F374609

General Info

Members Datasets Scaffolds Average Seq Length
267 128 534 329

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100001024|Ga0070698_10000102418
Length 355
Sequence MSIYITRPITLHAVNTYPLASRKSKVNIKDFAKPPASNPSLMKFLDSLPHFLAAQDLRHLLAAIHGARKDGKPILWGIGGHVIKVGLGPVLIDLIRRDFVSALAMNGAALIHDFEIALAGNTSEDVEVNLDSGKFGMAAETGEYLNQIAKLAPRLRIGYGEAAGQFLTSGVLDLRHAHSSVLVAAYKRRVPVTIHLAIGTDIPHMHPAVDSSALGIAAHHDFRLFCSLVKEMHPGGVYLNWGSAVLLPEVFLKAVSVVRNLGVPLRPITTANFDFLQHYRPLQNVVKRPTASQAGSRGPESRGYAITGHHEILLPLVAAALASGWPKASPLPSSTRTRGRGSPAQSRHPSSVPRK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.62
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 12.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100001024 3300005471 Bacteria 30722
2 Ga0065707_10022485 3300005295 Bacteria 1857
3 Ga0070680_100116401 3300005336 Bacteria 2228
4 Ga0070703_10000078 3300005406 Bacteria 48341
5 Ga0070703_10004572 3300005406 Bacteria 3888
6 Ga0070709_10000237 3300005434 Bacteria 35643
7 Ga0070709_10001163 3300005434 Bacteria 14432
8 Ga0070709_10036680 3300005434 Bacteria 2989
9 Ga0070709_10068252 3300005434 Bacteria 2286
10 Ga0070714_100268747 3300005435 Bacteria 1581
11 Ga0070713_100000907 3300005436 Bacteria 18932
12 Ga0070713_100229778 3300005436 Bacteria 1686
13 Ga0070701_10056091 3300005438 Bacteria 2060
14 Ga0070711_100000027 3300005439 Bacteria 108952
15 Ga0070711_100039578 3300005439 Bacteria 3177
16 Ga0070711_100225126 3300005439 Bacteria 1460
17 Ga0070705_100000397 3300005440 Bacteria 25329
18 Ga0070694_100002730 3300005444 Bacteria 10471
19 Ga0070708_100004033 3300005445 Bacteria 11540
20 Ga0070708_100008725 3300005445 Bacteria 8146
21 Ga0070708_100010982 3300005445 Bacteria 7358
22 Ga0070708_100057360 3300005445 Bacteria 3467
23 Ga0070662_100198613 3300005457 Bacteria 1590
24 Ga0070681_10313393 3300005458 Bacteria 1478
25 Ga0070706_100000320 3300005467 Bacteria 58537
26 Ga0070706_100012173 3300005467 Bacteria 7975
27 Ga0070706_100195558 3300005467 Unclassified 1889
28 Ga0070706_100210607 3300005467 Bacteria 1815
29 Ga0070707_100000983 3300005468 Bacteria 28206
30 Ga0070707_100002408 3300005468 Bacteria 17848
31 Ga0070707_100038808 3300005468 Bacteria 4549
32 Ga0070707_100143009 3300005468 Unclassified 2328
33 Ga0070707_100307653 3300005468 Unclassified 1540
34 Ga0070698_100010649 3300005471 Bacteria 9800
35 Ga0070698_100098847 3300005471 Bacteria 2892
36 Ga0070699_100000194 3300005518 Bacteria 59391
37 Ga0070699_100001335 3300005518 Bacteria 22694
38 Ga0070699_100012685 3300005518 Bacteria 7267
39 Ga0070699_100046599 3300005518 Bacteria 3751
40 Ga0070697_100001113 3300005536 Bacteria 20323
41 Ga0070697_100001253 3300005536 Bacteria 19201
42 Ga0070697_100024949 3300005536 Bacteria 4763
43 Ga0070697_100173339 3300005536 Unclassified 1827
44 Ga0070686_100218479 3300005544 Unclassified 1376
45 Ga0070695_100018245 3300005545 Bacteria 4260
46 Ga0070695_100159261 3300005545 Archaea 1583
47 Ga0070696_100000242 3300005546 Bacteria 32817
48 Ga0070696_100004471 3300005546 Bacteria 9335
49 Ga0070696_100054834 3300005546 Bacteria 2779
50 Ga0070693_100000102 3300005547 Bacteria 37722
51 Ga0070693_100066660 3300005547 Bacteria 2107
52 Ga0070665_100001198 3300005548 Bacteria 31613
53 Ga0070704_100001455 3300005549 Bacteria 12695
54 Ga0068859_100594080 3300005617 Bacteria 1200
55 Ga0068863_100011038 3300005841 Bacteria 8763
56 Ga0068858_100144251 3300005842 Bacteria 2236
57 Ga0068860_100254969 3300005843 Unclassified 1709
58 Ga0070716_100000676 3300006173 Bacteria 14574
59 Ga0070716_100027406 3300006173 Bacteria 3061
60 Ga0070716_100030951 3300006173 Bacteria 2908
61 Ga0070716_100169723 3300006173 Bacteria 1423
62 Ga0070716_100229235 3300006173 Bacteria 1253
63 Ga0070712_100046551 3300006175 Bacteria 2999
64 Ga0068871_100007273 3300006358 Bacteria 7897
65 Ga0068871_100081118 3300006358 Bacteria 2687
66 Ga0075433_10218130 3300006852 Bacteria 1695
67 Ga0075434_100007292 3300006871 Bacteria 10231
68 Ga0075434_100009700 3300006871 Bacteria 8997
69 Ga0075434_100083879 3300006871 Bacteria 3185
70 Ga0075434_100147880 3300006871 Unclassified 2370
71 Ga0075429_100068451 3300006880 Bacteria 3090
72 Ga0068865_100456627 3300006881 Unclassified 1057
73 Ga0075436_100091710 3300006914 Bacteria 2112
74 Ga0075436_100186142 3300006914 Unclassified 1468
75 Ga0097620_100594041 3300006931 Bacteria 1200
76 Ga0075435_100159420 3300007076 Unclassified 1900
77 Ga0099794_10005917 3300007265 Bacteria 4932
78 Ga0099794_10017359 3300007265 Bacteria 3206
79 Ga0099794_10046903 3300007265 Bacteria 2071
80 Ga0099794_10050658 3300007265 Bacteria 1998
81 Ga0099794_10068463 3300007265 Bacteria 1736
82 Ga0105240_10002535 3300009093 Bacteria 29306
83 Ga0105247_10025966 3300009101 Bacteria 3536
84 Ga0114129_10091695 3300009147 Bacteria 4209
85 Ga0114129_10286555 3300009147 Bacteria 2199
86 Ga0114129_10526813 3300009147 Bacteria 1540
87 Ga0105248_10101396 3300009177 Bacteria 3245
88 Ga0105237_10048877 3300009545 Bacteria 4252
89 Ga0099796_10013128 3300010159 Unclassified 2358
90 Ga0105239_10188063 3300010375 Bacteria 2311
91 Ga0157378_10000582 3300013297 Bacteria 34326
92 Ga0157378_10007470 3300013297 Bacteria 9549
93 Ga0163162_10040103 3300013306 Bacteria 4681
94 Ga0157372_10069295 3300013307 Bacteria 3967
95 Ga0157375_10181323 3300013308 Unclassified 2257
96 Ga0163163_10164513 3300014325 Bacteria 2264
97 Ga0157379_10009600 3300014968 Bacteria 8426
98 Ga0157379_10075338 3300014968 Bacteria 3021
99 Ga0157376_10000005 3300014969 Bacteria 443695
100 Ga0157376_10002022 3300014969 Bacteria 13602
101 Ga0207653_10000021 3300025885 Bacteria 127411
102 Ga0207653_10004656 3300025885 Bacteria 4297
103 Ga0207699_10000017 3300025906 Bacteria 189613
104 Ga0207699_10001399 3300025906 Bacteria 11448
105 Ga0207699_10004530 3300025906 Bacteria 6637
106 Ga0207699_10022034 3300025906 Bacteria 3446
107 Ga0207684_10000394 3300025910 Bacteria 58364
108 Ga0207684_10020925 3300025910 Bacteria 5586
109 Ga0207684_10023955 3300025910 Bacteria 5208
110 Ga0207684_10054910 3300025910 Bacteria 3380
111 Ga0207695_10008578 3300025913 Bacteria 12772
112 Ga0207671_10119034 3300025914 Unclassified 2017
113 Ga0207693_10016332 3300025915 Bacteria 5935
114 Ga0207693_10040680 3300025915 Bacteria 3661
115 Ga0207693_10058864 3300025915 Bacteria 3010
116 Ga0207663_10000006 3300025916 Bacteria 253740
117 Ga0207663_10024088 3300025916 Bacteria 3502
118 Ga0207663_10208861 3300025916 Bacteria 1413
119 Ga0207646_10000282 3300025922 Bacteria 69731
120 Ga0207646_10003445 3300025922 Bacteria 17862
121 Ga0207646_10005298 3300025922 Bacteria 13595
122 Ga0207646_10054432 3300025922 Unclassified 3579
123 Ga0207665_10000020 3300025939 Bacteria 117316
124 Ga0207665_10010922 3300025939 Bacteria 5960
125 Ga0207665_10013336 3300025939 Bacteria 5403
126 Ga0207665_10021990 3300025939 Bacteria 4193
127 Ga0207665_10031156 3300025939 Bacteria 3528
128 Ga0207665_10053730 3300025939 Bacteria 2715
129 Ga0207711_10076880 3300025941 Bacteria 2909
130 Ga0207689_10237106 3300025942 Bacteria 1508
131 Ga0207641_10059055 3300026088 Unclassified 3265
132 Ga0207641_10495227 3300026088 Bacteria 1186
133 Ga0209588_1000388 3300027671 Bacteria 11430
134 Ga0209588_1000676 3300027671 Bacteria 8568
135 Ga0209588_1001439 3300027671 Bacteria 6217
136 Ga0209588_1005909 3300027671 Bacteria 3527
137 Ga0268266_10000661 3300028379 Bacteria 46641
138 Ga0268264_10189556 3300028381 Unclassified 1873
139 Ga0268264_10280395 3300028381 Unclassified 1561
140 Ga0265318_10011328 3300028577 Bacteria 3843
141 Ga0265770_1002445 3300030878 Unclassified 2518
142 Ga0265770_1008488 3300030878 Unclassified 1466
143 Ga0265760_10007905 3300031090 Bacteria 3038
144 Ga0265760_10033050 3300031090 Unclassified 1528
145 Ga0265327_10028361 3300031251 Bacteria 3204
146 Ga0373928_0000970 3300035084 Bacteria 5623
147 Ga0373934_0019098 3300035086 Bacteria 2628
148 Ga0373953_0011310 3300035117 Bacteria 3129
149 Ga0373954_0003291 3300035118 Bacteria 6822
150 Ga0373956_0113414 3300035119 Bacteria 1263
151 Ga0373957_0006245 3300035120 Bacteria 3746
152 Ga0373946_0014638 3300035171 Bacteria 2960
153 Ga0373955_0000538 3300035172 Bacteria 16066
154 Ga0373924_0028147 3300035410 Bacteria 2238
155 Ga0373931_0114653 3300035691 Bacteria 1533
156 Ga0373927_0072391 3300035695 Bacteria 2230
157 Ga0373933_0000280 3300035724 Bacteria 33213
158 Ga0373937_0000932 3300036401 Bacteria 24796
159 Ga0373937_0058054 3300036401 Bacteria 3555
160 Ga0373925_0006884 3300037068 Bacteria 8321
161 Ga0373925_0048267 3300037068 Bacteria 3172
162 Ga0436365_1907769 3300039437 Unclassified 1222
163 Ga0451577_0000035 3300042876 Bacteria 373467
164 Ga0451577_0001096 3300042876 Bacteria 38706
165 Ga0451577_0001321 3300042876 Bacteria 33791
166 Ga0451577_0004502 3300042876 Bacteria 14680
167 Ga0451577_0023875 3300042876 Bacteria 5571
168 Ga0451577_0029426 3300042876 Bacteria 4965
169 Ga0451577_0033010 3300042876 Bacteria 4665
170 Ga0451577_0038824 3300042876 Bacteria 4281
171 Ga0451577_0049916 3300042876 Bacteria 3735
172 Ga0451577_0060585 3300042876 Bacteria 3374
173 Ga0451577_0193716 3300042876 Bacteria 1834
174 Ga0453683_0000030 3300044673 Bacteria 242193
175 Ga0453683_0000054 3300044673 Bacteria 194357
176 Ga0453683_0000071 3300044673 Bacteria 158207
177 Ga0453683_0000121 3300044673 Bacteria 116746
178 Ga0453683_0000184 3300044673 Bacteria 86818
179 Ga0453683_0000377 3300044673 Bacteria 53278
180 Ga0453683_0001443 3300044673 Bacteria 20575
181 Ga0453683_0003039 3300044673 Bacteria 12555
182 Ga0453683_0004193 3300044673 Bacteria 10308
183 Ga0453683_0038562 3300044673 Bacteria 3004
184 Ga0453683_0044367 3300044673 Bacteria 2790
185 Ga0453683_0046593 3300044673 Bacteria 2718
186 Ga0453683_0120698 3300044673 Bacteria 1650
187 Ga0453684_0000097 3300044712 Bacteria 377772
188 Ga0453684_0000710 3300044712 Bacteria 117944
189 Ga0453684_0002350 3300044712 Bacteria 46268
190 Ga0453684_0002524 3300044712 Bacteria 44110
191 Ga0453684_0003633 3300044712 Bacteria 34344
192 Ga0453684_0008782 3300044712 Bacteria 17935
193 Ga0453684_0012808 3300044712 Bacteria 13751
194 Ga0453684_0014325 3300044712 Bacteria 12702
195 Ga0453684_0015950 3300044712 Bacteria 11812
196 Ga0453684_0018036 3300044712 Bacteria 10866
197 Ga0453684_0018317 3300044712 Bacteria 10761
198 Ga0453684_0024890 3300044712 Bacteria 8717
199 Ga0453684_0025262 3300044712 Bacteria 8632
200 Ga0453684_0036125 3300044712 Bacteria 6815
201 Ga0453684_0110254 3300044712 Bacteria 3345
202 Ga0453684_0177014 3300044712 Bacteria 2508
203 Ga0453684_0191794 3300044712 Bacteria 2390
204 Ga0453684_0242745 3300044712 Bacteria 2073
205 Ga0453684_0339011 3300044712 Bacteria 1698
206 Ga0453684_0776219 3300044712 Bacteria 1035
207 Ga0451576_0000847 3300045051 Bacteria 59370
208 Ga0451576_0005482 3300045051 Bacteria 15880
209 Ga0451576_0015246 3300045051 Bacteria 8522
210 Ga0451576_0076449 3300045051 Bacteria 3484
211 Ga0451576_0128735 3300045051 Bacteria 2639
212 Ga0451576_0156478 3300045051 Unclassified 2377
213 Ga0451576_0168028 3300045051 Bacteria 2289
214 Ga0451576_0180447 3300045051 Bacteria 2204
215 Ga0451576_0222222 3300045051 Bacteria 1972
216 Ga0451576_0237409 3300045051 Unclassified 1904
217 Ga0451576_0727312 3300045051 Bacteria 1043
218 Ga0495629_0006758 3300046459 Bacteria 8476
219 Ga0495641_0020395 3300046461 Bacteria 3361
220 Ga0495651_0018960 3300046462 Bacteria 5330
221 Ga0495580_0060177 3300046472 Bacteria 2669
222 Ga0495580_0081783 3300046472 Bacteria 2251
223 Ga0495582_0098690 3300046473 Bacteria 1634
224 Ga0495662_0128351 3300046476 Bacteria 1246
225 Ga0495630_0058238 3300046517 Bacteria 2896
226 Ga0495630_0078200 3300046517 Unclassified 2494
227 Ga0495665_0020054 3300046531 Bacteria 3593
228 Ga0495586_0009283 3300046535 Bacteria 5231
229 Ga0495587_0024148 3300046536 Bacteria 3729
230 Ga0495645_0030318 3300046543 Bacteria 3938
231 Ga0495634_0062011 3300046642 Unclassified 2484
232 Ga0495635_0055158 3300046663 Bacteria 2738
233 Ga0495658_0128766 3300046683 Unclassified 1538
234 Ga0495624_0117795 3300046690 Bacteria 1632
235 Ga0495604_0007684 3300047317 Bacteria 8540
236 Ga0495674_0221085 3300047319 Unclassified 1565
237 Ga0495676_0152069 3300047321 Unclassified 1646
238 Ga0495680_0033444 3300047322 Bacteria 4163
239 Ga0495684_0030902 3300047471 Bacteria 4112
240 Ga0495602_0055366 3300048088 Bacteria 3493
241 Ga0495614_0038718 3300048089 Bacteria 2046
242 Ga0496100_0015461 3300048903 Bacteria 4458
243 Ga0496101_0051864 3300048904 Bacteria 2957
244 Ga0496102_0001293 3300048905 Bacteria 22508
245 Ga0496104_0093173 3300048907 Bacteria 2881
246 Ga0496110_0097482 3300048913 Bacteria 2635
247 Ga0496114_0071169 3300048917 Bacteria 2922
248 Ga0496115_0001061 3300048918 Bacteria 19923
249 nmdc:mga05p37_107_c1 3300050507 Bacteria 75468
250 nmdc:mga05p37_233588_c1 3300050507 Bacteria 2214
251 nmdc:mga09592_109000_c1 3300050508 Bacteria 2375
252 nmdc:mga0n895_165621_c1 3300050512 Unclassified 2242
253 nmdc:mga0n895_27769_c1 3300050512 Bacteria 5379
254 nmdc:mga0n895_85231_c1 3300050512 Unclassified 3154
255 nmdc:mga0n895_85909_c1 3300050512 Bacteria 3142
256 nmdc:mga0rr50_147180_c1 3300050513 Unclassified 1900
257 nmdc:mga0rr50_174364_c1 3300050513 Unclassified 1754
258 nmdc:mga0rr50_266003_c2 3300050513 Bacteria 1000
259 nmdc:mga0rr50_276539_c1 3300050513 Bacteria 1400
260 nmdc:mga08x19_11784_c1 3300050514 Bacteria 5264
261 nmdc:mga08x19_24743_c1 3300050514 Bacteria 3736
262 nmdc:mga08x19_42451_c1 3300050514 Bacteria 2899
263 nmdc:mga08x19_566_c1 3300050514 Bacteria 24232
264 nmdc:mga0a205_421877_c1 3300050515 Bacteria 1196
265 nmdc:mga0a205_65482_c1 3300050515 Unclassified 3511
266 Ga0495612_0035890 3300053078 Bacteria 2011
267 Ga0495619_0006292 3300053085 Bacteria 7532
268 Ga0070698_100001024
269 Ga0065707_10022485
270 Ga0070680_100116401
271 Ga0070703_10000078
272 Ga0070703_10004572
273 Ga0070709_10000237
274 Ga0070709_10001163
275 Ga0070709_10036680
276 Ga0070709_10068252
277 Ga0070714_100268747
278 Ga0070713_100000907
279 Ga0070713_100229778
280 Ga0070701_10056091
281 Ga0070711_100000027
282 Ga0070711_100039578
283 Ga0070711_100225126
284 Ga0070705_100000397
285 Ga0070694_100002730
286 Ga0070708_100004033
287 Ga0070708_100008725
288 Ga0070708_100010982
289 Ga0070708_100057360
290 Ga0070662_100198613
291 Ga0070681_10313393
292 Ga0070706_100000320
293 Ga0070706_100012173
294 Ga0070706_100195558
295 Ga0070706_100210607
296 Ga0070707_100000983
297 Ga0070707_100002408
298 Ga0070707_100038808
299 Ga0070707_100143009
300 Ga0070707_100307653
301 Ga0070698_100010649
302 Ga0070698_100098847
303 Ga0070699_100000194
304 Ga0070699_100001335
305 Ga0070699_100012685
306 Ga0070699_100046599
307 Ga0070697_100001113
308 Ga0070697_100001253
309 Ga0070697_100024949
310 Ga0070697_100173339
311 Ga0070686_100218479
312 Ga0070695_100018245
313 Ga0070695_100159261
314 Ga0070696_100000242
315 Ga0070696_100004471
316 Ga0070696_100054834
317 Ga0070693_100000102
318 Ga0070693_100066660
319 Ga0070665_100001198
320 Ga0070704_100001455
321 Ga0068859_100594080
322 Ga0068863_100011038
323 Ga0068858_100144251
324 Ga0068860_100254969
325 Ga0070716_100000676
326 Ga0070716_100027406
327 Ga0070716_100030951
328 Ga0070716_100169723
329 Ga0070716_100229235
330 Ga0070712_100046551
331 Ga0068871_100007273
332 Ga0068871_100081118
333 Ga0075433_10218130
334 Ga0075434_100007292
335 Ga0075434_100009700
336 Ga0075434_100083879
337 Ga0075434_100147880
338 Ga0075429_100068451
339 Ga0068865_100456627
340 Ga0075436_100091710
341 Ga0075436_100186142
342 Ga0097620_100594041
343 Ga0075435_100159420
344 Ga0099794_10005917
345 Ga0099794_10017359
346 Ga0099794_10046903
347 Ga0099794_10050658
348 Ga0099794_10068463
349 Ga0105240_10002535
350 Ga0105247_10025966
351 Ga0114129_10091695
352 Ga0114129_10286555
353 Ga0114129_10526813
354 Ga0105248_10101396
355 Ga0105237_10048877
356 Ga0099796_10013128
357 Ga0105239_10188063
358 Ga0157378_10000582
359 Ga0157378_10007470
360 Ga0163162_10040103
361 Ga0157372_10069295
362 Ga0157375_10181323
363 Ga0163163_10164513
364 Ga0157379_10009600
365 Ga0157379_10075338
366 Ga0157376_10000005
367 Ga0157376_10002022
368 Ga0207653_10000021
369 Ga0207653_10004656
370 Ga0207699_10000017
371 Ga0207699_10001399
372 Ga0207699_10004530
373 Ga0207699_10022034
374 Ga0207684_10000394
375 Ga0207684_10020925
376 Ga0207684_10023955
377 Ga0207684_10054910
378 Ga0207695_10008578
379 Ga0207671_10119034
380 Ga0207693_10016332
381 Ga0207693_10040680
382 Ga0207693_10058864
383 Ga0207663_10000006
384 Ga0207663_10024088
385 Ga0207663_10208861
386 Ga0207646_10000282
387 Ga0207646_10003445
388 Ga0207646_10005298
389 Ga0207646_10054432
390 Ga0207665_10000020
391 Ga0207665_10010922
392 Ga0207665_10013336
393 Ga0207665_10021990
394 Ga0207665_10031156
395 Ga0207665_10053730
396 Ga0207711_10076880
397 Ga0207689_10237106
398 Ga0207641_10059055
399 Ga0207641_10495227
400 Ga0209588_1000388
401 Ga0209588_1000676
402 Ga0209588_1001439
403 Ga0209588_1005909
404 Ga0268266_10000661
405 Ga0268264_10189556
406 Ga0268264_10280395
407 Ga0265318_10011328
408 Ga0265770_1002445
409 Ga0265770_1008488
410 Ga0265760_10007905
411 Ga0265760_10033050
412 Ga0265327_10028361
413 Ga0373928_0000970
414 Ga0373934_0019098
415 Ga0373953_0011310
416 Ga0373954_0003291
417 Ga0373956_0113414
418 Ga0373957_0006245
419 Ga0373946_0014638
420 Ga0373955_0000538
421 Ga0373924_0028147
422 Ga0373931_0114653
423 Ga0373927_0072391
424 Ga0373933_0000280
425 Ga0373937_0000932
426 Ga0373937_0058054
427 Ga0373925_0006884
428 Ga0373925_0048267
429 Ga0436365_1907769
430 Ga0451577_0000035
431 Ga0451577_0001096
432 Ga0451577_0001321
433 Ga0451577_0004502
434 Ga0451577_0023875
435 Ga0451577_0029426
436 Ga0451577_0033010
437 Ga0451577_0038824
438 Ga0451577_0049916
439 Ga0451577_0060585
440 Ga0451577_0193716
441 Ga0453683_0000030
442 Ga0453683_0000054
443 Ga0453683_0000071
444 Ga0453683_0000121
445 Ga0453683_0000184
446 Ga0453683_0000377
447 Ga0453683_0001443
448 Ga0453683_0003039
449 Ga0453683_0004193
450 Ga0453683_0038562
451 Ga0453683_0044367
452 Ga0453683_0046593
453 Ga0453683_0120698
454 Ga0453684_0000097
455 Ga0453684_0000710
456 Ga0453684_0002350
457 Ga0453684_0002524
458 Ga0453684_0003633
459 Ga0453684_0008782
460 Ga0453684_0012808
461 Ga0453684_0014325
462 Ga0453684_0015950
463 Ga0453684_0018036
464 Ga0453684_0018317
465 Ga0453684_0024890
466 Ga0453684_0025262
467 Ga0453684_0036125
468 Ga0453684_0110254
469 Ga0453684_0177014
470 Ga0453684_0191794
471 Ga0453684_0242745
472 Ga0453684_0339011
473 Ga0453684_0776219
474 Ga0451576_0000847
475 Ga0451576_0005482
476 Ga0451576_0015246
477 Ga0451576_0076449
478 Ga0451576_0128735
479 Ga0451576_0156478
480 Ga0451576_0168028
481 Ga0451576_0180447
482 Ga0451576_0222222
483 Ga0451576_0237409
484 Ga0451576_0727312
485 Ga0495629_0006758
486 Ga0495641_0020395
487 Ga0495651_0018960
488 Ga0495580_0060177
489 Ga0495580_0081783
490 Ga0495582_0098690
491 Ga0495662_0128351
492 Ga0495630_0058238
493 Ga0495630_0078200
494 Ga0495665_0020054
495 Ga0495586_0009283
496 Ga0495587_0024148
497 Ga0495645_0030318
498 Ga0495634_0062011
499 Ga0495635_0055158
500 Ga0495658_0128766
501 Ga0495624_0117795
502 Ga0495604_0007684
503 Ga0495674_0221085
504 Ga0495676_0152069
505 Ga0495680_0033444
506 Ga0495684_0030902
507 Ga0495602_0055366
508 Ga0495614_0038718
509 Ga0496100_0015461
510 Ga0496101_0051864
511 Ga0496102_0001293
512 Ga0496104_0093173
513 Ga0496110_0097482
514 Ga0496114_0071169
515 Ga0496115_0001061
516 nmdc:mga05p37_107_c1
517 nmdc:mga05p37_233588_c1
518 nmdc:mga09592_109000_c1
519 nmdc:mga0n895_165621_c1
520 nmdc:mga0n895_27769_c1
521 nmdc:mga0n895_85231_c1
522 nmdc:mga0n895_85909_c1
523 nmdc:mga0rr50_147180_c1
524 nmdc:mga0rr50_174364_c1
525 nmdc:mga0rr50_266003_c2
526 nmdc:mga0rr50_276539_c1
527 nmdc:mga08x19_11784_c1
528 nmdc:mga08x19_24743_c1
529 nmdc:mga08x19_42451_c1
530 nmdc:mga08x19_566_c1
531 nmdc:mga0a205_421877_c1
532 nmdc:mga0a205_65482_c1
533 Ga0495612_0035890
534 Ga0495619_0006292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7383 55 311
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7369 51 315
6juy-assembly1.cif.gz_B crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7347 55 311
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7304 55 311
4d5e-assembly1.cif.gz_B crystal structure of recombinant wildtype cdh 0.7293 55 105
ID Description Score Start End Superfamily
4d5eB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7293 55 105 3.40.50.1220
4q9dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7059 54 106 3.40.50.1220
af_O06335_192_342_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6744 58 109 3.40.50.1220
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6591 37 315 3.40.910.10
af_Q6NYK1_8_355_3.40.910.10 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6445 19 310 3.40.910.10
ID Description Score Start End GO Terms
AF-A0A7W1PC57-F1-model_v4 Deoxyhypusine synthase family protein 0.952 2 267
AF-A0A522LIX4-F1-model_v4 Deoxyhypusine synthase 0.9455 8 215
AF-A0A7W1PC57-F1-model_v4 Deoxyhypusine synthase family protein 0.9451 2 267
AF-A0A2V9BPD3-F1-model_v4 Uncharacterized protein 0.9444 1 235
AF-A0A1V4RNV3-F1-model_v4 Uncharacterized protein 0.9437 79 277

Map