F374638

General Info

Members Datasets Scaffolds Average Seq Length
267 137 534 209

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100053706|Ga0070664_1000537062
Length 219
Sequence MFRIFSTAIVTAILTSAFWIFYFNLGSAPAENGKVEASGDVAVVQPQSGQPVAIAEGVEVGPAGLAIPVQGIKANQLSDTFTQARAGGARVHDAIDIMAAEGTPVIAATDGTVEKLFYSNGGGGNTIYVRSPDQRWTYYYAHLQGYQPGLAEGQQVKRGQLIGRVGHTGNANPEGPHLHFAINRMQPGEKWWQGAPINPYPLLPEKRPAAKGASNPRGR

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
128 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
129 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
130 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
131 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
132 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
133 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100053706 3300005564 Bacteria 3416
2 JGI24747J21853_1016576 3300001978 Unclassified 780
3 JGI24740J21852_10021614 3300001979 Bacteria 2227
4 JGI24743J22301_10027188 3300001991 Bacteria 1116
5 JGI24738J21930_10007085 3300002075 Bacteria 2603
6 Ga0070658_10081021 3300005327 Bacteria 2666
7 Ga0070658_10108292 3300005327 Bacteria 2300
8 Ga0070658_10215529 3300005327 Bacteria 1622
9 Ga0070676_10029220 3300005328 Bacteria 3135
10 Ga0070683_100122797 3300005329 Bacteria 2453
11 Ga0070670_100012231 3300005331 Bacteria 7341
12 Ga0070670_100014327 3300005331 Bacteria 6802
13 Ga0070670_100066265 3300005331 Bacteria 3098
14 Ga0070670_100705421 3300005331 Bacteria 907
15 Ga0070677_10003399 3300005333 Bacteria 5131
16 Ga0068869_100347906 3300005334 Bacteria 1208
17 Ga0070660_100009801 3300005339 Bacteria 6751
18 Ga0070660_100019390 3300005339 Bacteria 4984
19 Ga0070660_100128118 3300005339 Bacteria 2029
20 Ga0070660_100674489 3300005339 Bacteria 866
21 Ga0070689_100248590 3300005340 Bacteria 1467
22 Ga0070661_100187976 3300005344 Bacteria 1574
23 Ga0070661_100400205 3300005344 Bacteria 1085
24 Ga0070692_10035501 3300005345 Bacteria 2524
25 Ga0070668_100840905 3300005347 Bacteria 817
26 Ga0070669_100014430 3300005353 Bacteria 5623
27 Ga0070669_100252842 3300005353 Bacteria 1403
28 Ga0070669_100290126 3300005353 Bacteria 1313
29 Ga0070675_100255185 3300005354 Bacteria 1535
30 Ga0070675_100547901 3300005354 Bacteria 1046
31 Ga0070671_100024813 3300005355 Bacteria 4912
32 Ga0070673_100080709 3300005364 Bacteria 2636
33 Ga0070659_100001560 3300005366 Bacteria 16514
34 Ga0070659_100151754 3300005366 Bacteria 1890
35 Ga0070659_100270577 3300005366 Bacteria 1412
36 Ga0070659_100435939 3300005366 Bacteria 1110
37 Ga0070667_100007536 3300005367 Bacteria 9028
38 Ga0070667_100067527 3300005367 Bacteria 3040
39 Ga0070667_100341291 3300005367 Bacteria 1355
40 Ga0070667_100481323 3300005367 Bacteria 1136
41 Ga0070667_100845801 3300005367 Bacteria 850
42 Ga0070667_100965486 3300005367 Bacteria 794
43 Ga0070705_100215696 3300005440 Bacteria 1326
44 Ga0070694_100579441 3300005444 Bacteria 901
45 Ga0070663_100005534 3300005455 Bacteria 7515
46 Ga0070662_100002872 3300005457 Bacteria 10690
47 Ga0070662_100006778 3300005457 Bacteria 7406
48 Ga0070662_100068928 3300005457 Bacteria 2602
49 Ga0070662_100104472 3300005457 Bacteria 2149
50 Ga0070662_100157592 3300005457 Bacteria 1773
51 Ga0070681_10099158 3300005458 Bacteria 2859
52 Ga0070679_100315667 3300005530 Bacteria 1512
53 Ga0070679_100830013 3300005530 Bacteria 867
54 Ga0070684_100375777 3300005535 Bacteria 1308
55 Ga0068853_100227607 3300005539 Bacteria 1705
56 Ga0070672_100440870 3300005543 Bacteria 1121
57 Ga0070665_100011849 3300005548 Bacteria 8809
58 Ga0070665_100056106 3300005548 Bacteria 3950
59 Ga0068857_100220732 3300005577 Bacteria 1731
60 Ga0068857_100398532 3300005577 Bacteria 1280
61 Ga0068854_100297001 3300005578 Bacteria 1305
62 Ga0068852_100080870 3300005616 Bacteria 2882
63 Ga0068859_100057367 3300005617 Bacteria 3922
64 Ga0068859_100092447 3300005617 Bacteria 3076
65 Ga0068859_101052348 3300005617 Bacteria 894
66 Ga0068864_100122209 3300005618 Bacteria 2329
67 Ga0068866_10456620 3300005718 Bacteria 837
68 Ga0068861_100656576 3300005719 Bacteria 969
69 Ga0068870_10574096 3300005840 Bacteria 763
70 Ga0068863_100067980 3300005841 Bacteria 3370
71 Ga0068863_100089870 3300005841 Bacteria 2912
72 Ga0068863_100917465 3300005841 Bacteria 877
73 Ga0068858_100042504 3300005842 Bacteria 4214
74 Ga0068858_100295941 3300005842 Bacteria 1543
75 Ga0068860_100057531 3300005843 Bacteria 3696
76 Ga0068860_100076393 3300005843 Bacteria 3186
77 Ga0068860_100094268 3300005843 Bacteria 2853
78 Ga0068860_100404762 3300005843 Bacteria 1350
79 Ga0068860_100994484 3300005843 Bacteria 856
80 Ga0068862_100074255 3300005844 Bacteria 2939
81 Ga0068862_100082482 3300005844 Bacteria 2790
82 Ga0068862_100403982 3300005844 Bacteria 1278
83 Ga0068862_100549456 3300005844 Bacteria 1103
84 Ga0097621_100930638 3300006237 Bacteria 811
85 Ga0075433_10102753 3300006852 Bacteria 2531
86 Ga0097620_100057378 3300006931 Bacteria 3922
87 Ga0097620_100092449 3300006931 Bacteria 3076
88 Ga0097620_101052423 3300006931 Bacteria 894
89 Ga0105243_10121653 3300009148 Bacteria 2201
90 Ga0105248_10128397 3300009177 Bacteria 2860
91 Ga0105248_10413001 3300009177 Bacteria 1520
92 Ga0105249_10477778 3300009553 Bacteria 1289
93 Ga0105249_10705217 3300009553 Bacteria 1069
94 Ga0105249_11190557 3300009553 Bacteria 833
95 Ga0105239_10531622 3300010375 Bacteria 1338
96 Ga0157373_10039789 3300013100 Bacteria 3365
97 Ga0157373_10062693 3300013100 Bacteria 2633
98 Ga0157371_10008583 3300013102 Bacteria 8122
99 Ga0157371_10034005 3300013102 Bacteria 3660
100 Ga0157371_10086682 3300013102 Bacteria 2217
101 Ga0157370_10122446 3300013104 Bacteria 2428
102 Ga0157369_10824741 3300013105 Bacteria 952
103 Ga0163162_10044435 3300013306 Bacteria 4450
104 Ga0163162_10157910 3300013306 Bacteria 2389
105 Ga0157372_10050615 3300013307 Bacteria 4620
106 Ga0157372_11396986 3300013307 Bacteria 807
107 Ga0157375_10088572 3300013308 Bacteria 3150
108 Ga0157379_10447585 3300014968 Bacteria 1192
109 Ga0213876_10101299 3300021384 Bacteria 1527
110 Ga0207697_10046060 3300025315 Bacteria 1795
111 Ga0207682_10014664 3300025893 Bacteria 3054
112 Ga0207642_10078690 3300025899 Bacteria 1594
113 Ga0207688_10129001 3300025901 Unclassified 1481
114 Ga0207647_10007288 3300025904 Bacteria 8006
115 Ga0207705_10018404 3300025909 Bacteria 4996
116 Ga0207705_10035422 3300025909 Bacteria 3570
117 Ga0207707_10231888 3300025912 Bacteria 1606
118 Ga0207660_10181641 3300025917 Bacteria 1634
119 Ga0207657_10000806 3300025919 Bacteria 33100
120 Ga0207657_10004231 3300025919 Bacteria 15210
121 Ga0207657_10069051 3300025919 Bacteria 3000
122 Ga0207657_10090179 3300025919 Bacteria 2559
123 Ga0207649_10068879 3300025920 Bacteria 2251
124 Ga0207652_10317047 3300025921 Unclassified 1407
125 Ga0207681_10043161 3300025923 Bacteria 3017
126 Ga0207681_10134206 3300025923 Bacteria 1834
127 Ga0207681_10137606 3300025923 Bacteria 1815
128 Ga0207681_10277436 3300025923 Bacteria 1318
129 Ga0207650_10029943 3300025925 Bacteria 3917
130 Ga0207650_10185363 3300025925 Bacteria 1660
131 Ga0207650_10350488 3300025925 Bacteria 1214
132 Ga0207650_10430351 3300025925 Bacteria 1096
133 Ga0207659_10005830 3300025926 Bacteria 7506
134 Ga0207659_10139880 3300025926 Bacteria 1878
135 Ga0207644_10042837 3300025931 Bacteria 3210
136 Ga0207690_10001480 3300025932 Bacteria 14676
137 Ga0207690_10208723 3300025932 Bacteria 1488
138 Ga0207690_10324949 3300025932 Bacteria 1210
139 Ga0207706_10011139 3300025933 Bacteria 8195
140 Ga0207706_10022657 3300025933 Bacteria 5637
141 Ga0207706_10035543 3300025933 Bacteria 4429
142 Ga0207706_10046937 3300025933 Bacteria 3823
143 Ga0207706_10070515 3300025933 Bacteria 3074
144 Ga0207686_10140504 3300025934 Bacteria 1668
145 Ga0207670_10433558 3300025936 Bacteria 1057
146 Ga0207691_10018682 3300025940 Bacteria 6567
147 Ga0207691_10156250 3300025940 Bacteria 2003
148 Ga0207711_10003402 3300025941 Bacteria 13771
149 Ga0207711_10020786 3300025941 Bacteria 5477
150 Ga0207689_10345752 3300025942 Bacteria 1236
151 Ga0207679_10020556 3300025945 Bacteria 4456
152 Ga0207679_10183898 3300025945 Bacteria 1731
153 Ga0207679_10531627 3300025945 Bacteria 1053
154 Ga0207667_10017089 3300025949 Bacteria 8180
155 Ga0207667_10097082 3300025949 Bacteria 3041
156 Ga0207667_10341800 3300025949 Bacteria 1527
157 Ga0207651_10020325 3300025960 Bacteria 4006
158 Ga0207712_10000491 3300025961 Bacteria 32766
159 Ga0207640_10148260 3300025981 Bacteria 1720
160 Ga0207658_10011213 3300025986 Bacteria 6106
161 Ga0207658_10042983 3300025986 Bacteria 3282
162 Ga0207658_10187733 3300025986 Bacteria 1715
163 Ga0207658_10381554 3300025986 Bacteria 1234
164 Ga0207658_11352026 3300025986 Bacteria 651
165 Ga0207703_10007086 3300026035 Bacteria 8920
166 Ga0207678_10008182 3300026067 Bacteria 9223
167 Ga0207678_10227953 3300026067 Bacteria 1595
168 Ga0207678_10344083 3300026067 Bacteria 1285
169 Ga0207641_10613573 3300026088 Bacteria 1066
170 Ga0207641_10863233 3300026088 Bacteria 897
171 Ga0207641_11086032 3300026088 Bacteria 798
172 Ga0207676_10115553 3300026095 Bacteria 2253
173 Ga0207674_10030489 3300026116 Bacteria 5668
174 Ga0207674_10212600 3300026116 Bacteria 1883
175 Ga0207674_10228831 3300026116 Bacteria 1807
176 Ga0207675_100470726 3300026118 Bacteria 1247
177 Ga0207698_10031114 3300026142 Bacteria 3848
178 Ga0209974_10004410 3300027876 Bacteria 5006
179 Ga0268266_10122275 3300028379 Bacteria 2317
180 Ga0268265_10183582 3300028380 Bacteria 1799
181 Ga0268264_10042735 3300028381 Bacteria 3752
182 Ga0268264_10055662 3300028381 Bacteria 3306
183 Ga0268264_10331510 3300028381 Bacteria 1442
184 Ga0268264_10560658 3300028381 Bacteria 1122
185 Ga0307408_100049507 3300031548 Bacteria 3018
186 Ga0307408_100283336 3300031548 Bacteria 1381
187 Ga0307405_10042201 3300031731 Bacteria 2775
188 Ga0307405_10103809 3300031731 Bacteria 1912
189 Ga0307405_10246316 3300031731 Bacteria 1327
190 Ga0307405_10289093 3300031731 Bacteria 1238
191 Ga0307413_10001989 3300031824 Bacteria 8117
192 Ga0307413_10009984 3300031824 Bacteria 4576
193 Ga0307413_10013292 3300031824 Bacteria 4133
194 Ga0307413_10020503 3300031824 Bacteria 3517
195 Ga0307410_10012326 3300031852 Bacteria 4939
196 Ga0307410_10017747 3300031852 Bacteria 4282
197 Ga0307410_10022802 3300031852 Bacteria 3877
198 Ga0307410_10034618 3300031852 Bacteria 3273
199 Ga0307410_10306705 3300031852 Bacteria 1254
200 Ga0307406_10180347 3300031901 Bacteria 1537
201 Ga0307406_10449396 3300031901 Bacteria 1033
202 Ga0307407_10005842 3300031903 Bacteria 5391
203 Ga0307407_10076834 3300031903 Bacteria 2006
204 Ga0307407_10180901 3300031903 Bacteria 1397
205 Ga0307407_10681545 3300031903 Bacteria 772
206 Ga0307412_10018794 3300031911 Bacteria 4168
207 Ga0307412_10174962 3300031911 Bacteria 1608
208 Ga0307412_10401406 3300031911 Bacteria 1116
209 Ga0307412_10687320 3300031911 Bacteria 877
210 Ga0307409_100012991 3300031995 Bacteria 5335
211 Ga0307409_100053897 3300031995 Bacteria 3094
212 Ga0307409_100063454 3300031995 Bacteria 2897
213 Ga0307409_100212685 3300031995 Bacteria 1739
214 Ga0307416_100039147 3300032002 Bacteria 3667
215 Ga0307416_100040236 3300032002 Bacteria 3629
216 Ga0307416_100247083 3300032002 Bacteria 1734
217 Ga0307416_100327589 3300032002 Bacteria 1537
218 Ga0307416_100361705 3300032002 Bacteria 1473
219 Ga0307416_100803111 3300032002 Bacteria 1037
220 Ga0307414_10008408 3300032004 Bacteria 5852
221 Ga0307414_10027812 3300032004 Bacteria 3659
222 Ga0307414_10058108 3300032004 Bacteria 2723
223 Ga0307414_10066727 3300032004 Bacteria 2573
224 Ga0307414_10122166 3300032004 Bacteria 2004
225 Ga0307414_10295517 3300032004 Bacteria 1367
226 Ga0307411_10001600 3300032005 Bacteria 9407
227 Ga0307411_10004837 3300032005 Bacteria 6533
228 Ga0307411_10013047 3300032005 Bacteria 4565
229 Ga0307411_10052763 3300032005 Bacteria 2660
230 Ga0307411_10065635 3300032005 Bacteria 2435
231 Ga0307411_10118690 3300032005 Bacteria 1909
232 Ga0307411_10611450 3300032005 Bacteria 938
233 Ga0307415_100092219 3300032126 Bacteria 2196
234 Ga0307415_100132534 3300032126 Bacteria 1889
235 Ga0307415_100279749 3300032126 Bacteria 1371
236 Ga0307415_100307191 3300032126 Bacteria 1316
237 Ga0395899_0211171 3300037312 Bacteria 1349
238 Ga0395900_0035044 3300037418 Bacteria 5169
239 Ga0395900_0269918 3300037418 Bacteria 1696
240 Ga0395900_0645632 3300037418 Bacteria 995
241 Ga0395905_0016582 3300037471 Bacteria 7002
242 Ga0395905_0196679 3300037471 Bacteria 1891
243 Ga0395901_0972916 3300038443 Bacteria 826
244 Ga0439436_0089768 3300041404 Bacteria 856
245 Ga0439447_095470 3300041407 Bacteria 683
246 Ga0439432_077604 3300042006 Bacteria 1008
247 Ga0439434_0034812 3300042435 Bacteria 1538
248 Ga0466969_0194555 3300044656 Bacteria 926
249 Ga0466965_0177117 3300044683 Bacteria 1124
250 Ga0466966_0034921 3300044684 Bacteria 3250
251 Ga0495668_0071656 3300046616 Bacteria 1904
252 Ga0495668_0291602 3300046616 Bacteria 894
253 Ga0496102_0598531 3300048905 Bacteria 1026
254 Ga0496107_0119504 3300048910 Bacteria 1941
255 Ga0496107_0344532 3300048910 Bacteria 1109
256 Ga0496108_1001440 3300048911 Bacteria 714
257 Ga0501227_075255 3300049665 Bacteria 880
258 Ga0501233_024527 3300049668 Bacteria 1320
259 Ga0501236_011443 3300049670 Bacteria 1179
260 Ga0501257_026215 3300049686 Bacteria 1390
261 Ga0501267_016202 3300049764 Bacteria 793
262 Ga0501268_009892 3300049765 Bacteria 1474
263 Ga0501270_055781 3300049767 Bacteria 728
264 nmdc:mga0n895_663983_c1 3300050512 Bacteria 1040
265 nmdc:mga0a205_14843_c1 3300050515 Bacteria 7270
266 Ga0500643_000001 3300053087 Bacteria 1440111
267 Ga0500616_0002601 3300053153 Bacteria 14774
268 Ga0070664_100053706
269 JGI24747J21853_1016576
270 JGI24740J21852_10021614
271 JGI24743J22301_10027188
272 JGI24738J21930_10007085
273 Ga0070658_10081021
274 Ga0070658_10108292
275 Ga0070658_10215529
276 Ga0070676_10029220
277 Ga0070683_100122797
278 Ga0070670_100012231
279 Ga0070670_100014327
280 Ga0070670_100066265
281 Ga0070670_100705421
282 Ga0070677_10003399
283 Ga0068869_100347906
284 Ga0070660_100009801
285 Ga0070660_100019390
286 Ga0070660_100128118
287 Ga0070660_100674489
288 Ga0070689_100248590
289 Ga0070661_100187976
290 Ga0070661_100400205
291 Ga0070692_10035501
292 Ga0070668_100840905
293 Ga0070669_100014430
294 Ga0070669_100252842
295 Ga0070669_100290126
296 Ga0070675_100255185
297 Ga0070675_100547901
298 Ga0070671_100024813
299 Ga0070673_100080709
300 Ga0070659_100001560
301 Ga0070659_100151754
302 Ga0070659_100270577
303 Ga0070659_100435939
304 Ga0070667_100007536
305 Ga0070667_100067527
306 Ga0070667_100341291
307 Ga0070667_100481323
308 Ga0070667_100845801
309 Ga0070667_100965486
310 Ga0070705_100215696
311 Ga0070694_100579441
312 Ga0070663_100005534
313 Ga0070662_100002872
314 Ga0070662_100006778
315 Ga0070662_100068928
316 Ga0070662_100104472
317 Ga0070662_100157592
318 Ga0070681_10099158
319 Ga0070679_100315667
320 Ga0070679_100830013
321 Ga0070684_100375777
322 Ga0068853_100227607
323 Ga0070672_100440870
324 Ga0070665_100011849
325 Ga0070665_100056106
326 Ga0068857_100220732
327 Ga0068857_100398532
328 Ga0068854_100297001
329 Ga0068852_100080870
330 Ga0068859_100057367
331 Ga0068859_100092447
332 Ga0068859_101052348
333 Ga0068864_100122209
334 Ga0068866_10456620
335 Ga0068861_100656576
336 Ga0068870_10574096
337 Ga0068863_100067980
338 Ga0068863_100089870
339 Ga0068863_100917465
340 Ga0068858_100042504
341 Ga0068858_100295941
342 Ga0068860_100057531
343 Ga0068860_100076393
344 Ga0068860_100094268
345 Ga0068860_100404762
346 Ga0068860_100994484
347 Ga0068862_100074255
348 Ga0068862_100082482
349 Ga0068862_100403982
350 Ga0068862_100549456
351 Ga0097621_100930638
352 Ga0075433_10102753
353 Ga0097620_100057378
354 Ga0097620_100092449
355 Ga0097620_101052423
356 Ga0105243_10121653
357 Ga0105248_10128397
358 Ga0105248_10413001
359 Ga0105249_10477778
360 Ga0105249_10705217
361 Ga0105249_11190557
362 Ga0105239_10531622
363 Ga0157373_10039789
364 Ga0157373_10062693
365 Ga0157371_10008583
366 Ga0157371_10034005
367 Ga0157371_10086682
368 Ga0157370_10122446
369 Ga0157369_10824741
370 Ga0163162_10044435
371 Ga0163162_10157910
372 Ga0157372_10050615
373 Ga0157372_11396986
374 Ga0157375_10088572
375 Ga0157379_10447585
376 Ga0213876_10101299
377 Ga0207697_10046060
378 Ga0207682_10014664
379 Ga0207642_10078690
380 Ga0207688_10129001
381 Ga0207647_10007288
382 Ga0207705_10018404
383 Ga0207705_10035422
384 Ga0207707_10231888
385 Ga0207660_10181641
386 Ga0207657_10000806
387 Ga0207657_10004231
388 Ga0207657_10069051
389 Ga0207657_10090179
390 Ga0207649_10068879
391 Ga0207652_10317047
392 Ga0207681_10043161
393 Ga0207681_10134206
394 Ga0207681_10137606
395 Ga0207681_10277436
396 Ga0207650_10029943
397 Ga0207650_10185363
398 Ga0207650_10350488
399 Ga0207650_10430351
400 Ga0207659_10005830
401 Ga0207659_10139880
402 Ga0207644_10042837
403 Ga0207690_10001480
404 Ga0207690_10208723
405 Ga0207690_10324949
406 Ga0207706_10011139
407 Ga0207706_10022657
408 Ga0207706_10035543
409 Ga0207706_10046937
410 Ga0207706_10070515
411 Ga0207686_10140504
412 Ga0207670_10433558
413 Ga0207691_10018682
414 Ga0207691_10156250
415 Ga0207711_10003402
416 Ga0207711_10020786
417 Ga0207689_10345752
418 Ga0207679_10020556
419 Ga0207679_10183898
420 Ga0207679_10531627
421 Ga0207667_10017089
422 Ga0207667_10097082
423 Ga0207667_10341800
424 Ga0207651_10020325
425 Ga0207712_10000491
426 Ga0207640_10148260
427 Ga0207658_10011213
428 Ga0207658_10042983
429 Ga0207658_10187733
430 Ga0207658_10381554
431 Ga0207658_11352026
432 Ga0207703_10007086
433 Ga0207678_10008182
434 Ga0207678_10227953
435 Ga0207678_10344083
436 Ga0207641_10613573
437 Ga0207641_10863233
438 Ga0207641_11086032
439 Ga0207676_10115553
440 Ga0207674_10030489
441 Ga0207674_10212600
442 Ga0207674_10228831
443 Ga0207675_100470726
444 Ga0207698_10031114
445 Ga0209974_10004410
446 Ga0268266_10122275
447 Ga0268265_10183582
448 Ga0268264_10042735
449 Ga0268264_10055662
450 Ga0268264_10331510
451 Ga0268264_10560658
452 Ga0307408_100049507
453 Ga0307408_100283336
454 Ga0307405_10042201
455 Ga0307405_10103809
456 Ga0307405_10246316
457 Ga0307405_10289093
458 Ga0307413_10001989
459 Ga0307413_10009984
460 Ga0307413_10013292
461 Ga0307413_10020503
462 Ga0307410_10012326
463 Ga0307410_10017747
464 Ga0307410_10022802
465 Ga0307410_10034618
466 Ga0307410_10306705
467 Ga0307406_10180347
468 Ga0307406_10449396
469 Ga0307407_10005842
470 Ga0307407_10076834
471 Ga0307407_10180901
472 Ga0307407_10681545
473 Ga0307412_10018794
474 Ga0307412_10174962
475 Ga0307412_10401406
476 Ga0307412_10687320
477 Ga0307409_100012991
478 Ga0307409_100053897
479 Ga0307409_100063454
480 Ga0307409_100212685
481 Ga0307416_100039147
482 Ga0307416_100040236
483 Ga0307416_100247083
484 Ga0307416_100327589
485 Ga0307416_100361705
486 Ga0307416_100803111
487 Ga0307414_10008408
488 Ga0307414_10027812
489 Ga0307414_10058108
490 Ga0307414_10066727
491 Ga0307414_10122166
492 Ga0307414_10295517
493 Ga0307411_10001600
494 Ga0307411_10004837
495 Ga0307411_10013047
496 Ga0307411_10052763
497 Ga0307411_10065635
498 Ga0307411_10118690
499 Ga0307411_10611450
500 Ga0307415_100092219
501 Ga0307415_100132534
502 Ga0307415_100279749
503 Ga0307415_100307191
504 Ga0395899_0211171
505 Ga0395900_0035044
506 Ga0395900_0269918
507 Ga0395900_0645632
508 Ga0395905_0016582
509 Ga0395905_0196679
510 Ga0395901_0972916
511 Ga0439436_0089768
512 Ga0439447_095470
513 Ga0439432_077604
514 Ga0439434_0034812
515 Ga0466969_0194555
516 Ga0466965_0177117
517 Ga0466966_0034921
518 Ga0495668_0071656
519 Ga0495668_0291602
520 Ga0496102_0598531
521 Ga0496107_0119504
522 Ga0496107_0344532
523 Ga0496108_1001440
524 Ga0501227_075255
525 Ga0501233_024527
526 Ga0501236_011443
527 Ga0501257_026215
528 Ga0501267_016202
529 Ga0501268_009892
530 Ga0501270_055781
531 nmdc:mga0n895_663983_c1
532 nmdc:mga0a205_14843_c1
533 Ga0500643_000001
534 Ga0500616_0002601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

90

199

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rny-assembly1.cif.gz_A structure of helicobacter pylori csd3 from the orthorhombic crystal 0.9141 91 203
4lxc-assembly5.cif.gz_C-2 the antimicrobial peptidase lysostaphin from staphylococcus simulans 0.9078 93 203
4qpb-assembly1.cif.gz_A catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate 0.9067 90 201
3slu-assembly2.cif.gz_B crystal structure of nmb0315 0.9067 92 206
6smk-assembly1.cif.gz_A crystal structure of catalytic domain a109h mutant of prophage-encoded m23 protein enpa from enterococcus faecalis. 0.9066 90 199
ID Description Score Start End Superfamily
3sluA03 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9432 91 199 2.70.70.10
4qpbA00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9067 90 201 2.70.70.10
2hsiA02 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8903 61 207 2.70.70.10
1qwyA02 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8844 92 203 2.70.70.10
af_Q2FYC8_1682_1819_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8764 89 199 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A2I6QH46-F1-model_v4 M23/M37 family peptidase 0.9839 107 203 GO:0004222
AF-A0A7X8MDG7-F1-model_v4 M23 family metallopeptidase 0.9802 91 200 GO:0004222
GO:0005886
GO:0046872
AF-A0A520J8R3-F1-model_v4 M23 family peptidase 0.9795 105 179
AF-A0A2V8GCS9-F1-model_v4 Metalloendopeptidase 0.9723 93 200 GO:0004222
AF-A0A7W0R7M5-F1-model_v4 M23 family metallopeptidase 0.9711 97 203 GO:0004222

Map