F374550

General Info

Members Datasets Scaffolds Average Seq Length
267 104 267 136

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10429515|Ga0070691_104295151
Length 155
Sequence LQDAALSTKRLRRLLNYPMQSVQYPAKFEFLDEIRDFVGDIARKNGFGSKEIYGIQLATDEAASNIIEHAYEHISDGVLELSCGFKGGEITVILVDHGEPFDPAEIPMPDLKADLSDRKIGGLGIFLMRKLMDEVHYDSQPGKNSNTLTMIKRKR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
79 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.25
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_604670 2162886007 Bacteria 2815
2 JGI25406J46586_10000882 3300003203 Bacteria 14125
3 rootL2_10387215 3300003322 Unclassified 1724
4 Ga0065704_10070820 3300005289 Bacteria 15684
5 Ga0065704_10292331 3300005289 Bacteria 901
6 Ga0065704_10411408 3300005289 Unclassified 741
7 Ga0065704_10457100 3300005289 Unclassified 700
8 Ga0065715_10405478 3300005293 Unclassified 864
9 Ga0065707_10000506 3300005295 Bacteria 28358
10 Ga0065707_10001073 3300005295 Bacteria 9087
11 Ga0065707_10086009 3300005295 Bacteria 5723
12 Ga0065707_10089871 3300005295 Bacteria 4262
13 Ga0065707_10103788 3300005295 Unclassified 2729
14 Ga0065707_10127204 3300005295 Bacteria 1988
15 Ga0065707_10469135 3300005295 Bacteria 782
16 Ga0068869_100818918 3300005334 Unclassified 801
17 Ga0070680_100857219 3300005336 Bacteria 783
18 Ga0070689_100041483 3300005340 Unclassified 3533
19 Ga0070689_100333309 3300005340 Unclassified 1269
20 Ga0070689_100881058 3300005340 Unclassified 791
21 Ga0070691_10429515 3300005341 Unclassified 750
22 Ga0070701_10280452 3300005438 Unclassified 1017
23 Ga0070701_10582689 3300005438 Unclassified 738
24 Ga0070705_100074503 3300005440 Bacteria 2064
25 Ga0070705_100125397 3300005440 Unclassified 1665
26 Ga0070705_100831285 3300005440 Bacteria 737
27 Ga0070700_100917353 3300005441 Unclassified 714
28 Ga0070694_100116423 3300005444 Bacteria 1912
29 Ga0070694_100329116 3300005444 Bacteria 1178
30 Ga0070706_101363887 3300005467 Unclassified 649
31 Ga0070706_101411349 3300005467 Unclassified 637
32 Ga0070707_100173293 3300005468 Bacteria 2103
33 Ga0070707_100349638 3300005468 Bacteria 1436
34 Ga0070707_100865344 3300005468 Bacteria 868
35 Ga0070707_101831273 3300005468 Bacteria 574
36 Ga0070698_100038879 3300005471 Bacteria 4902
37 Ga0070698_100061672 3300005471 Unclassified 3784
38 Ga0070698_100129402 3300005471 Bacteria 2481
39 Ga0070698_100200230 3300005471 Unclassified 1933
40 Ga0070698_100324941 3300005471 Unclassified 1469
41 Ga0070698_100376024 3300005471 Bacteria 1353
42 Ga0070699_100002719 3300005518 Bacteria 15768
43 Ga0070699_100011144 3300005518 Bacteria 7770
44 Ga0070699_100190123 3300005518 Bacteria 1823
45 Ga0070699_100225018 3300005518 Unclassified 1672
46 Ga0070697_100110048 3300005536 Bacteria 2295
47 Ga0070697_100536775 3300005536 Unclassified 1025
48 Ga0070686_101721454 3300005544 Unclassified 532
49 Ga0070695_100055137 3300005545 Bacteria 2561
50 Ga0070695_100432806 3300005545 Unclassified 1004
51 Ga0070695_100502683 3300005545 Unclassified 938
52 Ga0070695_100557343 3300005545 Unclassified 894
53 Ga0070696_100684455 3300005546 Bacteria 834
54 Ga0070696_100718059 3300005546 Unclassified 816
55 Ga0070704_100022631 3300005549 Unclassified 4092
56 Ga0070704_100164091 3300005549 Bacteria 1760
57 Ga0068857_100272449 3300005577 Bacteria 1556
58 Ga0070702_100149515 3300005615 Unclassified 1497
59 Ga0068859_100022103 3300005617 Bacteria 6377
60 Ga0068859_100048564 3300005617 Bacteria 4263
61 Ga0068864_100892759 3300005618 Unclassified 877
62 Ga0068864_100981334 3300005618 Unclassified 837
63 Ga0068861_100665079 3300005719 Unclassified 964
64 Ga0068858_101546367 3300005842 Unclassified 654
65 Ga0068858_101757795 3300005842 Unclassified 612
66 Ga0068862_100008614 3300005844 Bacteria 8438
67 Ga0068862_100101585 3300005844 Bacteria 2516
68 Ga0068862_100284464 3300005844 Bacteria 1516
69 Ga0068862_100960669 3300005844 Bacteria 843
70 Ga0081539_10000656 3300005985 Bacteria 69569
71 Ga0081539_10082574 3300005985 Unclassified 1684
72 Ga0081539_10413076 3300005985 Unclassified 560
73 Ga0081539_10440655 3300005985 Unclassified 540
74 Ga0075427_10106349 3300006194 Unclassified 526
75 Ga0075428_100014326 3300006844 Bacteria 8814
76 Ga0075428_100261389 3300006844 Bacteria 1864
77 Ga0075428_100315159 3300006844 Bacteria 1681
78 Ga0075428_100605613 3300006844 Bacteria 1170
79 Ga0075428_101831422 3300006844 Unclassified 631
80 Ga0075428_102057190 3300006844 Unclassified 591
81 Ga0075428_102217260 3300006844 Unclassified 566
82 Ga0075430_100118488 3300006846 Bacteria 2207
83 Ga0075430_100218342 3300006846 Bacteria 1582
84 Ga0075430_100646516 3300006846 Unclassified 872
85 Ga0075431_100026619 3300006847 Bacteria 5932
86 Ga0075431_100078922 3300006847 Bacteria 3398
87 Ga0075433_10016715 3300006852 Bacteria 6057
88 Ga0075433_10283406 3300006852 Unclassified 1468
89 Ga0075434_100290572 3300006871 Unclassified 1655
90 Ga0075429_100030280 3300006880 Bacteria 4701
91 Ga0075429_100039436 3300006880 Unclassified 4110
92 Ga0075429_100043553 3300006880 Unclassified 3906
93 Ga0075429_100176781 3300006880 Bacteria 1870
94 Ga0075429_100215673 3300006880 Unclassified 1681
95 Ga0075429_100413219 3300006880 Bacteria 1182
96 Ga0075429_100745334 3300006880 Unclassified 858
97 Ga0097620_100022103 3300006931 Bacteria 6377
98 Ga0097620_100048564 3300006931 Bacteria 4263
99 Ga0111539_10116539 3300009094 Bacteria 3132
100 Ga0114129_10008374 3300009147 Bacteria 14733
101 Ga0114129_10012520 3300009147 Bacteria 12080
102 Ga0114129_10026326 3300009147 Bacteria 8237
103 Ga0114129_10049838 3300009147 Bacteria 5883
104 Ga0114129_10135620 3300009147 Unclassified 3377
105 Ga0114129_10171476 3300009147 Unclassified 2958
106 Ga0114129_10352317 3300009147 Unclassified 1950
107 Ga0114129_10395495 3300009147 Bacteria 1822
108 Ga0114129_11913448 3300009147 Bacteria 719
109 Ga0105243_10049507 3300009148 Bacteria 3315
110 Ga0105243_10069986 3300009148 Bacteria 2832
111 Ga0105243_10096430 3300009148 Bacteria 2446
112 Ga0105249_10066397 3300009553 Unclassified 3321
113 Ga0105249_10124291 3300009553 Unclassified 2455
114 Ga0105249_10148403 3300009553 Bacteria 2255
115 Ga0105249_10357202 3300009553 Unclassified 1482
116 Ga0105239_10564210 3300010375 Bacteria 1297
117 Ga0105239_12472520 3300010375 Unclassified 605
118 Ga0105246_10091270 3300011119 Bacteria 2195
119 Ga0105246_11201166 3300011119 Unclassified 698
120 Ga0157378_10838860 3300013297 Unclassified 947
121 Ga0163163_11421323 3300014325 Bacteria 755
122 Ga0157380_10099946 3300014326 Bacteria 2414
123 Ga0157380_11914820 3300014326 Unclassified 654
124 Ga0157379_10657871 3300014968 Bacteria 981
125 Ga0157379_12390536 3300014968 Unclassified 527
126 Ga0207653_10068352 3300025885 Bacteria 1210
127 Ga0207684_10020533 3300025910 Bacteria 5645
128 Ga0207684_10872025 3300025910 Unclassified 758
129 Ga0207662_10524724 3300025918 Bacteria 818
130 Ga0207646_10116163 3300025922 Bacteria 2403
131 Ga0207709_10051670 3300025935 Bacteria 2520
132 Ga0207709_10128662 3300025935 Bacteria 1722
133 Ga0207670_10261038 3300025936 Unclassified 1343
134 Ga0207670_10444228 3300025936 Bacteria 1044
135 Ga0207689_10769037 3300025942 Unclassified 813
136 Ga0207708_10051400 3300026075 Unclassified 3137
137 Ga0207708_10515875 3300026075 Unclassified 1004
138 Ga0207708_11235686 3300026075 Bacteria 654
139 Ga0207676_10213572 3300026095 Unclassified 1713
140 Ga0207674_10260448 3300026116 Unclassified 1681
141 Ga0207674_10475841 3300026116 Unclassified 1207
142 Ga0207675_100279522 3300026118 Unclassified 1622
143 Ga0207675_100332761 3300026118 Bacteria 1485
144 Ga0207675_100361077 3300026118 Bacteria 1425
145 Ga0268265_10037718 3300028380 Unclassified 3549
146 Ga0268264_10900676 3300028381 Bacteria 888
147 Ga0265326_10036922 3300028558 Bacteria 1389
148 Ga0265323_10005875 3300028653 Bacteria 5189
149 Ga0265338_10254298 3300028800 Bacteria 1294
150 Ga0265328_10128372 3300031239 Bacteria 948
151 Ga0265320_10029633 3300031240 Bacteria 2831
152 Ga0265340_10000941 3300031247 Bacteria 16553
153 Ga0265339_10453741 3300031249 Bacteria 595
154 Ga0307408_100636463 3300031548 Unclassified 952
155 Ga0307405_11303980 3300031731 Unclassified 632
156 Ga0307410_10604252 3300031852 Unclassified 915
157 Ga0307406_10173835 3300031901 Unclassified 1562
158 Ga0307406_10955181 3300031901 Unclassified 733
159 Ga0307412_10800405 3300031911 Unclassified 818
160 Ga0307409_100380526 3300031995 Bacteria 1342
161 Ga0307409_100778602 3300031995 Unclassified 963
162 Ga0307409_100878557 3300031995 Unclassified 909
163 Ga0307416_101817689 3300032002 Unclassified 713
164 Ga0307416_102799570 3300032002 Unclassified 583
165 Ga0307415_100625949 3300032126 Unclassified 961
166 Ga0307415_101145103 3300032126 Unclassified 730
167 Ga0373948_0098217 3300034817 Unclassified 687
168 Ga0373939_0241399 3300035114 Unclassified 699
169 Ga0451853_0394355 3300041512 Bacteria 655
170 Ga0451577_0000028 3300042876 Bacteria 395361
171 Ga0451577_0022236 3300042876 Bacteria 5791
172 Ga0451577_0044044 3300042876 Bacteria 3995
173 Ga0451577_0120051 3300042876 Bacteria 2355
174 Ga0451577_0157459 3300042876 Bacteria 2045
175 Ga0451577_0197119 3300042876 Bacteria 1817
176 Ga0451577_0281834 3300042876 Bacteria 1506
177 Ga0451577_0432631 3300042876 Unclassified 1195
178 Ga0451577_1627806 3300042876 Unclassified 569
179 Ga0453683_0001921 3300044673 Bacteria 16949
180 Ga0453683_0015016 3300044673 Bacteria 5027
181 Ga0453683_0069775 3300044673 Bacteria 2197
182 Ga0453683_0331894 3300044673 Bacteria 975
183 Ga0453683_0665210 3300044673 Bacteria 681
184 Ga0453683_0923456 3300044673 Unclassified 577
185 Ga0453684_0000044 3300044712 Bacteria 585643
186 Ga0453684_0000390 3300044712 Bacteria 180365
187 Ga0453684_0000567 3300044712 Bacteria 138873
188 Ga0453684_0002083 3300044712 Bacteria 50780
189 Ga0453684_0002471 3300044712 Bacteria 44690
190 Ga0453684_0003100 3300044712 Bacteria 38284
191 Ga0453684_0013446 3300044712 Bacteria 13291
192 Ga0453684_0049224 3300044712 Bacteria 5561
193 Ga0453684_0057150 3300044712 Bacteria 5053
194 Ga0453684_0070190 3300044712 Bacteria 4438
195 Ga0453684_0073118 3300044712 Bacteria 4324
196 Ga0453684_0085743 3300044712 Bacteria 3911
197 Ga0453684_0139021 3300044712 Bacteria 2903
198 Ga0453684_0156932 3300044712 Bacteria 2696
199 Ga0453684_0207400 3300044712 Bacteria 2280
200 Ga0453684_0208879 3300044712 Bacteria 2271
201 Ga0453684_0220588 3300044712 Unclassified 2197
202 Ga0453684_0223847 3300044712 Bacteria 2177
203 Ga0453684_0436794 3300044712 Unclassified 1459
204 Ga0453684_0440399 3300044712 Bacteria 1452
205 Ga0453684_0475858 3300044712 Bacteria 1386
206 Ga0453684_0497241 3300044712 Unclassified 1351
207 Ga0453684_0505129 3300044712 Bacteria 1338
208 Ga0453684_0685227 3300044712 Unclassified 1115
209 Ga0453684_0723882 3300044712 Unclassified 1079
210 Ga0453684_0747597 3300044712 Bacteria 1059
211 Ga0453684_0942076 3300044712 Unclassified 922
212 Ga0453684_1003635 3300044712 Unclassified 887
213 Ga0453684_2122423 3300044712 Unclassified 563
214 Ga0451576_0001478 3300045051 Bacteria 39768
215 Ga0451576_0047636 3300045051 Unclassified 4505
216 Ga0451576_0054582 3300045051 Bacteria 4183
217 Ga0451576_0074661 3300045051 Unclassified 3528
218 Ga0451576_0140381 3300045051 Bacteria 2520
219 Ga0451576_0176371 3300045051 Bacteria 2231
220 Ga0451576_0194585 3300045051 Bacteria 2118
221 Ga0451576_0217847 3300045051 Unclassified 1993
222 Ga0451576_0472707 3300045051 Bacteria 1317
223 Ga0451576_0635822 3300045051 Bacteria 1121
224 Ga0451576_0833216 3300045051 Unclassified 968
225 Ga0451576_1579837 3300045051 Unclassified 681
226 Ga0501036_1626502 3300049572 Unclassified 521
227 Ga0501039_0371999 3300049575 Bacteria 1123
228 Ga0501072_0189602 3300049588 Bacteria 1640
229 Ga0501075_0269839 3300049591 Bacteria 1297
230 Ga0501075_0524064 3300049591 Unclassified 904
231 Ga0501076_0004233 3300049592 Bacteria 10152
232 Ga0501076_0066227 3300049592 Unclassified 2883
233 Ga0501076_0183594 3300049592 Bacteria 1706
234 Ga0501076_1143175 3300049592 Unclassified 641
235 Ga0501245_027651 3300049708 Unclassified 921
236 Ga0501079_0111959 3300049741 Bacteria 2121
237 Ga0501080_0261371 3300049742 Unclassified 1577
238 Ga0501081_0095721 3300049743 Unclassified 2094
239 Ga0501081_0597081 3300049743 Unclassified 826
240 Ga0501241_053139 3300049758 Unclassified 803
241 Ga0501045_0462539 3300049824 Unclassified 943
242 nmdc:mga05p37_1359108_c1 3300050507 Bacteria 719
243 nmdc:mga05p37_233499_c1 3300050507 Unclassified 2215
244 nmdc:mga05p37_445222_c1 3300050507 Unclassified 1501
245 nmdc:mga05p37_44951_c1 3300050507 Bacteria 5433
246 nmdc:mga05p37_82766_c1 3300050507 Bacteria 3955
247 nmdc:mga05p37_9557_c1 3300050507 Bacteria 11484
248 nmdc:mga09592_118764_c1 3300050508 Bacteria 2270
249 nmdc:mga09592_1247827_c1 3300050508 Unclassified 613
250 nmdc:mga09592_254318_c1 3300050508 Bacteria 1523
251 nmdc:mga09592_285641_c1 3300050508 Bacteria 1431
252 nmdc:mga0qj67_116169_c1 3300050509 Bacteria 2162
253 nmdc:mga0qj67_503328_c1 3300050509 Bacteria 974
254 nmdc:mga06r32_247871_c1 3300050510 Bacteria 1769
255 nmdc:mga06r32_707147_c1 3300050510 Bacteria 973
256 nmdc:mga0n895_190423_c1 3300050512 Unclassified 2082
257 nmdc:mga0n895_2060112_c1 3300050512 Unclassified 528
258 nmdc:mga0a205_127423_c1 3300050515 Unclassified 2445
259 nmdc:mga0a205_313019_c1 3300050515 Unclassified 1442
260 nmdc:mga0a205_36571_c1 3300050515 Bacteria 4718
261 Ga0501084_0274176 3300054114 Unclassified 1424
262 Ga0501084_1751926 3300054114 Unclassified 519
263 Ga0501082_0099019 3300060353 Bacteria 2521
264 Ga0501082_0143856 3300060353 Unclassified 2069
265 Ga0501082_0943232 3300060353 Unclassified 755
266 Ga0501082_1339919 3300060353 Unclassified 625
267 Ga0530510_0309636 3300061734 Bacteria 1183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028653 Ga0265323_10005875 Ga0265323_100058753 121
2 3300044712 Ga0453684_0070190 Ga0453684_0070190_752_1162 127
3 3300042876 Ga0451577_0000028 Ga0451577_0000028_320072_320497 133
4 3300042876 Ga0451577_1627806 Ga0451577_1627806_116_538 133
5 3300044673 Ga0453683_0331894 Ga0453683_0331894_153_578 133
6 3300044712 Ga0453684_0000390 Ga0453684_0000390_160794_161219 133
7 3300044712 Ga0453684_0000567 Ga0453684_0000567_117845_118267 133
8 3300044712 Ga0453684_0002083 Ga0453684_0002083_46539_46961 133
9 3300044712 Ga0453684_0002471 Ga0453684_0002471_16148_16549 133
10 3300045051 Ga0451576_0001478 Ga0451576_0001478_9516_9941 133
11 3300049592 Ga0501076_1143175 Ga0501076_1143175_121_522 133
12 3300005295 Ga0065707_10127204 Ga0065707_101272042 135
13 3300005295 Ga0065707_10469135 Ga0065707_104691351 135
14 3300005440 Ga0070705_100831285 Ga0070705_1008312851 135
15 3300005467 Ga0070706_101411349 Ga0070706_1014113491 135
16 3300005468 Ga0070707_100865344 Ga0070707_1008653442 135
17 3300005471 Ga0070698_100129402 Ga0070698_1001294022 135
18 3300005518 Ga0070699_100002719 Ga0070699_1000027197 135
19 3300005545 Ga0070695_100055137 Ga0070695_1000551372 135
20 3300005545 Ga0070695_100432806 Ga0070695_1004328062 135
21 3300006194 Ga0075427_10106349 Ga0075427_101063491 135
22 3300006844 Ga0075428_100014326 Ga0075428_1000143262 135
23 3300006844 Ga0075428_100261389 Ga0075428_1002613892 135
24 3300006847 Ga0075431_100078922 Ga0075431_1000789223 135
25 3300006880 Ga0075429_100030280 Ga0075429_1000302802 135
26 3300006880 Ga0075429_100413219 Ga0075429_1004132192 135
27 3300009147 Ga0114129_10012520 Ga0114129_100125206 135
28 3300009147 Ga0114129_10352317 Ga0114129_103523173 135
29 3300025885 Ga0207653_10068352 Ga0207653_100683522 135
30 3300025910 Ga0207684_10872025 Ga0207684_108720252 135
31 3300026075 Ga0207708_11235686 Ga0207708_112356861 135
32 3300028558 Ga0265326_10036922 Ga0265326_100369222 135
33 3300028800 Ga0265338_10254298 Ga0265338_102542982 135
34 3300031239 Ga0265328_10128372 Ga0265328_101283722 135
35 3300031240 Ga0265320_10029633 Ga0265320_100296332 135
36 3300031247 Ga0265340_10000941 Ga0265340_100009412 135
37 3300031249 Ga0265339_10453741 Ga0265339_104537412 135
38 3300041512 Ga0451853_0394355 Ga0451853_0394355_194_601 135
39 3300042876 Ga0451577_0157459 Ga0451577_0157459_1329_1736 135
40 3300042876 Ga0451577_0281834 Ga0451577_0281834_494_901 135
41 3300042876 Ga0451577_0432631 Ga0451577_0432631_511_918 135
42 3300044673 Ga0453683_0001921 Ga0453683_0001921_16206_16613 135
43 3300044673 Ga0453683_0015016 Ga0453683_0015016_2138_2545 135
44 3300044673 Ga0453683_0069775 Ga0453683_0069775_1047_1454 135
45 3300044712 Ga0453684_0049224 Ga0453684_0049224_627_1034 135
46 3300044712 Ga0453684_0139021 Ga0453684_0139021_965_1372 135
47 3300044712 Ga0453684_0223847 Ga0453684_0223847_1204_1611 135
48 3300044712 Ga0453684_0436794 Ga0453684_0436794_95_502 135
49 3300044712 Ga0453684_0505129 Ga0453684_0505129_324_731 135
50 3300045051 Ga0451576_0140381 Ga0451576_0140381_1599_2006 135
51 3300045051 Ga0451576_0217847 Ga0451576_0217847_1398_1805 135
52 3300045051 Ga0451576_0833216 Ga0451576_0833216_265_672 135
53 3300050507 nmdc:mga05p37_9557_c1 nmdc:mga05p37_9557_c1_6055_6462 135
54 3300050508 nmdc:mga09592_285641_c1 nmdc:mga09592_285641_c1_921_1328 135
55 3300050509 nmdc:mga0qj67_503328_c1 nmdc:mga0qj67_503328_c1_18_425 135
56 3300050510 nmdc:mga06r32_707147_c1 nmdc:mga06r32_707147_c1_234_641 135
57 2162886007 SwRhRL2b_contig_604670 SwRhRL2b_0528.00002270 136
58 3300003203 JGI25406J46586_10000882 JGI25406J46586_100008823 136
59 3300003322 rootL2_10387215 rootL2_103872152 136
60 3300005289 Ga0065704_10070820 Ga0065704_100708202 136
61 3300005289 Ga0065704_10292331 Ga0065704_102923311 136
62 3300005289 Ga0065704_10411408 Ga0065704_104114082 136
63 3300005289 Ga0065704_10457100 Ga0065704_104571002 136
64 3300005293 Ga0065715_10405478 Ga0065715_104054782 136
65 3300005295 Ga0065707_10000506 Ga0065707_1000050614 136
66 3300005295 Ga0065707_10001073 Ga0065707_100010733 136
67 3300005295 Ga0065707_10086009 Ga0065707_100860095 136
68 3300005295 Ga0065707_10089871 Ga0065707_100898712 136
69 3300005295 Ga0065707_10103788 Ga0065707_101037882 136
70 3300005334 Ga0068869_100818918 Ga0068869_1008189182 136
71 3300005336 Ga0070680_100857219 Ga0070680_1008572192 136
72 3300005340 Ga0070689_100041483 Ga0070689_1000414832 136
73 3300005340 Ga0070689_100333309 Ga0070689_1003333092 136
74 3300005340 Ga0070689_100881058 Ga0070689_1008810582 136
75 3300005341 Ga0070691_10429515 Ga0070691_104295151 136
76 3300005438 Ga0070701_10280452 Ga0070701_102804522 136
77 3300005438 Ga0070701_10582689 Ga0070701_105826891 136
78 3300005440 Ga0070705_100074503 Ga0070705_1000745032 136
79 3300005440 Ga0070705_100125397 Ga0070705_1001253972 136
80 3300005441 Ga0070700_100917353 Ga0070700_1009173531 136
81 3300005444 Ga0070694_100116423 Ga0070694_1001164232 136
82 3300005444 Ga0070694_100329116 Ga0070694_1003291162 136
83 3300005467 Ga0070706_101363887 Ga0070706_1013638872 136
84 3300005468 Ga0070707_100173293 Ga0070707_1001732932 136
85 3300005468 Ga0070707_100349638 Ga0070707_1003496383 136
86 3300005468 Ga0070707_101831273 Ga0070707_1018312731 136
87 3300005471 Ga0070698_100038879 Ga0070698_1000388793 136
88 3300005471 Ga0070698_100061672 Ga0070698_1000616722 136
89 3300005471 Ga0070698_100200230 Ga0070698_1002002302 136
90 3300005471 Ga0070698_100324941 Ga0070698_1003249412 136
91 3300005471 Ga0070698_100376024 Ga0070698_1003760243 136
92 3300005518 Ga0070699_100011144 Ga0070699_1000111442 136
93 3300005518 Ga0070699_100190123 Ga0070699_1001901232 136
94 3300005518 Ga0070699_100225018 Ga0070699_1002250182 136
95 3300005536 Ga0070697_100110048 Ga0070697_1001100482 136
96 3300005536 Ga0070697_100536775 Ga0070697_1005367752 136
97 3300005544 Ga0070686_101721454 Ga0070686_1017214541 136
98 3300005545 Ga0070695_100502683 Ga0070695_1005026832 136
99 3300005545 Ga0070695_100557343 Ga0070695_1005573432 136
100 3300005546 Ga0070696_100684455 Ga0070696_1006844552 136
101 3300005546 Ga0070696_100718059 Ga0070696_1007180591 136
102 3300005549 Ga0070704_100022631 Ga0070704_1000226312 136
103 3300005549 Ga0070704_100164091 Ga0070704_1001640912 136
104 3300005577 Ga0068857_100272449 Ga0068857_1002724492 136
105 3300005615 Ga0070702_100149515 Ga0070702_1001495153 136
106 3300005617 Ga0068859_100022103 Ga0068859_1000221033 136
107 3300005617 Ga0068859_100048564 Ga0068859_1000485645 136
108 3300005618 Ga0068864_100892759 Ga0068864_1008927592 136
109 3300005618 Ga0068864_100981334 Ga0068864_1009813342 136
110 3300005719 Ga0068861_100665079 Ga0068861_1006650792 136
111 3300005842 Ga0068858_101546367 Ga0068858_1015463672 136
112 3300005842 Ga0068858_101757795 Ga0068858_1017577952 136
113 3300005844 Ga0068862_100008614 Ga0068862_1000086146 136
114 3300005844 Ga0068862_100101585 Ga0068862_1001015852 136
115 3300005844 Ga0068862_100284464 Ga0068862_1002844641 136
116 3300005844 Ga0068862_100960669 Ga0068862_1009606691 136
117 3300005985 Ga0081539_10000656 Ga0081539_1000065624 136
118 3300005985 Ga0081539_10082574 Ga0081539_100825742 136
119 3300005985 Ga0081539_10413076 Ga0081539_104130761 136
120 3300005985 Ga0081539_10440655 Ga0081539_104406552 136
121 3300006844 Ga0075428_100315159 Ga0075428_1003151593 136
122 3300006844 Ga0075428_100605613 Ga0075428_1006056132 136
123 3300006844 Ga0075428_101831422 Ga0075428_1018314222 136
124 3300006844 Ga0075428_102057190 Ga0075428_1020571901 136
125 3300006844 Ga0075428_102217260 Ga0075428_1022172601 136
126 3300006846 Ga0075430_100118488 Ga0075430_1001184882 136
127 3300006846 Ga0075430_100218342 Ga0075430_1002183422 136
128 3300006846 Ga0075430_100646516 Ga0075430_1006465162 136
129 3300006847 Ga0075431_100026619 Ga0075431_1000266196 136
130 3300006852 Ga0075433_10016715 Ga0075433_100167152 136
131 3300006852 Ga0075433_10283406 Ga0075433_102834062 136
132 3300006871 Ga0075434_100290572 Ga0075434_1002905722 136
133 3300006880 Ga0075429_100039436 Ga0075429_1000394365 136
134 3300006880 Ga0075429_100043553 Ga0075429_1000435533 136
135 3300006880 Ga0075429_100176781 Ga0075429_1001767813 136
136 3300006880 Ga0075429_100215673 Ga0075429_1002156732 136
137 3300006880 Ga0075429_100745334 Ga0075429_1007453341 136
138 3300006931 Ga0097620_100022103 Ga0097620_1000221033 136
139 3300006931 Ga0097620_100048564 Ga0097620_1000485645 136
140 3300009094 Ga0111539_10116539 Ga0111539_101165394 136
141 3300009147 Ga0114129_10008374 Ga0114129_100083742 136
142 3300009147 Ga0114129_10026326 Ga0114129_100263266 136
143 3300009147 Ga0114129_10049838 Ga0114129_100498382 136
144 3300009147 Ga0114129_10135620 Ga0114129_101356202 136
145 3300009147 Ga0114129_10171476 Ga0114129_101714762 136
146 3300009147 Ga0114129_10395495 Ga0114129_103954952 136
147 3300009147 Ga0114129_11913448 Ga0114129_119134482 136
148 3300009148 Ga0105243_10049507 Ga0105243_100495072 136
149 3300009148 Ga0105243_10069986 Ga0105243_100699862 136
150 3300009148 Ga0105243_10096430 Ga0105243_100964302 136
151 3300009553 Ga0105249_10066397 Ga0105249_100663971 136
152 3300009553 Ga0105249_10124291 Ga0105249_101242912 136
153 3300009553 Ga0105249_10148403 Ga0105249_101484032 136
154 3300009553 Ga0105249_10357202 Ga0105249_103572023 136
155 3300010375 Ga0105239_10564210 Ga0105239_105642102 136
156 3300010375 Ga0105239_12472520 Ga0105239_124725201 136
157 3300011119 Ga0105246_10091270 Ga0105246_100912702 136
158 3300011119 Ga0105246_11201166 Ga0105246_112011662 136
159 3300013297 Ga0157378_10838860 Ga0157378_108388602 136
160 3300014325 Ga0163163_11421323 Ga0163163_114213232 136
161 3300014326 Ga0157380_10099946 Ga0157380_100999462 136
162 3300014326 Ga0157380_11914820 Ga0157380_119148202 136
163 3300014968 Ga0157379_10657871 Ga0157379_106578712 136
164 3300014968 Ga0157379_12390536 Ga0157379_123905361 136
165 3300025910 Ga0207684_10020533 Ga0207684_100205335 136
166 3300025918 Ga0207662_10524724 Ga0207662_105247242 136
167 3300025922 Ga0207646_10116163 Ga0207646_101161633 136
168 3300025935 Ga0207709_10051670 Ga0207709_100516702 136
169 3300025935 Ga0207709_10128662 Ga0207709_101286623 136
170 3300025936 Ga0207670_10261038 Ga0207670_102610382 136
171 3300025936 Ga0207670_10444228 Ga0207670_104442282 136
172 3300025942 Ga0207689_10769037 Ga0207689_107690372 136
173 3300026075 Ga0207708_10051400 Ga0207708_100514003 136
174 3300026075 Ga0207708_10515875 Ga0207708_105158752 136
175 3300026095 Ga0207676_10213572 Ga0207676_102135723 136
176 3300026116 Ga0207674_10260448 Ga0207674_102604483 136
177 3300026116 Ga0207674_10475841 Ga0207674_104758412 136
178 3300026118 Ga0207675_100279522 Ga0207675_1002795222 136
179 3300026118 Ga0207675_100332761 Ga0207675_1003327613 136
180 3300026118 Ga0207675_100361077 Ga0207675_1003610772 136
181 3300028380 Ga0268265_10037718 Ga0268265_100377182 136
182 3300028381 Ga0268264_10900676 Ga0268264_109006762 136
183 3300031548 Ga0307408_100636463 Ga0307408_1006364631 136
184 3300031731 Ga0307405_11303980 Ga0307405_113039802 136
185 3300031852 Ga0307410_10604252 Ga0307410_106042522 136
186 3300031901 Ga0307406_10173835 Ga0307406_101738352 136
187 3300031901 Ga0307406_10955181 Ga0307406_109551812 136
188 3300031911 Ga0307412_10800405 Ga0307412_108004052 136
189 3300031995 Ga0307409_100380526 Ga0307409_1003805262 136
190 3300031995 Ga0307409_100778602 Ga0307409_1007786022 136
191 3300031995 Ga0307409_100878557 Ga0307409_1008785572 136
192 3300032002 Ga0307416_101817689 Ga0307416_1018176892 136
193 3300032002 Ga0307416_102799570 Ga0307416_1027995701 136
194 3300032126 Ga0307415_100625949 Ga0307415_1006259492 136
195 3300032126 Ga0307415_101145103 Ga0307415_1011451031 136
196 3300034817 Ga0373948_0098217 Ga0373948_0098217_251_661 136
197 3300035114 Ga0373939_0241399 Ga0373939_0241399_150_560 136
198 3300042876 Ga0451577_0022236 Ga0451577_0022236_4560_4970 136
199 3300042876 Ga0451577_0044044 Ga0451577_0044044_1304_1714 136
200 3300042876 Ga0451577_0120051 Ga0451577_0120051_132_542 136
201 3300042876 Ga0451577_0197119 Ga0451577_0197119_411_821 136
202 3300044673 Ga0453683_0665210 Ga0453683_0665210_184_594 136
203 3300044673 Ga0453683_0923456 Ga0453683_0923456_105_515 136
204 3300044712 Ga0453684_0000044 Ga0453684_0000044_75350_75829 136
205 3300044712 Ga0453684_0003100 Ga0453684_0003100_33736_34146 136
206 3300044712 Ga0453684_0013446 Ga0453684_0013446_11942_12352 136
207 3300044712 Ga0453684_0057150 Ga0453684_0057150_4102_4512 136
208 3300044712 Ga0453684_0073118 Ga0453684_0073118_274_684 136
209 3300044712 Ga0453684_0085743 Ga0453684_0085743_612_1022 136
210 3300044712 Ga0453684_0156932 Ga0453684_0156932_1745_2158 136
211 3300044712 Ga0453684_0207400 Ga0453684_0207400_513_923 136
212 3300044712 Ga0453684_0208879 Ga0453684_0208879_1137_1547 136
213 3300044712 Ga0453684_0220588 Ga0453684_0220588_937_1347 136
214 3300044712 Ga0453684_0440399 Ga0453684_0440399_341_751 136
215 3300044712 Ga0453684_0475858 Ga0453684_0475858_169_579 136
216 3300044712 Ga0453684_0497241 Ga0453684_0497241_113_523 136
217 3300044712 Ga0453684_0685227 Ga0453684_0685227_495_905 136
218 3300044712 Ga0453684_0723882 Ga0453684_0723882_467_877 136
219 3300044712 Ga0453684_0747597 Ga0453684_0747597_263_673 136
220 3300044712 Ga0453684_0942076 Ga0453684_0942076_447_857 136
221 3300044712 Ga0453684_1003635 Ga0453684_1003635_412_822 136
222 3300044712 Ga0453684_2122423 Ga0453684_2122423_77_487 136
223 3300045051 Ga0451576_0047636 Ga0451576_0047636_3212_3622 136
224 3300045051 Ga0451576_0054582 Ga0451576_0054582_3522_3932 136
225 3300045051 Ga0451576_0074661 Ga0451576_0074661_2786_3196 136
226 3300045051 Ga0451576_0176371 Ga0451576_0176371_1551_1961 136
227 3300045051 Ga0451576_0194585 Ga0451576_0194585_1464_1874 136
228 3300045051 Ga0451576_0472707 Ga0451576_0472707_336_746 136
229 3300045051 Ga0451576_0635822 Ga0451576_0635822_344_754 136
230 3300045051 Ga0451576_1579837 Ga0451576_1579837_186_596 136
231 3300049572 Ga0501036_1626502 Ga0501036_1626502_69_479 136
232 3300049575 Ga0501039_0371999 Ga0501039_0371999_147_557 136
233 3300049588 Ga0501072_0189602 Ga0501072_0189602_1021_1431 136
234 3300049591 Ga0501075_0269839 Ga0501075_0269839_741_1151 136
235 3300049591 Ga0501075_0524064 Ga0501075_0524064_351_761 136
236 3300049592 Ga0501076_0004233 Ga0501076_0004233_8127_8537 136
237 3300049592 Ga0501076_0066227 Ga0501076_0066227_1582_1992 136
238 3300049592 Ga0501076_0183594 Ga0501076_0183594_459_869 136
239 3300049708 Ga0501245_027651 Ga0501245_027651_499_909 136
240 3300049741 Ga0501079_0111959 Ga0501079_0111959_162_572 136
241 3300049742 Ga0501080_0261371 Ga0501080_0261371_98_508 136
242 3300049743 Ga0501081_0095721 Ga0501081_0095721_585_995 136
243 3300049743 Ga0501081_0597081 Ga0501081_0597081_87_497 136
244 3300049758 Ga0501241_053139 Ga0501241_053139_58_468 136
245 3300049824 Ga0501045_0462539 Ga0501045_0462539_223_633 136
246 3300050507 nmdc:mga05p37_1359108_c1 nmdc:mga05p37_1359108_c1_203_613 136
247 3300050507 nmdc:mga05p37_233499_c1 nmdc:mga05p37_233499_c1_1666_2076 136
248 3300050507 nmdc:mga05p37_445222_c1 nmdc:mga05p37_445222_c1_334_744 136
249 3300050507 nmdc:mga05p37_44951_c1 nmdc:mga05p37_44951_c1_3214_3624 136
250 3300050507 nmdc:mga05p37_82766_c1 nmdc:mga05p37_82766_c1_3026_3436 136
251 3300050508 nmdc:mga09592_118764_c1 nmdc:mga09592_118764_c1_957_1367 136
252 3300050508 nmdc:mga09592_1247827_c1 nmdc:mga09592_1247827_c1_103_513 136
253 3300050508 nmdc:mga09592_254318_c1 nmdc:mga09592_254318_c1_288_698 136
254 3300050509 nmdc:mga0qj67_116169_c1 nmdc:mga0qj67_116169_c1_1470_1883 136
255 3300050510 nmdc:mga06r32_247871_c1 nmdc:mga06r32_247871_c1_382_795 136
256 3300050512 nmdc:mga0n895_190423_c1 nmdc:mga0n895_190423_c1_1503_1913 136
257 3300050512 nmdc:mga0n895_2060112_c1 nmdc:mga0n895_2060112_c1_55_465 136
258 3300050515 nmdc:mga0a205_127423_c1 nmdc:mga0a205_127423_c1_1471_1881 136
259 3300050515 nmdc:mga0a205_313019_c1 nmdc:mga0a205_313019_c1_401_811 136
260 3300050515 nmdc:mga0a205_36571_c1 nmdc:mga0a205_36571_c1_3224_3634 136
261 3300054114 Ga0501084_0274176 Ga0501084_0274176_80_490 136
262 3300054114 Ga0501084_1751926 Ga0501084_1751926_84_494 136
263 3300060353 Ga0501082_0099019 Ga0501082_0099019_601_1011 136
264 3300060353 Ga0501082_0143856 Ga0501082_0143856_441_851 136
265 3300060353 Ga0501082_0943232 Ga0501082_0943232_172_582 136
266 3300060353 Ga0501082_1339919 Ga0501082_1339919_74_484 136
267 3300061734 Ga0530510_0309636 Ga0530510_0309636_552_962 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

24

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9249 2 136
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9243 2 136
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9207 2 136
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9174 2 134
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9173 2 136
ID Description Score Start End Superfamily
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8568 2 136 3.30.565.10
af_Q9W466_37_196_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.8268 55 78 3.40.1000.30
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8072 1 136 3.90.1100.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8011 1 136 3.90.1100.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7982 3 133 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A850A706-F1-model_v4 ATP-binding protein 0.9511 2 134 GO:0004674
GO:0005524
AF-A0A7Y5BR41-F1-model_v4 ATP-binding protein 0.9491 2 135 GO:0004674
GO:0005524
AF-A0A3D1JEI0-F1-model_v4 ATP-binding protein 0.9454 2 136 GO:0004674
GO:0005524
AF-A0A661S8G0-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9438 2 136 GO:0004674
AF-A0A5Q4G132-F1-model_v4 ATP-binding protein 0.9437 2 136 GO:0004674
GO:0005524

Feature Viewer

pLDDT pTM Quality
88.21 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map