F374482

General Info

Members Datasets Scaffolds Average Seq Length
267 202 534 157

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1002380|Ga0006562J51391_10023801
Length 170
Sequence MLKVQEIRELIKLVDQSSIDEFVYENEGSKIKMKKNVSATYVSQVSAAPSVIEAVPTPLAPIVQTATPSVAVQEVGQEVQKQETVKQADTTNLHKIVSPMVGTFYASPTPDADNYVKQGSNVTKDSIVCIVEAMKLFNEIEAEIDGEIVEILVKNGQLVEYGQPLFLVKP

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
5 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
6 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
9 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
10 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
11 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
13 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
17 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
18 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
19 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
20 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
21 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
22 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
23 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
24 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
25 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
26 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
27 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
28 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
29 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
30 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
31 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
32 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
33 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
34 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
35 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
36 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
37 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
38 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
39 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
40 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
41 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
42 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
43 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
44 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
45 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
46 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
47 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
48 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
49 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
50 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
51 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
52 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
53 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
54 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
55 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
56 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
57 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
65 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
85 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
86 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
89 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
90 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
91 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
92 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
93 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
94 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
95 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
96 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
97 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
98 2643221729 Bacillus sp. Root11 Isolate Unclassified
99 2643221730 Bacillus sp. Root131 Isolate Unclassified
100 2643221731 Bacillus sp. Root147 Isolate Unclassified
101 2643221732 Bacillus sp. Root239 Isolate Unclassified
102 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
103 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
104 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
105 2684622632 Bacillus cereus 905 Isolate Unclassified
106 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
107 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
108 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
109 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
110 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
111 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
112 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
113 2738541295 Bacillus sp. OK085 Isolate Unclassified
114 2738541358 Bacillus sp. OV752 Isolate Unclassified
115 2738543006 Bacillus sp. OK077 Isolate Unclassified
116 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
117 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
118 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
119 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
120 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
121 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
122 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
123 2818991441 Niallia circulans 3243 Isolate Rhizosphere
124 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
125 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
126 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
127 2842682962 Bacillus sp. R-72492 Isolate Unclassified
128 2842882022 Bacillus sp. R-71893 Isolate Unclassified
129 2849139964 Bacillus sp. R-71875 Isolate Unclassified
130 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
131 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
132 2857581216 Bacillus sp. R-71922 Isolate Unclassified
133 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
134 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
135 2860837431 Bacillus sp. WR11 Isolate Unclassified
136 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
137 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
138 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
139 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
140 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
141 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
142 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
143 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
144 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
145 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
146 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
147 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
148 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
149 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
150 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
151 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
152 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
153 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
154 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
155 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
156 2919720352 Priestia megaterium 4340 Isolate Unclassified
157 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
158 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
159 2929004312 Priestia megaterium 1104 Isolate Unclassified
160 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
161 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
162 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
163 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
164 2938917290 Bacillus sp. CR71 Isolate Unclassified
165 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
166 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
167 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
168 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
169 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
170 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
171 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
172 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
173 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
174 2965761152 Bacillus sp. COPE52 Isolate Unclassified
175 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
176 2969141011 Bacillus velezensis MH25 Isolate Unclassified
177 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
178 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
179 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
180 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
181 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
182 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
183 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
184 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
185 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
186 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
187 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
188 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
189 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
190 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
191 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
192 8022653035 Bacillus sp. Rc4 Isolate Unclassified
193 8022792930 Bacillus sp. Xin Isolate Rhizosphere
194 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
195 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
196 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
197 8023438354 Bacillus sp. BH2 Isolate Unclassified
198 8023444577 Bacillus sp. BH32 Isolate Unclassified
199 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
200 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
201 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
202 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 39.33
Metatranscriptomes 17.98
Isolates 42.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 3.37
Rhizosphere 55.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1002380 3300003578 Bacteria 2500
2 JGI25159J45721_1011193 3300002987 Bacteria 2221
3 JGI25159J45721_1024185 3300002987 Bacteria 1087
4 JGI25151J46595_10005991 3300003187 Bacteria 6191
5 JGI25151J46595_10006095 3300003187 Bacteria 6124
6 Ga0006562J51391_1011131 3300003578 Bacteria 2439
7 Ga0105251_10353694 3300009011 Bacteria 671
8 Ga0105244_10002547 3300009036 Bacteria 13685
9 Ga0105244_10013881 3300009036 Bacteria 4681
10 Ga0105244_10059182 3300009036 Bacteria 1932
11 Ga0105244_10150758 3300009036 Bacteria 1114
12 Ga0105250_10000777 3300009092 Bacteria 19313
13 Ga0105250_10339831 3300009092 Bacteria 656
14 Ga0105250_10415556 3300009092 Bacteria 599
15 Ga0105246_10011769 3300011119 Bacteria 5437
16 Ga0209147_103119 3300025229 Bacteria 3449
17 Ga0209147_103611 3300025229 Bacteria 2910
18 Ga0209437_101630 3300025233 Bacteria 5125
19 Ga0209130_1001432 3300025284 Bacteria 15855
20 Ga0209130_1001553 3300025284 Bacteria 14596
21 Ga0209676_1100718 3300025292 Bacteria 615
22 Ga0209025_1001032 3300025294 Bacteria 40808
23 Ga0209025_1007203 3300025294 Bacteria 8379
24 Ga0209025_1008487 3300025294 Bacteria 7387
25 Ga0207696_1015733 3300025711 Bacteria 2555
26 Ga0207655_1002826 3300025728 Bacteria 13459
27 Ga0207655_1011946 3300025728 Bacteria 5119
28 Ga0207713_1163166 3300025735 Bacteria 709
29 Ga0209371_1016534 3300027312 Bacteria 1941
30 Ga0237817_10087 3300030083 Bacteria 28269
31 Ga0237817_10176 3300030083 Bacteria 18082
32 Ga0268256_1018377 3300030500 Bacteria 1941
33 Ga0307408_100000759 3300031548 Bacteria 25947
34 Ga0307408_100981253 3300031548 Bacteria 778
35 Ga0307405_10092983 3300031731 Bacteria 2002
36 Ga0307405_10985679 3300031731 Bacteria 718
37 Ga0307412_10232425 3300031911 Bacteria 1421
38 Ga0307409_100001838 3300031995 Bacteria 10791
39 Ga0307409_100147860 3300031995 Bacteria 2035
40 Ga0307416_100022358 3300032002 Bacteria 4563
41 Ga0307416_100225323 3300032002 Bacteria 1802
42 Ga0237819_10428 3300038705 Bacteria 1212
43 Ga0466969_0002838 3300044656 Bacteria 9268
44 Ga0466966_0480226 3300044684 Bacteria 747
45 Ga0466968_0009039 3300044735 Bacteria 3831
46 Ga0466959_0001222 3300045049 Bacteria 15504
47 Ga0466967_0011516 3300045976 Bacteria 6705
48 Ga0495584_0113719 3300046491 Bacteria 1369
49 Ga0495584_0115786 3300046491 Bacteria 1357
50 Ga0495606_0123375 3300046507 Bacteria 1548
51 Ga0495620_0104635 3300046515 Bacteria 1126
52 Ga0495661_0084222 3300046665 Bacteria 1826
53 Ga0495661_0220104 3300046665 Bacteria 984
54 Ga0495649_0104765 3300046694 Bacteria 1502
55 Ga0495660_0060419 3300046810 Bacteria 2036
56 Ga0495626_0008552 3300048091 Bacteria 5600
57 Ga0495626_0034962 3300048091 Bacteria 2401
58 Ga0496101_0833499 3300048904 Bacteria 727
59 Ga0496102_0283298 3300048905 Bacteria 1562
60 Ga0496103_0211298 3300048906 Bacteria 1248
61 Ga0496107_0294163 3300048910 Bacteria 1209
62 Ga0496109_0092903 3300048912 Bacteria 2791
63 Ga0496110_0270610 3300048913 Bacteria 1547
64 Ga0496111_0045641 3300048914 Bacteria 3153
65 Ga0496112_0077590 3300048915 Bacteria 3285
66 Ga0496113_0130713 3300048916 Bacteria 1970
67 Ga0496116_0001262 3300048919 Bacteria 29283
68 Ga0496116_0006812 3300048919 Bacteria 10276
69 Ga0496116_0007146 3300048919 Bacteria 9985
70 Ga0496116_0008110 3300048919 Bacteria 9178
71 Ga0496116_0353647 3300048919 Bacteria 671
72 Ga0496117_0006027 3300048920 Bacteria 12459
73 Ga0496117_0016892 3300048920 Bacteria 6124
74 Ga0496118_0017547 3300048921 Bacteria 6507
75 Ga0496119_0000122 3300048922 Bacteria 109048
76 Ga0496119_0032512 3300048922 Bacteria 3475
77 Ga0496120_0000045 3300048923 Bacteria 191663
78 Ga0496120_0035561 3300048923 Bacteria 2974
79 Ga0496121_0154994 3300048924 Bacteria 1681
80 Ga0496121_0436185 3300048924 Bacteria 848
81 Ga0496122_0030807 3300048925 Bacteria 4483
82 Ga0496122_0136078 3300048925 Bacteria 1548
83 Ga0496122_0141610 3300048925 Bacteria 1503
84 Ga0496122_0241461 3300048925 Bacteria 1018
85 Ga0496122_0266320 3300048925 Bacteria 947
86 Ga0496122_0383329 3300048925 Bacteria 720
87 Ga0496123_0077322 3300048926 Bacteria 2044
88 Ga0496123_0089752 3300048926 Bacteria 1830
89 Ga0496124_0001617 3300048927 Bacteria 32284
90 Ga0496124_0029034 3300048927 Bacteria 4935
91 Ga0496124_0040625 3300048927 Bacteria 4022
92 Ga0496124_0059839 3300048927 Bacteria 3198
93 Ga0496124_0120006 3300048927 Bacteria 2103
94 Ga0496124_0213743 3300048927 Bacteria 1457
95 Ga0496125_0000492 3300048928 Bacteria 69225
96 Ga0496125_0066832 3300048928 Bacteria 2838
97 Ga0496125_0284849 3300048928 Bacteria 1021
98 Ga0496125_0529666 3300048928 Bacteria 657
99 Ga0496126_0002349 3300048929 Bacteria 25865
100 Ga0496126_0016871 3300048929 Bacteria 7290
101 Ga0496126_0027324 3300048929 Bacteria 5452
102 Ga0501306_030154 3300049127 Bacteria 802
103 Ga0501341_05025 3300049131 Bacteria 784
104 Ga0501343_000492 3300049132 Bacteria 2319
105 Ga0501343_006131 3300049132 Bacteria 934
106 Ga0501343_008202 3300049132 Bacteria 832
107 Ga0501344_01577 3300049133 Bacteria 1118
108 Ga0501345_03098 3300049134 Bacteria 708
109 Ga0501305_002373 3300049161 Bacteria 2020
110 Ga0501342_01511 3300049163 Bacteria 742
111 Ga0501290_030968 3300049513 Bacteria 767
112 Ga0501311_026689 3300049527 Bacteria 815
113 Ga0501311_028038 3300049527 Bacteria 802
114 Ga0501312_000246 3300049528 Bacteria 3898
115 Ga0501312_017727 3300049528 Bacteria 1031
116 Ga0501312_041706 3300049528 Bacteria 752
117 Ga0501313_022589 3300049529 Bacteria 785
118 Ga0501313_031402 3300049529 Bacteria 690
119 Ga0501315_000579 3300049531 Bacteria 2636
120 Ga0501315_001380 3300049531 Bacteria 2062
121 Ga0501315_022192 3300049531 Bacteria 864
122 Ga0501316_025921 3300049532 Bacteria 765
123 Ga0501317_030160 3300049533 Bacteria 783
124 Ga0501317_031729 3300049533 Bacteria 770
125 Ga0501321_032299 3300049537 Bacteria 705
126 Ga0501323_009112 3300049539 Bacteria 1165
127 Ga0501323_015000 3300049539 Bacteria 974
128 Ga0501324_021394 3300049540 Bacteria 663
129 Ga0501326_03140 3300049542 Bacteria 837
130 Ga0501330_006637 3300049546 Bacteria 761
131 Ga0501330_007594 3300049546 Bacteria 730
132 Ga0501331_06596 3300049547 Bacteria 679
133 Ga0501332_07885 3300049548 Bacteria 685
134 Ga0501332_12118 3300049548 Bacteria 590
135 Ga0501334_00764 3300049550 Bacteria 1605
136 Ga0501334_05445 3300049550 Bacteria 840
137 Ga0501334_09230 3300049550 Bacteria 699
138 Ga0501334_10660 3300049550 Bacteria 666
139 Ga0501335_010149 3300049551 Bacteria 906
140 Ga0501336_004174 3300049552 Bacteria 1005
141 Ga0501336_015039 3300049552 Bacteria 660
142 Ga0501337_001408 3300049553 Bacteria 1372
143 Ga0501337_001709 3300049553 Bacteria 1280
144 Ga0501337_005144 3300049553 Bacteria 870
145 Ga0501338_04085 3300049554 Bacteria 878
146 Ga0501338_04430 3300049554 Bacteria 852
147 Ga0501338_09140 3300049554 Bacteria 657
148 Ga0501340_010042 3300049556 Bacteria 690
149 Ga0501217_033850 3300049661 Bacteria 1271
150 Ga0501227_075136 3300049665 Bacteria 881
151 Ga0501225_0006158 3300049705 Bacteria 3505
152 Ga0501082_0586703 3300060353 Bacteria 975
153 Ga0466962_0077229 3300061719 Bacteria 1592
154 2511700228 2511231119 Bacteria 4019861
155 2540607371 2540341094 Bacteria 4061186
156 2545556912 2545555800 Bacteria 4222588
157 2553393460 2551306519 Bacteria 5465154
158 2573038974 2571042588 Bacteria 5045676
159 2578931166 2576861599 Bacteria 4217202
160 2580933449 2579778775 Bacteria 5360914
161 2621276186 2619619294 Bacteria 5575484
162 2631985484 2630968484 Bacteria 3876276
163 2644708235 2643221729 Bacteria 6621700
164 2644712538 2643221730 Bacteria 6523787
165 2644715852 2643221731 Bacteria 5623886
166 2644724277 2643221732 Bacteria 5756404
167 2651531892 2648501850 Bacteria 3975476
168 2672336898 2671180330 Bacteria 5521719
169 2674418958 2671180844 Bacteria 4164150
170 2685152159 2684622632 Bacteria 5380049
171 2695628207 2695420354 Bacteria 3922431
172 2698321004 2695420987 Bacteria 6152737
173 2705996100 2703719227 Bacteria 5631989
174 2717916086 2716884898 Bacteria 3928789
175 2721507320 2718218445 Bacteria 5113413
176 2723604731 2721755693 Bacteria 6126117
177 2730135369 2728369359 Bacteria 5621728
178 2738813798 2738541295 Bacteria 5730091
179 2739154639 2738541358 Bacteria 5932299
180 2739207989 2738543006 Bacteria 5904091
181 2745166241 2744054657 Bacteria 5016802
182 2753809826 2751185905 Bacteria 6142767
183 2802436987 2802428803 Bacteria 5806948
184 2808869367 2808606364 Bacteria 4465927
185 2809055946 2808606399 Bacteria 4021018
186 2816862648 2816332186 Bacteria 5331395
187 2817618054 2816332336 Bacteria 5207640
188 2819569197 2818991441 Bacteria 5062707
189 2819584380 2818991443 Bacteria 6598732
190 2819709324 2818991465 Bacteria 5388835
191 2821114440 2821111986 Bacteria 6894338
192 2842684430 2842682962 Bacteria 5589973
193 2842884428 2842882022 Bacteria 6158489
194 2849145522 2849139964 Bacteria 5613304
195 2852675402 2852673933 Bacteria 3347676
196 2857461179 2857460504 Bacteria 5194327
197 2857582385 2857581216 Bacteria 5522813
198 2857604185 2857604169 Bacteria 5111450
199 2857610839 2857609550 Bacteria 3753890
200 2860840061 2860837431 Bacteria 4202080
201 2864737722 2864733723 Bacteria 6770668
202 2877771113 2877768649 Bacteria 3957164
203 2880171977 2880169592 Bacteria 3900066
204 2881644341 2881644220 Bacteria 5302661
205 2885527395 2885526491 Bacteria 7164189
206 2889046585 2889042446 Bacteria 7618936
207 2889050261 2889049205 Bacteria 7524325
208 2889280640 2889276214 Bacteria 5979355
209 2897112188 2897109615 Bacteria 4009619
210 2898909957 2898907183 Bacteria 4067722
211 2904118182 2904113452 Bacteria 7796941
212 2904163461 2904162308 Bacteria 7086713
213 2904497009 2904490793 Bacteria 7046938
214 2904524542 2904524088 Bacteria 5887454
215 2904562067 2904560550 Bacteria 4029838
216 2904595430 2904595352 Bacteria 6124848
217 2919146881 2919143609 Bacteria 6219228
218 2919165292 2919160200 Bacteria 6929020
219 2919415370 2919414237 Bacteria 5429133
220 2919518785 2919517244 Bacteria 5858162
221 2919723150 2919720352 Bacteria 5986006
222 2928096321 2928093941 Bacteria 5965005
223 2928514130 2928510474 Bacteria 4815308
224 2929006305 2929004312 Bacteria 5678476
225 2929208591 2929206907 Bacteria 5918291
226 2929237858 2929233124 Bacteria 5948380
227 2931390033 2931384279 Bacteria 7299545
228 2936367321 2936361878 Bacteria 5632809
229 2938922050 2938917290 Bacteria 5914775
230 2939679978 2939679117 Bacteria 6921672
231 2939706440 2939702853 Bacteria 5139229
232 2945991273 2945991243 Bacteria 7008369
233 2946053970 2946053406 Bacteria 6978655
234 2947430943 2947426588 Bacteria 5357194
235 2960319942 2960319331 Bacteria 5502575
236 2960380847 2960375949 Bacteria 5361395
237 2962293335 2962290636 Bacteria 4072939
238 2964379138 2964375228 Bacteria 4909004
239 2965765685 2965761152 Bacteria 5806513
240 2969139346 2969136845 Bacteria 3923176
241 2969143560 2969141011 Bacteria 4118468
242 2969767314 2969765954 Bacteria 4216713
243 2969773374 2969770375 Bacteria 4271280
244 2971895759 2971893375 Bacteria 3929648
245 2977256670 2977254563 Bacteria 4828420
246 2979087844 2979083700 Bacteria 5894929
247 2980495100 2980492589 Bacteria 4072961
248 2990277543 2990275345 Bacteria 4887158
249 2996711218 2996706504 Bacteria 5757485
250 3001268318 3001267043 Bacteria 4823521
251 3001273815 3001272096 Bacteria 4729684
252 3006984607 3006984091 Bacteria 4207523
253 3006989014 3006988479 Bacteria 4767936
254 648170770 648028048 Bacteria 5394884
255 8022624085 8022621104 Bacteria 5241040
256 8022631854 8022630665 Bacteria 3886130
257 8022654225 8022653035 Bacteria 4035078
258 8022796779 8022792930 Bacteria 5693794
259 8022898100 8022893055 Bacteria 5300455
260 8022917282 8022914991 Bacteria 5584517
261 8022949766 8022948649 Bacteria 5366783
262 8023443008 8023438354 Bacteria 5779374
263 8023445052 8023444577 Bacteria 5661597
264 8051955314 8051952484 Bacteria 3926774
265 8052178191 8052174270 Bacteria 3881265
266 8055635744 8055632911 Bacteria 5283357
267 8057979004 8057977335 Bacteria 5694872
268 Ga0006562J51391_1002380
269 JGI25159J45721_1011193
270 JGI25159J45721_1024185
271 JGI25151J46595_10005991
272 JGI25151J46595_10006095
273 Ga0006562J51391_1011131
274 Ga0105251_10353694
275 Ga0105244_10002547
276 Ga0105244_10013881
277 Ga0105244_10059182
278 Ga0105244_10150758
279 Ga0105250_10000777
280 Ga0105250_10339831
281 Ga0105250_10415556
282 Ga0105246_10011769
283 Ga0209147_103119
284 Ga0209147_103611
285 Ga0209437_101630
286 Ga0209130_1001432
287 Ga0209130_1001553
288 Ga0209676_1100718
289 Ga0209025_1001032
290 Ga0209025_1007203
291 Ga0209025_1008487
292 Ga0207696_1015733
293 Ga0207655_1002826
294 Ga0207655_1011946
295 Ga0207713_1163166
296 Ga0209371_1016534
297 Ga0237817_10087
298 Ga0237817_10176
299 Ga0268256_1018377
300 Ga0307408_100000759
301 Ga0307408_100981253
302 Ga0307405_10092983
303 Ga0307405_10985679
304 Ga0307412_10232425
305 Ga0307409_100001838
306 Ga0307409_100147860
307 Ga0307416_100022358
308 Ga0307416_100225323
309 Ga0237819_10428
310 Ga0466969_0002838
311 Ga0466966_0480226
312 Ga0466968_0009039
313 Ga0466959_0001222
314 Ga0466967_0011516
315 Ga0495584_0113719
316 Ga0495584_0115786
317 Ga0495606_0123375
318 Ga0495620_0104635
319 Ga0495661_0084222
320 Ga0495661_0220104
321 Ga0495649_0104765
322 Ga0495660_0060419
323 Ga0495626_0008552
324 Ga0495626_0034962
325 Ga0496101_0833499
326 Ga0496102_0283298
327 Ga0496103_0211298
328 Ga0496107_0294163
329 Ga0496109_0092903
330 Ga0496110_0270610
331 Ga0496111_0045641
332 Ga0496112_0077590
333 Ga0496113_0130713
334 Ga0496116_0001262
335 Ga0496116_0006812
336 Ga0496116_0007146
337 Ga0496116_0008110
338 Ga0496116_0353647
339 Ga0496117_0006027
340 Ga0496117_0016892
341 Ga0496118_0017547
342 Ga0496119_0000122
343 Ga0496119_0032512
344 Ga0496120_0000045
345 Ga0496120_0035561
346 Ga0496121_0154994
347 Ga0496121_0436185
348 Ga0496122_0030807
349 Ga0496122_0136078
350 Ga0496122_0141610
351 Ga0496122_0241461
352 Ga0496122_0266320
353 Ga0496122_0383329
354 Ga0496123_0077322
355 Ga0496123_0089752
356 Ga0496124_0001617
357 Ga0496124_0029034
358 Ga0496124_0040625
359 Ga0496124_0059839
360 Ga0496124_0120006
361 Ga0496124_0213743
362 Ga0496125_0000492
363 Ga0496125_0066832
364 Ga0496125_0284849
365 Ga0496125_0529666
366 Ga0496126_0002349
367 Ga0496126_0016871
368 Ga0496126_0027324
369 Ga0501306_030154
370 Ga0501341_05025
371 Ga0501343_000492
372 Ga0501343_006131
373 Ga0501343_008202
374 Ga0501344_01577
375 Ga0501345_03098
376 Ga0501305_002373
377 Ga0501342_01511
378 Ga0501290_030968
379 Ga0501311_026689
380 Ga0501311_028038
381 Ga0501312_000246
382 Ga0501312_017727
383 Ga0501312_041706
384 Ga0501313_022589
385 Ga0501313_031402
386 Ga0501315_000579
387 Ga0501315_001380
388 Ga0501315_022192
389 Ga0501316_025921
390 Ga0501317_030160
391 Ga0501317_031729
392 Ga0501321_032299
393 Ga0501323_009112
394 Ga0501323_015000
395 Ga0501324_021394
396 Ga0501326_03140
397 Ga0501330_006637
398 Ga0501330_007594
399 Ga0501331_06596
400 Ga0501332_07885
401 Ga0501332_12118
402 Ga0501334_00764
403 Ga0501334_05445
404 Ga0501334_09230
405 Ga0501334_10660
406 Ga0501335_010149
407 Ga0501336_004174
408 Ga0501336_015039
409 Ga0501337_001408
410 Ga0501337_001709
411 Ga0501337_005144
412 Ga0501338_04085
413 Ga0501338_04430
414 Ga0501338_09140
415 Ga0501340_010042
416 Ga0501217_033850
417 Ga0501227_075136
418 Ga0501225_0006158
419 Ga0501082_0586703
420 Ga0466962_0077229
421 2511700228
422 2540607371
423 2545556912
424 2553393460
425 2573038974
426 2578931166
427 2580933449
428 2621276186
429 2631985484
430 2644708235
431 2644712538
432 2644715852
433 2644724277
434 2651531892
435 2672336898
436 2674418958
437 2685152159
438 2695628207
439 2698321004
440 2705996100
441 2717916086
442 2721507320
443 2723604731
444 2730135369
445 2738813798
446 2739154639
447 2739207989
448 2745166241
449 2753809826
450 2802436987
451 2808869367
452 2809055946
453 2816862648
454 2817618054
455 2819569197
456 2819584380
457 2819709324
458 2821114440
459 2842684430
460 2842884428
461 2849145522
462 2852675402
463 2857461179
464 2857582385
465 2857604185
466 2857610839
467 2860840061
468 2864737722
469 2877771113
470 2880171977
471 2881644341
472 2885527395
473 2889046585
474 2889050261
475 2889280640
476 2897112188
477 2898909957
478 2904118182
479 2904163461
480 2904497009
481 2904524542
482 2904562067
483 2904595430
484 2919146881
485 2919165292
486 2919415370
487 2919518785
488 2919723150
489 2928096321
490 2928514130
491 2929006305
492 2929208591
493 2929237858
494 2931390033
495 2936367321
496 2938922050
497 2939679978
498 2939706440
499 2945991273
500 2946053970
501 2947430943
502 2960319942
503 2960380847
504 2962293335
505 2964379138
506 2965765685
507 2969139346
508 2969143560
509 2969767314
510 2969773374
511 2971895759
512 2977256670
513 2979087844
514 2980495100
515 2990277543
516 2996711218
517 3001268318
518 3001273815
519 3006984607
520 3006989014
521 648170770
522 8022624085
523 8022631854
524 8022654225
525 8022796779
526 8022898100
527 8022917282
528 8022949766
529 8023443008
530 8023445052
531 8051955314
532 8052178191
533 8055635744
534 8057979004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

94

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9831 63 138
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9474 64 137
1dd2-assembly1.cif.gz_A biotin carboxyl carrier domain of transcarboxylase (tc 1.3s) 0.9415 64 137
2b8f-assembly1.cif.gz_A solution structure of bacillus subtilis blap apo form (energy minimized mean structure) 0.9353 65 135
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9351 63 137
ID Description Score Start End Superfamily
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9804 63 137 2.40.50.100
af_Q93W03_192_271_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9624 61 137 2.40.50.100
af_Q2FXX0_70_148_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9566 61 137 2.40.50.100
af_Q58628_489_566_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9532 64 137 2.40.50.100
2d5dB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9434 64 137 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3D4JS47-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1 61 138 GO:0003989
GO:0006633
GO:0009317
AF-A0A6L7JPP6-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9951 61 139 GO:0003989
GO:0006633
GO:0009317
AF-A0A837GMF7-F1-model_v4 deleted 0.9877 62 139
AF-L8NPU0-F1-model_v4 deleted 0.9796 56 137
AF-A0A386X1N1-F1-model_v4 deleted 0.9741 61 139

Map