F374486

General Info

Members Datasets Scaffolds Average Seq Length
267 214 534 134

Family's Representative Sequence

Representative Sequence 3300003759|Ga0055525_1000038|Ga0055525_1000038146
Length 136
Sequence MTNKQILQPPGWAAPKGYANGIAARGTQVFVAGQIGWNARSEFESDDLVDQVRQALTNVKAVLAAAGAEPRHIVRMTWYLLDKREYVMRGREIGMAYREVLGREFGIAMSAVQVVGLVEDRAKVEIEVTAVVDTED

Samples

Sample ID Description Type Environment
1 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
175 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
213 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
214 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 0
Rhizoplane 1.5
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055525_1000038 3300003759 Bacteria 297540
2 JGI25153J46596_10004922 3300003215 Bacteria 7098
3 Ga0070658_11584100 3300005327 Bacteria 568
4 Ga0070676_10515327 3300005328 Bacteria 851
5 Ga0070690_100033093 3300005330 Bacteria 3233
6 Ga0070690_100931904 3300005330 Bacteria 681
7 Ga0068869_100939152 3300005334 Bacteria 750
8 Ga0068868_100172883 3300005338 Bacteria 1789
9 Ga0070689_100091024 3300005340 Bacteria 2404
10 Ga0070687_100154621 3300005343 Bacteria 1350
11 Ga0070668_100850474 3300005347 Bacteria 813
12 Ga0070669_100021002 3300005353 Bacteria 4665
13 Ga0070671_100011175 3300005355 Bacteria 7210
14 Ga0070671_101182001 3300005355 Bacteria 673
15 Ga0070673_101022201 3300005364 Bacteria 770
16 Ga0070688_100259327 3300005365 Bacteria 1241
17 Ga0070688_100269153 3300005365 Bacteria 1220
18 Ga0070688_100625265 3300005365 Bacteria 827
19 Ga0070667_100006270 3300005367 Bacteria 9886
20 Ga0070667_100587101 3300005367 Bacteria 1026
21 Ga0070710_10027930 3300005437 Bacteria 3014
22 Ga0070694_101335443 3300005444 Bacteria 604
23 Ga0070681_11610543 3300005458 Bacteria 575
24 Ga0068867_100798165 3300005459 Bacteria 841
25 Ga0070685_10675258 3300005466 Bacteria 751
26 Ga0070706_101089411 3300005467 Bacteria 735
27 Ga0070706_101292942 3300005467 Bacteria 669
28 Ga0070698_100048340 3300005471 Bacteria 4346
29 Ga0070698_100497547 3300005471 Bacteria 1157
30 Ga0070699_100099205 3300005518 Bacteria 2552
31 Ga0070699_100359309 3300005518 Bacteria 1313
32 Ga0070699_100864684 3300005518 Bacteria 828
33 Ga0070699_100908062 3300005518 Bacteria 807
34 Ga0070684_100753424 3300005535 Bacteria 909
35 Ga0070697_100237852 3300005536 Bacteria 1555
36 Ga0070686_100513181 3300005544 Bacteria 932
37 Ga0070695_101479296 3300005545 Bacteria 565
38 Ga0070696_100100731 3300005546 Bacteria 2070
39 Ga0070696_101072285 3300005546 Bacteria 676
40 Ga0070665_100822080 3300005548 Bacteria 942
41 Ga0068857_101022090 3300005577 Bacteria 796
42 Ga0068854_101593660 3300005578 Bacteria 595
43 Ga0068854_102130212 3300005578 Bacteria 518
44 Ga0068861_100422798 3300005719 Bacteria 1188
45 Ga0068861_100599576 3300005719 Bacteria 1011
46 Ga0068851_10431288 3300005834 Bacteria 780
47 Ga0068860_101437750 3300005843 Bacteria 711
48 Ga0068862_100010005 3300005844 Bacteria 7835
49 Ga0081540_1000040 3300005983 Bacteria 136968
50 Ga0075365_10004553 3300006038 Bacteria 7365
51 Ga0075363_100007871 3300006048 Bacteria 4932
52 Ga0075364_10000914 3300006051 Bacteria 15591
53 Ga0070716_100660510 3300006173 Bacteria 794
54 Ga0075362_10226449 3300006177 Bacteria 915
55 Ga0075367_10011009 3300006178 Bacteria 4770
56 Ga0075367_10015575 3300006178 Bacteria 4138
57 Ga0097621_100392389 3300006237 Bacteria 1241
58 Ga0068871_100002872 3300006358 Bacteria 11810
59 Ga0075428_100306614 3300006844 Bacteria 1707
60 Ga0075430_100676357 3300006846 Bacteria 851
61 Ga0075433_10159428 3300006852 Bacteria 2008
62 Ga0075433_11120669 3300006852 Bacteria 684
63 Ga0075434_100010010 3300006871 Bacteria 8875
64 Ga0075434_100509292 3300006871 Bacteria 1224
65 Ga0075434_100858979 3300006871 Bacteria 923
66 Ga0075429_101000063 3300006880 Bacteria 731
67 Ga0068865_100002842 3300006881 Bacteria 10313
68 Ga0075436_100030535 3300006914 Bacteria 3709
69 Ga0097620_101381634 3300006931 Bacteria 777
70 Ga0105245_11761583 3300009098 Bacteria 672
71 Ga0114129_10019848 3300009147 Bacteria 9565
72 Ga0114129_10027101 3300009147 Bacteria 8113
73 Ga0114129_10032311 3300009147 Bacteria 7397
74 Ga0114129_10111182 3300009147 Bacteria 3781
75 Ga0105241_12488619 3300009174 Bacteria 518
76 Ga0105242_10012513 3300009176 Bacteria 6532
77 Ga0105242_12052130 3300009176 Bacteria 615
78 Ga0105242_12444797 3300009176 Bacteria 570
79 Ga0105248_10019014 3300009177 Bacteria 7597
80 Ga0105248_11845000 3300009177 Bacteria 686
81 Ga0163162_10077980 3300013306 Bacteria 3378
82 Ga0157375_11574270 3300013308 Bacteria 777
83 Ga0163163_10124202 3300014325 Bacteria 2617
84 Ga0157380_10862047 3300014326 Unclassified 928
85 Ga0157379_10055016 3300014968 Bacteria 3556
86 Ga0157376_10035153 3300014969 Bacteria 4052
87 Ga0157376_11124684 3300014969 Bacteria 812
88 Ga0213872_10000183 3300021361 Bacteria 56352
89 Ga0213874_10036260 3300021377 Bacteria 1453
90 Ga0213875_10410472 3300021388 Bacteria 646
91 Ga0209563_100005 3300025230 Bacteria 1774893
92 Ga0209758_1000193 3300025297 Bacteria 134744
93 Ga0207688_10284783 3300025901 Bacteria 1007
94 Ga0207680_10041660 3300025903 Bacteria 2681
95 Ga0207680_10896359 3300025903 Unclassified 636
96 Ga0207684_11084878 3300025910 Bacteria 667
97 Ga0207707_11433420 3300025912 Bacteria 550
98 Ga0207662_10040337 3300025918 Bacteria 2744
99 Ga0207681_10356645 3300025923 Bacteria 1172
100 Ga0207650_10098252 3300025925 Bacteria 2249
101 Ga0207687_10074998 3300025927 Bacteria 2426
102 Ga0207687_11144800 3300025927 Bacteria 668
103 Ga0207644_10077762 3300025931 Bacteria 2444
104 Ga0207686_10048988 3300025934 Bacteria 2620
105 Ga0207670_10048582 3300025936 Bacteria 2833
106 Ga0207670_10474030 3300025936 Bacteria 1013
107 Ga0207704_10032920 3300025938 Bacteria 2941
108 Ga0207704_11126230 3300025938 Bacteria 667
109 Ga0207665_10599625 3300025939 Bacteria 860
110 Ga0207691_10066011 3300025940 Bacteria 3274
111 Ga0207711_10390658 3300025941 Bacteria 1292
112 Ga0207689_10833947 3300025942 Bacteria 778
113 Ga0207679_10496410 3300025945 Bacteria 1088
114 Ga0207651_10753147 3300025960 Bacteria 861
115 Ga0207651_11683124 3300025960 Unclassified 571
116 Ga0207668_10043135 3300025972 Bacteria 3059
117 Ga0207640_11517355 3300025981 Bacteria 602
118 Ga0207658_10678289 3300025986 Bacteria 930
119 Ga0207708_10203554 3300026075 Bacteria 1580
120 Ga0207648_10103151 3300026089 Bacteria 2501
121 Ga0207676_11692621 3300026095 Bacteria 631
122 Ga0207674_11486262 3300026116 Bacteria 647
123 Ga0207675_100326202 3300026118 Bacteria 1500
124 Ga0207683_10657536 3300026121 Bacteria 971
125 Ga0209813_10009505 3300027866 Bacteria 2489
126 Ga0209813_10011972 3300027866 Bacteria 2280
127 Ga0207428_10172550 3300027907 Bacteria 1637
128 Ga0207428_10488920 3300027907 Bacteria 895
129 Ga0268266_10171169 3300028379 Bacteria 1971
130 Ga0268266_11808951 3300028379 Bacteria 585
131 Ga0268265_10026128 3300028380 Bacteria 4151
132 Ga0268265_11102504 3300028380 Bacteria 788
133 Ga0268264_10136490 3300028381 Bacteria 2181
134 Ga0265326_10149772 3300028558 Bacteria 666
135 Ga0307515_10000525 3300028794 Bacteria 91297
136 Ga0265328_10043928 3300031239 Bacteria 1644
137 Ga0265320_10031920 3300031240 Bacteria 2702
138 Ga0265331_10002642 3300031250 Bacteria 12012
139 Ga0265327_10000028 3300031251 Bacteria 361066
140 Ga0307408_100243149 3300031548 Bacteria 1480
141 Ga0307408_101537875 3300031548 Bacteria 630
142 Ga0307405_10189020 3300031731 Bacteria 1486
143 Ga0307405_10948504 3300031731 Bacteria 731
144 Ga0307413_10467360 3300031824 Bacteria 1005
145 Ga0307410_10047398 3300031852 Bacteria 2872
146 Ga0307406_10350070 3300031901 Bacteria 1154
147 Ga0307406_10788079 3300031901 Bacteria 801
148 Ga0307416_100349770 3300032002 Bacteria 1495
149 Ga0307416_100497811 3300032002 Bacteria 1282
150 Ga0307415_100941482 3300032126 Bacteria 799
151 Ga0373926_0023976 3300035083 Bacteria 2122
152 Ga0373934_0084471 3300035086 Bacteria 1277
153 Ga0373952_0094991 3300035092 Bacteria 779
154 Ga0373936_0009841 3300035113 Bacteria 3609
155 Ga0373939_0083058 3300035114 Bacteria 1068
156 Ga0373941_0026506 3300035115 Bacteria 1684
157 Ga0373956_0103993 3300035119 Bacteria 1319
158 Ga0373943_0027606 3300035170 Bacteria 2668
159 Ga0373946_0278312 3300035171 Bacteria 822
160 Ga0373955_0045662 3300035172 Bacteria 2365
161 Ga0373942_0045404 3300035207 Bacteria 1214
162 Ga0373962_0031063 3300035242 Bacteria 1464
163 Ga0373935_0028848 3300035692 Bacteria 3430
164 Ga0373927_0375425 3300035695 Bacteria 937
165 Ga0373927_0722625 3300035695 Bacteria 658
166 Ga0373947_0213132 3300035725 Bacteria 1267
167 Ga0373937_0013814 3300036401 Bacteria 7115
168 Ga0373925_0020931 3300037068 Bacteria 4766
169 Ga0395898_0003564 3300037466 Bacteria 17354
170 Ga0436364_0370365 3300037853 Bacteria 1566
171 Ga0436364_0690950 3300037853 Bacteria 707
172 Ga0436360_0454481 3300039438 Bacteria 1797
173 Ga0436361_0324913 3300039447 Bacteria 5533
174 Ga0436361_0446152 3300039447 Bacteria 899
175 Ga0436363_1718678 3300039450 Bacteria 1066
176 Ga0439435_0004528 3300042436 Bacteria 3002
177 Ga0466966_0037065 3300044684 Bacteria 3146
178 Ga0466966_0145148 3300044684 Bacteria 1449
179 Ga0466961_0867985 3300044693 Bacteria 538
180 Ga0466963_0124270 3300044694 Bacteria 1778
181 Ga0466964_0767490 3300044706 Bacteria 542
182 Ga0466957_0406026 3300044842 Bacteria 932
183 Ga0466959_0052285 3300045049 Bacteria 2993
184 Ga0495651_0153863 3300046462 Bacteria 1654
185 Ga0495653_0034859 3300046463 Bacteria 3975
186 Ga0495580_0026414 3300046472 Bacteria 4233
187 Ga0495580_0167388 3300046472 Bacteria 1520
188 Ga0495582_0052595 3300046473 Bacteria 2245
189 Ga0495639_0036725 3300046475 Bacteria 2195
190 Ga0495662_0025026 3300046476 Bacteria 2882
191 Ga0495584_0022640 3300046491 Bacteria 3187
192 Ga0495594_0049243 3300046499 Bacteria 2316
193 Ga0495630_0043140 3300046517 Bacteria 3369
194 Ga0495666_0024710 3300046526 Bacteria 2968
195 Ga0495640_0259809 3300046533 Bacteria 1085
196 Ga0495586_0050966 3300046535 Bacteria 2240
197 Ga0495667_0058804 3300046559 Bacteria 2524
198 Ga0495668_0102806 3300046616 Bacteria 1563
199 Ga0495634_0337047 3300046642 Bacteria 905
200 Ga0495635_0029301 3300046663 Bacteria 3826
201 Ga0495635_0308909 3300046663 Bacteria 1060
202 Ga0495647_0028663 3300046681 Bacteria 2054
203 Ga0495658_0110747 3300046683 Bacteria 1650
204 Ga0495669_0195451 3300046684 Bacteria 966
205 Ga0495624_0220572 3300046690 Bacteria 1150
206 Ga0495581_0000957 3300047315 Bacteria 15517
207 Ga0495680_0044321 3300047322 Bacteria 3518
208 Ga0495684_0012536 3300047471 Bacteria 6534
209 Ga0495593_0082713 3300047673 Bacteria 1659
210 Ga0495614_0010133 3300048089 Bacteria 4160
211 Ga0496102_0562765 3300048905 Bacteria 1063
212 Ga0496109_0714498 3300048912 Bacteria 940
213 Ga0496110_0131892 3300048913 Bacteria 2257
214 Ga0496114_0235174 3300048917 Bacteria 1610
215 Ga0501292_073963 3300049515 Bacteria 638
216 Ga0501298_042468 3300049521 Bacteria 925
217 Ga0501300_039003 3300049523 Bacteria 713
218 Ga0501301_004714 3300049524 Bacteria 977
219 Ga0501031_0041032 3300049568 Bacteria 3022
220 Ga0501033_0492929 3300049570 Unclassified 848
221 Ga0501039_0045205 3300049575 Bacteria 3402
222 Ga0501039_0068059 3300049575 Bacteria 2765
223 Ga0501041_0131911 3300049577 Bacteria 1556
224 Ga0501042_0027429 3300049578 Bacteria 4005
225 Ga0501042_0328235 3300049578 Bacteria 1106
226 Ga0501046_0331321 3300049580 Unclassified 1108
227 Ga0501069_0551478 3300049585 Bacteria 690
228 Ga0501071_0625729 3300049587 Unclassified 828
229 Ga0501072_0090569 3300049588 Bacteria 2428
230 Ga0501073_0147960 3300049589 Bacteria 1628
231 Ga0501074_0200620 3300049590 Bacteria 1422
232 Ga0501075_0042448 3300049591 Bacteria 3410
233 Ga0501076_0020224 3300049592 Bacteria 5094
234 Ga0501076_0070490 3300049592 Bacteria 2795
235 Ga0501257_099966 3300049686 Bacteria 761
236 Ga0501079_0393276 3300049741 Bacteria 1087
237 Ga0501080_0811127 3300049742 Unclassified 820
238 Ga0501081_0649104 3300049743 Unclassified 791
239 Ga0501083_0002755 3300049744 Bacteria 12142
240 Ga0501265_000482 3300049762 Bacteria 4212
241 Ga0501281_02720 3300049777 Bacteria 1279
242 Ga0501045_0031172 3300049824 Bacteria 3861
243 nmdc:mga03n38_4048_c1 3300050490 Bacteria 4799
244 nmdc:mga00v17_182855_c1 3300050491 Bacteria 1353
245 nmdc:mga0yw44_12219_c1 3300050492 Bacteria 4467
246 nmdc:mga06z11_2481_c1 3300050494 Bacteria 7056
247 nmdc:mga06z11_325693_c1 3300050494 Bacteria 917
248 nmdc:mga06z11_4760_c1 3300050494 Bacteria 5368
249 nmdc:mga04h51_1298_c1 3300050495 Bacteria 5768
250 nmdc:mga04h51_41675_c1 3300050495 Bacteria 1502
251 nmdc:mga07m45_41646_c3 3300050496 Bacteria 1163
252 nmdc:mga05p37_164808_c1 3300050507 Bacteria 2705
253 nmdc:mga05p37_241653_c1 3300050507 Bacteria 2171
254 nmdc:mga05p37_446789_c1 3300050507 Bacteria 1498
255 nmdc:mga05p37_90485_c1 3300050507 Bacteria 3771
256 nmdc:mga09592_928558_c1 3300050508 Bacteria 730
257 nmdc:mga0n895_25224_c1 3300050512 Bacteria 5615
258 nmdc:mga0n895_379345_c1 3300050512 Bacteria 1431
259 nmdc:mga0rr50_754195_c1 3300050513 Bacteria 831
260 nmdc:mga0a205_180079_c1 3300050515 Bacteria 2008
261 Ga0495619_0016619 3300053085 Bacteria 4658
262 Ga0501084_0212745 3300054114 Bacteria 1631
263 Ga0501082_0463780 3300060353 Unclassified 1107
264 Ga0530510_0108020 3300061734 Bacteria 2037
265 2643968088 2643221592 Bacteria 6608788
266 2644142556 2643221625 Bacteria 6512927
267 2644276945 2643221648 Bacteria 6521465
268 Ga0055525_1000038
269 JGI25153J46596_10004922
270 Ga0070658_11584100
271 Ga0070676_10515327
272 Ga0070690_100033093
273 Ga0070690_100931904
274 Ga0068869_100939152
275 Ga0068868_100172883
276 Ga0070689_100091024
277 Ga0070687_100154621
278 Ga0070668_100850474
279 Ga0070669_100021002
280 Ga0070671_100011175
281 Ga0070671_101182001
282 Ga0070673_101022201
283 Ga0070688_100259327
284 Ga0070688_100269153
285 Ga0070688_100625265
286 Ga0070667_100006270
287 Ga0070667_100587101
288 Ga0070710_10027930
289 Ga0070694_101335443
290 Ga0070681_11610543
291 Ga0068867_100798165
292 Ga0070685_10675258
293 Ga0070706_101089411
294 Ga0070706_101292942
295 Ga0070698_100048340
296 Ga0070698_100497547
297 Ga0070699_100099205
298 Ga0070699_100359309
299 Ga0070699_100864684
300 Ga0070699_100908062
301 Ga0070684_100753424
302 Ga0070697_100237852
303 Ga0070686_100513181
304 Ga0070695_101479296
305 Ga0070696_100100731
306 Ga0070696_101072285
307 Ga0070665_100822080
308 Ga0068857_101022090
309 Ga0068854_101593660
310 Ga0068854_102130212
311 Ga0068861_100422798
312 Ga0068861_100599576
313 Ga0068851_10431288
314 Ga0068860_101437750
315 Ga0068862_100010005
316 Ga0081540_1000040
317 Ga0075365_10004553
318 Ga0075363_100007871
319 Ga0075364_10000914
320 Ga0070716_100660510
321 Ga0075362_10226449
322 Ga0075367_10011009
323 Ga0075367_10015575
324 Ga0097621_100392389
325 Ga0068871_100002872
326 Ga0075428_100306614
327 Ga0075430_100676357
328 Ga0075433_10159428
329 Ga0075433_11120669
330 Ga0075434_100010010
331 Ga0075434_100509292
332 Ga0075434_100858979
333 Ga0075429_101000063
334 Ga0068865_100002842
335 Ga0075436_100030535
336 Ga0097620_101381634
337 Ga0105245_11761583
338 Ga0114129_10019848
339 Ga0114129_10027101
340 Ga0114129_10032311
341 Ga0114129_10111182
342 Ga0105241_12488619
343 Ga0105242_10012513
344 Ga0105242_12052130
345 Ga0105242_12444797
346 Ga0105248_10019014
347 Ga0105248_11845000
348 Ga0163162_10077980
349 Ga0157375_11574270
350 Ga0163163_10124202
351 Ga0157380_10862047
352 Ga0157379_10055016
353 Ga0157376_10035153
354 Ga0157376_11124684
355 Ga0213872_10000183
356 Ga0213874_10036260
357 Ga0213875_10410472
358 Ga0209563_100005
359 Ga0209758_1000193
360 Ga0207688_10284783
361 Ga0207680_10041660
362 Ga0207680_10896359
363 Ga0207684_11084878
364 Ga0207707_11433420
365 Ga0207662_10040337
366 Ga0207681_10356645
367 Ga0207650_10098252
368 Ga0207687_10074998
369 Ga0207687_11144800
370 Ga0207644_10077762
371 Ga0207686_10048988
372 Ga0207670_10048582
373 Ga0207670_10474030
374 Ga0207704_10032920
375 Ga0207704_11126230
376 Ga0207665_10599625
377 Ga0207691_10066011
378 Ga0207711_10390658
379 Ga0207689_10833947
380 Ga0207679_10496410
381 Ga0207651_10753147
382 Ga0207651_11683124
383 Ga0207668_10043135
384 Ga0207640_11517355
385 Ga0207658_10678289
386 Ga0207708_10203554
387 Ga0207648_10103151
388 Ga0207676_11692621
389 Ga0207674_11486262
390 Ga0207675_100326202
391 Ga0207683_10657536
392 Ga0209813_10009505
393 Ga0209813_10011972
394 Ga0207428_10172550
395 Ga0207428_10488920
396 Ga0268266_10171169
397 Ga0268266_11808951
398 Ga0268265_10026128
399 Ga0268265_11102504
400 Ga0268264_10136490
401 Ga0265326_10149772
402 Ga0307515_10000525
403 Ga0265328_10043928
404 Ga0265320_10031920
405 Ga0265331_10002642
406 Ga0265327_10000028
407 Ga0307408_100243149
408 Ga0307408_101537875
409 Ga0307405_10189020
410 Ga0307405_10948504
411 Ga0307413_10467360
412 Ga0307410_10047398
413 Ga0307406_10350070
414 Ga0307406_10788079
415 Ga0307416_100349770
416 Ga0307416_100497811
417 Ga0307415_100941482
418 Ga0373926_0023976
419 Ga0373934_0084471
420 Ga0373952_0094991
421 Ga0373936_0009841
422 Ga0373939_0083058
423 Ga0373941_0026506
424 Ga0373956_0103993
425 Ga0373943_0027606
426 Ga0373946_0278312
427 Ga0373955_0045662
428 Ga0373942_0045404
429 Ga0373962_0031063
430 Ga0373935_0028848
431 Ga0373927_0375425
432 Ga0373927_0722625
433 Ga0373947_0213132
434 Ga0373937_0013814
435 Ga0373925_0020931
436 Ga0395898_0003564
437 Ga0436364_0370365
438 Ga0436364_0690950
439 Ga0436360_0454481
440 Ga0436361_0324913
441 Ga0436361_0446152
442 Ga0436363_1718678
443 Ga0439435_0004528
444 Ga0466966_0037065
445 Ga0466966_0145148
446 Ga0466961_0867985
447 Ga0466963_0124270
448 Ga0466964_0767490
449 Ga0466957_0406026
450 Ga0466959_0052285
451 Ga0495651_0153863
452 Ga0495653_0034859
453 Ga0495580_0026414
454 Ga0495580_0167388
455 Ga0495582_0052595
456 Ga0495639_0036725
457 Ga0495662_0025026
458 Ga0495584_0022640
459 Ga0495594_0049243
460 Ga0495630_0043140
461 Ga0495666_0024710
462 Ga0495640_0259809
463 Ga0495586_0050966
464 Ga0495667_0058804
465 Ga0495668_0102806
466 Ga0495634_0337047
467 Ga0495635_0029301
468 Ga0495635_0308909
469 Ga0495647_0028663
470 Ga0495658_0110747
471 Ga0495669_0195451
472 Ga0495624_0220572
473 Ga0495581_0000957
474 Ga0495680_0044321
475 Ga0495684_0012536
476 Ga0495593_0082713
477 Ga0495614_0010133
478 Ga0496102_0562765
479 Ga0496109_0714498
480 Ga0496110_0131892
481 Ga0496114_0235174
482 Ga0501292_073963
483 Ga0501298_042468
484 Ga0501300_039003
485 Ga0501301_004714
486 Ga0501031_0041032
487 Ga0501033_0492929
488 Ga0501039_0045205
489 Ga0501039_0068059
490 Ga0501041_0131911
491 Ga0501042_0027429
492 Ga0501042_0328235
493 Ga0501046_0331321
494 Ga0501069_0551478
495 Ga0501071_0625729
496 Ga0501072_0090569
497 Ga0501073_0147960
498 Ga0501074_0200620
499 Ga0501075_0042448
500 Ga0501076_0020224
501 Ga0501076_0070490
502 Ga0501257_099966
503 Ga0501079_0393276
504 Ga0501080_0811127
505 Ga0501081_0649104
506 Ga0501083_0002755
507 Ga0501265_000482
508 Ga0501281_02720
509 Ga0501045_0031172
510 nmdc:mga03n38_4048_c1
511 nmdc:mga00v17_182855_c1
512 nmdc:mga0yw44_12219_c1
513 nmdc:mga06z11_2481_c1
514 nmdc:mga06z11_325693_c1
515 nmdc:mga06z11_4760_c1
516 nmdc:mga04h51_1298_c1
517 nmdc:mga04h51_41675_c1
518 nmdc:mga07m45_41646_c3
519 nmdc:mga05p37_164808_c1
520 nmdc:mga05p37_241653_c1
521 nmdc:mga05p37_446789_c1
522 nmdc:mga05p37_90485_c1
523 nmdc:mga09592_928558_c1
524 nmdc:mga0n895_25224_c1
525 nmdc:mga0n895_379345_c1
526 nmdc:mga0rr50_754195_c1
527 nmdc:mga0a205_180079_c1
528 Ga0495619_0016619
529 Ga0501084_0212745
530 Ga0501082_0463780
531 Ga0530510_0108020
532 2643968088
533 2644142556
534 2644276945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

11

132

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.8549 15 129
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8506 16 128
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8433 16 128
2b33-assembly1.cif.gz_A crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution 0.8384 15 130
6tcd-assembly2.cif.gz_E crystal structure of salmo salar rida-2 0.8366 15 130
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8441 16 128 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8386 15 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8369 16 128 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8358 15 128 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8242 14 128 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7W5RBE7-F1-model_v4 deleted 0.9939 2 130
AF-A0A431JUH4-F1-model_v4 RidA family protein 0.9919 2 129
AF-G6YFA9-F1-model_v4 Endoribonuclease L-PSP 0.9907 2 130
AF-A0A527W0G0-F1-model_v4 RidA family protein 0.9897 23 130 GO:0005829
GO:0019239
AF-A0A4R9VQN0-F1-model_v4 RidA family protein 0.9896 2 130

Map