F374370

General Info

Members Datasets Scaffolds Average Seq Length
266 170 256 294

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_002283|Ga0501241_002283_539_1543
Length 334
Sequence VKVVGFSPETSIQDADKHLLTIFDDYLAGILIILRKYMYDICCVGHITLDKVVTTKSVVHMAGGTSFYFSNAIRHMDVKYRLVTALAESEMNTVAELRAKGIEVDALPSRHTVYFENIYSENQDHRTQRVLQKADPFSIEALSHTEANIFHLGPLLADDMPVELIRSLSARGKVSLDVQGYLRKVEDHNVFAIDWPAKQEAIKYIHTLKANEHEMEVLTGHKEVRKGAITLAEWGVKEVVITLGSMGSVIYADGVFHRIPAYVPTMVIDATGCGDTYMAGYLYQRSKGASLQQAGEFAAAMATLKIESSGPFTGAKQDVLDLLANSREKIFATL

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2914759650 Rhizosphaericola mali Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
100 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
101 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
102 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
148 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
149 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
150 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
151 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
155 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
170 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.3
Nodule 0
Rhizoplane 1.13
Rhizosphere 62.41
Stem 0
Stem Tuber 0
Unclassified 16.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013222 3300001989 Bacteria 3017
2 JGI24737J22298_10000022 3300001990 Bacteria 45529
3 JGI24737J22298_10017903 3300001990 Bacteria 2278
4 JGI24735J21928_10000031 3300002067 Bacteria 75354
5 JGI25162J39368_1000793 3300002737 Bacteria 21112
6 JGI25164J39214_1001983 3300002772 Bacteria 3682
7 JGI25165J46597_1000990 3300003214 Bacteria 18944
8 JGI25153J46596_10010909 3300003215 Unclassified 4063
9 rootH1_10000605 3300003316 Bacteria 10873
10 rootH1_10000605 3300003323 Bacteria 6862
11 rootH1_10008079 3300003316 Bacteria 5054
12 rootH1_10190554 3300003316 Bacteria 1769
13 rootH2_10011976 3300003320 Bacteria 56805
14 rootH2_10041902 3300003320 Bacteria 11603
15 rootH2_10047656 3300003320 Bacteria 1250
16 rootH2_10051297 3300003320 Bacteria 2692
17 rootH2_10053388 3300003320 Bacteria 21563
18 rootH2_10128080 3300003320 Bacteria 2643
19 rootL2_10001576 3300003322 Bacteria 11319
20 rootL2_10001886 3300003322 Bacteria 7293
21 rootL2_10054988 3300003322 Bacteria 16403
22 rootL2_10162730 3300003322 Bacteria 3735
23 rootL2_10162731 3300003322 Bacteria 3097
24 rootL2_10204370 3300003322 Bacteria 4136
25 rootH1_10008233 3300003323 Bacteria 3329
26 rootH1_10018633 3300003323 Bacteria 17867
27 rootH1_10063899 3300003323 Bacteria 6152
28 rootH1_10098410 3300003323 Bacteria 13061
29 rootH1_10099643 3300003323 Unclassified 2751
30 rootH1_10148238 3300003323 Bacteria 4166
31 rootH1_10180813 3300003323 Bacteria 14325
32 rootH1_10223625 3300003323 Unclassified 2630
33 JGI25160J50197_1004327 3300003354 Bacteria 6153
34 JGI25160J50197_1024503 3300003354 Bacteria 1711
35 Ga0055542_1008031 3300003762 Bacteria 2092
36 Ga0055526_1021271 3300003771 Unclassified 2264
37 Ga0055528_1000120 3300003790 Bacteria 62209
38 Ga0055530_10006455 3300003791 Bacteria 5233
39 Ga0055531_10000029 3300003794 Bacteria 159248
40 Ga0065165_1000012 3300005262 Bacteria 303241
41 Ga0065165_1000138 3300005262 Bacteria 126884
42 Ga0065165_1001087 3300005262 Bacteria 32424
43 Ga0070658_10000047 3300005327 Bacteria 129483
44 Ga0070676_10119491 3300005328 Bacteria 1652
45 Ga0070683_100026440 3300005329 Bacteria 5226
46 Ga0070660_100006923 3300005339 Bacteria 7863
47 Ga0070659_100026566 3300005366 Bacteria 4456
48 Ga0070667_100148767 3300005367 Bacteria 2056
49 Ga0070663_100013923 3300005455 Bacteria 5147
50 Ga0070678_100124742 3300005456 Bacteria 2036
51 Ga0068855_100010601 3300005563 Bacteria 11111
52 Ga0068855_100046974 3300005563 Bacteria 5103
53 Ga0068855_100157145 3300005563 Bacteria 2583
54 Ga0068857_100011947 3300005577 Bacteria 7550
55 Ga0068866_10156129 3300005718 Bacteria 1326
56 Ga0068860_100000082 3300005843 Bacteria 169805
57 Ga0068860_100017345 3300005843 Bacteria 7016
58 Ga0075366_10000181 3300006195 Bacteria 27528
59 Ga0075366_10006614 3300006195 Bacteria 6361
60 Ga0097621_100008788 3300006237 Bacteria 7299
61 Ga0075370_10152155 3300006353 Bacteria 1356
62 Ga0068871_100003909 3300006358 Bacteria 10268
63 Ga0105240_10000010 3300009093 Bacteria 537830
64 Ga0105240_10090426 3300009093 Bacteria 3741
65 Ga0105245_10161547 3300009098 Unclassified 2126
66 Ga0105247_10003236 3300009101 Bacteria 10716
67 Ga0105241_10001283 3300009174 Bacteria 19188
68 Ga0105241_10275737 3300009174 Bacteria 1434
69 Ga0105237_10000243 3300009545 Bacteria 77722
70 Ga0105237_10007344 3300009545 Bacteria 12075
71 Ga0105237_10011209 3300009545 Bacteria 9501
72 Ga0105237_10027743 3300009545 Bacteria 5773
73 Ga0105237_10065090 3300009545 Bacteria 3642
74 Ga0105238_10203312 3300009551 Bacteria 1957
75 Ga0105249_10032278 3300009553 Bacteria 4737
76 Ga0105239_10000053 3300010375 Bacteria 163705
77 Ga0105239_10000912 3300010375 Bacteria 41956
78 Ga0105239_10002950 3300010375 Bacteria 21215
79 Ga0105239_10008949 3300010375 Bacteria 11329
80 Ga0105239_10021213 3300010375 Bacteria 7162
81 Ga0105239_10071467 3300010375 Bacteria 3813
82 Ga0105239_10074462 3300010375 Bacteria 3733
83 Ga0105239_10396104 3300010375 Bacteria 1562
84 Ga0105239_10396531 3300010375 Bacteria 1561
85 Ga0105246_10019245 3300011119 Bacteria 4360
86 Ga0157373_10001175 3300013100 Bacteria 20027
87 Ga0157373_10032215 3300013100 Bacteria 3774
88 Ga0157371_10000476 3300013102 Bacteria 49123
89 Ga0157371_10004140 3300013102 Bacteria 12789
90 Ga0157371_10101943 3300013102 Unclassified 2036
91 Ga0157370_10015603 3300013104 Bacteria 7719
92 Ga0157369_10006702 3300013105 Bacteria 13294
93 Ga0157369_10056675 3300013105 Bacteria 4228
94 Ga0157374_10130382 3300013296 Bacteria 2433
95 Ga0157378_10068850 3300013297 Bacteria 3174
96 Ga0163162_10000483 3300013306 Bacteria 36950
97 Ga0163162_10018296 3300013306 Bacteria 6863
98 Ga0163162_10184585 3300013306 Bacteria 2212
99 Ga0163162_10549525 3300013306 Bacteria 1283
100 Ga0157372_10000029 3300013307 Bacteria 180371
101 Ga0157372_10002519 3300013307 Bacteria 19877
102 Ga0157372_10070074 3300013307 Bacteria 3944
103 Ga0157372_10137430 3300013307 Bacteria 2815
104 Ga0157375_10029582 3300013308 Bacteria 5154
105 Ga0157375_10915353 3300013308 Bacteria 1020
106 Ga0163163_10117413 3300014325 Bacteria 2692
107 Ga0157379_10136754 3300014968 Bacteria 2208
108 Ga0157376_10375723 3300014969 Bacteria 1367
109 Ga0163161_10000467 3300017792 Bacteria 33614
110 Ga0163161_10020376 3300017792 Bacteria 4654
111 Ga0163161_10037098 3300017792 Bacteria 3493
112 Ga0207427_100066 3300025231 Bacteria 165770
113 Ga0209437_100010 3300025233 Bacteria 838447
114 Ga0209437_100030 3300025233 Bacteria 532466
115 Ga0209258_100252 3300025242 Bacteria 97179
116 Ga0209646_1000009 3300025246 Bacteria 652154
117 Ga0209026_1000188 3300025250 Bacteria 90347
118 Ga0209148_1000217 3300025254 Bacteria 98076
119 Ga0209233_1000017 3300025261 Bacteria 898076
120 Ga0209673_1000016 3300025273 Bacteria 506202
121 Ga0209673_1000111 3300025273 Bacteria 180094
122 Ga0209564_1000921 3300025295 Bacteria 38293
123 Ga0209758_1001338 3300025297 Bacteria 29806
124 Ga0209758_1001631 3300025297 Bacteria 25504
125 Ga0209050_1003706 3300025298 Bacteria 10999
126 Ga0209050_1008151 3300025298 Bacteria 5677
127 Ga0207426_1000019 3300025302 Bacteria 558579
128 Ga0207426_1000793 3300025302 Bacteria 34331
129 Ga0207426_1010400 3300025302 Bacteria 3612
130 Ga0207426_1023871 3300025302 Unclassified 2082
131 Ga0207426_1029521 3300025302 Bacteria 1807
132 Ga0209257_1000013 3300025304 Bacteria 1047305
133 Ga0209257_1004716 3300025304 Bacteria 10225
134 Ga0207647_10000289 3300025904 Bacteria 41295
135 Ga0207647_10120613 3300025904 Unclassified 1546
136 Ga0207705_10000052 3300025909 Bacteria 168319
137 Ga0207705_10013618 3300025909 Bacteria 5867
138 Ga0207654_10154528 3300025911 Bacteria 1476
139 Ga0207695_10000019 3300025913 Bacteria 732137
140 Ga0207695_10119965 3300025913 Bacteria 2599
141 Ga0207695_10218003 3300025913 Bacteria 1816
142 Ga0207695_10309283 3300025913 Bacteria 1470
143 Ga0207671_10002073 3300025914 Bacteria 21935
144 Ga0207671_10003546 3300025914 Bacteria 15462
145 Ga0207671_10005218 3300025914 Bacteria 12076
146 Ga0207671_10019260 3300025914 Bacteria 5221
147 Ga0207657_10005438 3300025919 Bacteria 13306
148 Ga0207652_10080468 3300025921 Bacteria 2848
149 Ga0207644_10181165 3300025931 Bacteria 1651
150 Ga0207690_10063037 3300025932 Bacteria 2526
151 Ga0207691_10161571 3300025940 Bacteria 1965
152 Ga0207667_10037770 3300025949 Bacteria 5161
153 Ga0207667_10129263 3300025949 Bacteria 2601
154 Ga0207640_10015606 3300025981 Bacteria 4402
155 Ga0207677_10100165 3300026023 Bacteria 2130
156 Ga0207703_10093926 3300026035 Bacteria 2527
157 Ga0207678_10025650 3300026067 Bacteria 5145
158 Ga0207702_10013450 3300026078 Bacteria 6802
159 Ga0268264_10000013 3300028381 Bacteria 513859
160 Ga0268264_10011046 3300028381 Bacteria 7457
161 Ga0307515_10000528 3300028794 Bacteria 90438
162 Ga0307515_10001024 3300028794 Bacteria 63787
163 Ga0307511_10000085 3300030521 Bacteria 78341
164 Ga0316177_1170030 3300030731 Bacteria 6016
165 Ga0316176_1030179 3300030732 Bacteria 8339
166 Ga0316183_1160060 3300030742 Bacteria 39452
167 Ga0316181_1186179 3300030744 Bacteria 3895
168 Ga0265327_10000410 3300031251 Bacteria 78900
169 Ga0265327_10018943 3300031251 Bacteria 4249
170 Ga0307513_10061589 3300031456 Bacteria 3972
171 Ga0265313_10066958 3300031595 Bacteria 1663
172 Ga0307516_10000119 3300031730 Bacteria 92189
173 Ga0307516_10131109 3300031730 Unclassified 2285
174 Ga0307405_10026010 3300031731 Bacteria 3369
175 Ga0307414_10026586 3300032004 Bacteria 3727
176 Ga0307507_10237147 3300033179 Bacteria 1199
177 Ga0373941_0109878 3300035115 Bacteria 970
178 Ga0395899_0000024 3300037312 Bacteria 357402
179 Ga0395900_0001002 3300037418 Bacteria 36638
180 Ga0395900_0049933 3300037418 Bacteria 4310
181 Ga0395900_0293482 3300037418 Bacteria 1614
182 Ga0395905_0000520 3300037471 Bacteria 52744
183 Ga0395905_0023734 3300037471 Bacteria 5790
184 Ga0395905_0484035 3300037471 Unclassified 1137
185 Ga0395901_0003486 3300038443 Bacteria 15853
186 Ga0395901_0020217 3300038443 Bacteria 6816
187 Ga0451807_0982779 3300041486 Bacteria 1053
188 Ga0451851_0284798 3300041507 Bacteria 939
189 Ga0451843_0229466 3300041509 Bacteria 1058
190 Ga0466969_0110408 3300044656 Bacteria 1288
191 Ga0466972_0000035 3300044658 Bacteria 147516
192 Ga0466982_0025786 3300044672 Unclassified 3424
193 Ga0466966_0003483 3300044684 Bacteria 10373
194 Ga0466970_0103787 3300044765 Bacteria 1549
195 Ga0495627_004066 3300046453 Bacteria 6227
196 Ga0495638_0000197 3300046460 Bacteria 86853
197 Ga0495638_0184101 3300046460 Unclassified 1189
198 Ga0495651_0171220 3300046462 Bacteria 1546
199 Ga0495650_0056569 3300046471 Bacteria 1591
200 Ga0495585_0001510 3300046492 Bacteria 18129
201 Ga0495606_0014399 3300046507 Bacteria 6176
202 Ga0495631_0055189 3300046518 Bacteria 1731
203 Ga0495644_0110577 3300046523 Bacteria 1042
204 Ga0495648_0007052 3300046524 Bacteria 9058
205 Ga0495648_0133755 3300046524 Bacteria 1315
206 Ga0495652_0214607 3300046529 Bacteria 1450
207 Ga0495609_0003960 3300046538 Bacteria 8289
208 Ga0495609_0095178 3300046538 Bacteria 1293
209 Ga0495633_0000104 3300046558 Bacteria 114011
210 Ga0495633_0000500 3300046558 Bacteria 39535
211 Ga0495668_0000055 3300046616 Bacteria 199412
212 Ga0495625_0001500 3300046660 Bacteria 28046
213 Ga0495625_0004252 3300046660 Bacteria 13638
214 Ga0495625_0012760 3300046660 Bacteria 6796
215 Ga0495625_0033114 3300046660 Bacteria 3824
216 Ga0495625_0123350 3300046660 Bacteria 1761
217 Ga0495625_0203820 3300046660 Bacteria 1304
218 Ga0495661_0000527 3300046665 Bacteria 39504
219 Ga0495687_000010 3300047443 Bacteria 413735
220 Ga0495686_0001664 3300047472 Bacteria 23127
221 Ga0495686_0030475 3300047472 Bacteria 3503
222 Ga0495686_0165387 3300047472 Bacteria 1290
223 Ga0496105_0193161 3300048908 Bacteria 1664
224 Ga0496124_0031473 3300048927 Bacteria 4696
225 Ga0496126_0006252 3300048929 Bacteria 13310
226 Ga0495678_010351 3300049459 Bacteria 4540
227 Ga0495682_0055743 3300049460 Bacteria 1433
228 Ga0501047_0019555 3300049581 Bacteria 6497
229 Ga0501202_006195 3300049652 Unclassified 2134
230 Ga0501217_025523 3300049661 Bacteria 1422
231 Ga0501243_001621 3300049675 Bacteria 3236
232 Ga0501249_003704 3300049679 Bacteria 3081
233 Ga0501250_002230 3300049680 Bacteria 1732
234 Ga0501253_004075 3300049683 Bacteria 1814
235 Ga0501221_006233 3300049704 Bacteria 2013
236 Ga0501225_0009301 3300049705 Bacteria 2801
237 Ga0501241_002283 3300049758 Bacteria 3732
238 Ga0501264_000103 3300049761 Bacteria 12768
239 Ga0501044_0058437 3300049823 Bacteria 3955
240 nmdc:mga0k408_70_c2 3300050493 Bacteria 27573
241 nmdc:mga07m45_148576_c1 3300050496 Bacteria 1358
242 Ga0500583_0047335 3300053092 Bacteria 1981
243 Ga0500651_0011515 3300053093 Bacteria 5337
244 Ga0500608_018252 3300053122 Bacteria 3198
245 Ga0500618_000020 3300053125 Bacteria 161356
246 Ga0500658_0006305 3300053134 Bacteria 4404
247 Ga0500568_0021895 3300053139 Unclassified 2744
248 Ga0500577_0000631 3300053142 Bacteria 9027
249 Ga0500604_0001194 3300053151 Bacteria 7233
250 Ga0500616_0000051 3300053153 Bacteria 296240
251 Ga0500616_0077363 3300053153 Bacteria 1680
252 Ga0500622_0000010 3300053156 Bacteria 398804
253 Ga0500622_0000035 3300053156 Bacteria 182924
254 Ga0500622_0000330 3300053156 Bacteria 47053
255 Ga0500622_0007667 3300053156 Bacteria 6103
256 Ga0500624_000869 3300053157 Bacteria 6624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0982779 Ga0451807_0982779_176_985 265
2 3300006195 Ga0075366_10006614 Ga0075366_100066147 268
3 3300001990 JGI24737J22298_10017903 JGI24737J22298_100179032 270
4 3300005577 Ga0068857_100011947 Ga0068857_1000119471 270
5 3300025904 Ga0207647_10000289 Ga0207647_1000028934 270
6 3300025913 Ga0207695_10119965 Ga0207695_101199652 270
7 3300025932 Ga0207690_10063037 Ga0207690_100630372 270
8 3300041509 Ga0451843_0229466 Ga0451843_0229466_157_975 271
9 3300046462 Ga0495651_0171220 Ga0495651_0171220_387_1205 271
10 3300046492 Ga0495585_0001510 Ga0495585_0001510_13478_14296 271
11 3300046518 Ga0495631_0055189 Ga0495631_0055189_717_1535 271
12 3300046529 Ga0495652_0214607 Ga0495652_0214607_319_1137 271
13 3300046538 Ga0495609_0003960 Ga0495609_0003960_780_1598 271
14 3300046558 Ga0495633_0000500 Ga0495633_0000500_3348_4166 271
15 3300046616 Ga0495668_0000055 Ga0495668_0000055_1701_2519 271
16 3300046660 Ga0495625_0001500 Ga0495625_0001500_3242_4060 271
17 3300046660 Ga0495625_0004252 Ga0495625_0004252_5033_5851 271
18 3300046660 Ga0495625_0012760 Ga0495625_0012760_3156_3974 271
19 3300049460 Ga0495682_0055743 Ga0495682_0055743_137_955 271
20 3300050493 nmdc:mga0k408_70_c2 nmdc:mga0k408_70_c2_25028_25846 271
21 3300053157 Ga0500624_000869 Ga0500624_000869_1837_2655 271
22 3300003320 rootH2_10041902 rootH2_100419025 272
23 3300003323 rootH1_10223625 rootH1_102236252 272
24 3300003354 JGI25160J50197_1024503 JGI25160J50197_10245031 272
25 3300003771 Ga0055526_1021271 Ga0055526_10212712 272
26 3300003790 Ga0055528_1000120 Ga0055528_100012023 272
27 3300003791 Ga0055530_10006455 Ga0055530_100064552 272
28 3300005262 Ga0065165_1000012 Ga0065165_1000012232 272
29 3300025273 Ga0209673_1000016 Ga0209673_1000016338 272
30 3300025273 Ga0209673_1000111 Ga0209673_1000111106 272
31 3300025297 Ga0209758_1001631 Ga0209758_100163111 272
32 3300025298 Ga0209050_1008151 Ga0209050_10081512 272
33 3300025302 Ga0207426_1010400 Ga0207426_10104002 272
34 3300025302 Ga0207426_1023871 Ga0207426_10238712 272
35 3300025304 Ga0209257_1004716 Ga0209257_10047162 272
36 3300025904 Ga0207647_10120613 Ga0207647_101206132 272
37 3300049661 Ga0501217_025523 Ga0501217_025523_272_1108 272
38 3300049679 Ga0501249_003704 Ga0501249_003704_950_1786 272
39 3300053156 Ga0500622_0000330 Ga0500622_0000330_11846_12670 272
40 3300009551 Ga0105238_10203312 Ga0105238_102033122 274
41 3300013306 Ga0163162_10549525 Ga0163162_105495252 281
42 3300046507 Ga0495606_0014399 Ga0495606_0014399_662_1552 283
43 3300053151 Ga0500604_0001194 Ga0500604_0001194_5477_6340 286
44 3300041507 Ga0451851_0284798 Ga0451851_0284798_49_927 288
45 3300002737 JGI25162J39368_1000793 JGI25162J39368_10007938 289
46 3300002772 JGI25164J39214_1001983 JGI25164J39214_10019832 289
47 3300003214 JGI25165J46597_1000990 JGI25165J46597_10009909 289
48 3300003320 rootH2_10051297 rootH2_100512972 289
49 3300003323 rootH1_10008233 rootH1_100082333 289
50 3300005327 Ga0070658_10000047 Ga0070658_1000004799 289
51 3300005456 Ga0070678_100124742 Ga0070678_1001247421 289
52 3300005563 Ga0068855_100010601 Ga0068855_1000106014 289
53 3300025231 Ga0207427_100066 Ga0207427_10006645 289
54 3300025233 Ga0209437_100010 Ga0209437_100010160 289
55 3300025261 Ga0209233_1000017 Ga0209233_1000017173 289
56 3300025909 Ga0207705_10000052 Ga0207705_10000052100 289
57 3300025913 Ga0207695_10309283 Ga0207695_103092832 289
58 3300026078 Ga0207702_10013450 Ga0207702_100134502 289
59 3300037471 Ga0395905_0000520 Ga0395905_0000520_13133_14002 289
60 3300038443 Ga0395901_0003486 Ga0395901_0003486_9851_10720 289
61 3300010375 Ga0105239_10074462 Ga0105239_100744624 290
62 3300013297 Ga0157378_10068850 Ga0157378_100688502 290
63 3300013308 Ga0157375_10029582 Ga0157375_100295822 290
64 3300035115 Ga0373941_0109878 Ga0373941_0109878_79_951 290
65 iso_pu_bacteria 2919437846 2919439816 290
66 3300005366 Ga0070659_100026566 Ga0070659_1000265662 291
67 3300009093 Ga0105240_10090426 Ga0105240_100904262 291
68 3300010375 Ga0105239_10000053 Ga0105239_1000005323 291
69 3300013100 Ga0157373_10001175 Ga0157373_100011752 291
70 3300013102 Ga0157371_10000476 Ga0157371_100004762 291
71 3300013104 Ga0157370_10015603 Ga0157370_100156033 291
72 3300013105 Ga0157369_10056675 Ga0157369_100566752 291
73 3300013307 Ga0157372_10070074 Ga0157372_100700742 291
74 3300037418 Ga0395900_0001002 Ga0395900_0001002_21390_22265 291
75 3300038443 Ga0395901_0020217 Ga0395901_0020217_5860_6738 291
76 iso_pu_bacteria 2599185184 2599481361 291
77 iso_pu_bacteria 2842903701 2842907123 291
78 iso_pu_bacteria 2914759650 2914762474 291
79 iso_pu_bacteria 2928078545 2928081964 291
80 iso_pu_bacteria 2928147474 2928151980 291
81 iso_pu_bacteria 2929921140 2929924243 291
82 iso_pu_bacteria 2932082852 2932088165 291
83 iso_pu_bacteria 8003151029 8003156104 291
84 3300005328 Ga0070676_10119491 Ga0070676_101194912 292
85 3300005455 Ga0070663_100013923 Ga0070663_1000139234 292
86 3300013100 Ga0157373_10032215 Ga0157373_100322152 292
87 3300013102 Ga0157371_10004140 Ga0157371_1000414011 292
88 3300013105 Ga0157369_10006702 Ga0157369_100067028 292
89 3300013307 Ga0157372_10000029 Ga0157372_1000002979 292
90 3300017792 Ga0163161_10000467 Ga0163161_1000046719 292
91 3300026067 Ga0207678_10025650 Ga0207678_100256503 292
92 3300037312 Ga0395899_0000024 Ga0395899_0000024_48730_49677 292
93 3300037418 Ga0395900_0293482 Ga0395900_0293482_488_1435 292
94 3300044656 Ga0466969_0110408 Ga0466969_0110408_383_1264 292
95 3300044684 Ga0466966_0003483 Ga0466966_0003483_6857_7849 292
96 3300046538 Ga0495609_0095178 Ga0495609_0095178_146_1024 292
97 3300046665 Ga0495661_0000527 Ga0495661_0000527_32853_33731 292
98 3300049652 Ga0501202_006195 Ga0501202_006195_263_1150 292
99 3300025913 Ga0207695_10218003 Ga0207695_102180031 293
100 3300025921 Ga0207652_10080468 Ga0207652_100804683 293
101 iso_pu_bacteria 2818991444 2819590198 293
102 3300003316 rootH1_10000605 rootH1_100006058 294
103 3300003320 rootH2_10011976 rootH2_1001197612 294
104 3300003320 rootH2_10053388 rootH2_1005338819 294
105 3300003320 rootH2_10128080 rootH2_101280802 294
106 3300003322 rootL2_10001886 rootL2_100018867 294
107 3300003322 rootL2_10054988 rootL2_1005498811 294
108 3300003322 rootL2_10162730 rootL2_101627304 294
109 3300003322 rootL2_10162731 rootL2_101627312 294
110 3300003323 rootH1_10018633 rootH1_100186339 294
111 3300005339 Ga0070660_100006923 Ga0070660_1000069233 294
112 3300005563 Ga0068855_100046974 Ga0068855_1000469741 294
113 3300006195 Ga0075366_10000181 Ga0075366_1000018120 294
114 3300009545 Ga0105237_10007344 Ga0105237_100073448 294
115 3300009545 Ga0105237_10011209 Ga0105237_100112095 294
116 3300010375 Ga0105239_10000912 Ga0105239_1000091222 294
117 3300010375 Ga0105239_10008949 Ga0105239_100089493 294
118 3300017792 Ga0163161_10037098 Ga0163161_100370983 294
119 3300025233 Ga0209437_100030 Ga0209437_100030337 294
120 3300025298 Ga0209050_1003706 Ga0209050_10037065 294
121 3300025909 Ga0207705_10013618 Ga0207705_100136181 294
122 3300025914 Ga0207671_10002073 Ga0207671_1000207311 294
123 3300025914 Ga0207671_10005218 Ga0207671_100052188 294
124 3300025919 Ga0207657_10005438 Ga0207657_100054389 294
125 3300025949 Ga0207667_10037770 Ga0207667_100377701 294
126 3300025981 Ga0207640_10015606 Ga0207640_100156064 294
127 3300028794 Ga0307515_10000528 Ga0307515_1000052874 294
128 3300028794 Ga0307515_10001024 Ga0307515_1000102441 294
129 3300031456 Ga0307513_10061589 Ga0307513_100615895 294
130 3300033179 Ga0307507_10237147 Ga0307507_102371471 294
131 3300037418 Ga0395900_0049933 Ga0395900_0049933_1477_2370 294
132 3300037471 Ga0395905_0023734 Ga0395905_0023734_523_1416 294
133 3300037471 Ga0395905_0484035 Ga0395905_0484035_157_1050 294
134 3300046460 Ga0495638_0000197 Ga0495638_0000197_14490_15380 294
135 3300046471 Ga0495650_0056569 Ga0495650_0056569_530_1417 294
136 3300046524 Ga0495648_0133755 Ga0495648_0133755_250_1137 294
137 3300046660 Ga0495625_0033114 Ga0495625_0033114_2822_3709 294
138 3300046660 Ga0495625_0203820 Ga0495625_0203820_308_1195 294
139 3300047472 Ga0495686_0001664 Ga0495686_0001664_14708_15595 294
140 3300047472 Ga0495686_0030475 Ga0495686_0030475_1136_2023 294
141 3300049459 Ga0495678_010351 Ga0495678_010351_1637_2524 294
142 3300049675 Ga0501243_001621 Ga0501243_001621_1946_2851 294
143 3300049680 Ga0501250_002230 Ga0501250_002230_726_1631 294
144 3300049683 Ga0501253_004075 Ga0501253_004075_773_1678 294
145 3300049704 Ga0501221_006233 Ga0501221_006233_336_1241 294
146 3300049705 Ga0501225_0009301 Ga0501225_0009301_215_1120 294
147 3300049761 Ga0501264_000103 Ga0501264_000103_2327_3220 294
148 3300053122 Ga0500608_018252 Ga0500608_018252_1128_2015 294
149 3300053125 Ga0500618_000020 Ga0500618_000020_160310_161197 294
150 3300053153 Ga0500616_0000051 Ga0500616_0000051_14341_15231 294
151 3300053153 Ga0500616_0077363 Ga0500616_0077363_43_933 294
152 3300001989 JGI24739J22299_10013222 JGI24739J22299_100132222 295
153 3300001990 JGI24737J22298_10000022 JGI24737J22298_100000226 295
154 3300002067 JGI24735J21928_10000031 JGI24735J21928_1000003124 295
155 3300003215 JGI25153J46596_10010909 JGI25153J46596_100109092 295
156 3300003316 rootH1_10008079 rootH1_100080793 295
157 3300003316 rootH1_10190554 rootH1_101905542 295
158 3300003320 rootH2_10047656 rootH2_100476561 295
159 3300003322 rootL2_10001576 rootL2_100015765 295
160 3300003322 rootL2_10204370 rootL2_102043704 295
161 3300003323 rootH1_10063899 rootH1_100638995 295
162 3300003323 rootH1_10098410 rootH1_1009841014 295
163 3300003323 rootH1_10099643 rootH1_100996433 295
164 3300003323 rootH1_10148238 rootH1_101482383 295
165 3300003323 rootH1_10180813 rootH1_101808135 295
166 3300003354 JGI25160J50197_1004327 JGI25160J50197_10043274 295
167 3300003762 Ga0055542_1008031 Ga0055542_10080312 295
168 3300003794 Ga0055531_10000029 Ga0055531_10000029134 295
169 3300005262 Ga0065165_1000138 Ga0065165_100013854 295
170 3300005262 Ga0065165_1001087 Ga0065165_100108726 295
171 3300005329 Ga0070683_100026440 Ga0070683_1000264405 295
172 3300005367 Ga0070667_100148767 Ga0070667_1001487672 295
173 3300005563 Ga0068855_100157145 Ga0068855_1001571452 295
174 3300005718 Ga0068866_10156129 Ga0068866_101561292 295
175 3300005843 Ga0068860_100000082 Ga0068860_10000008270 295
176 3300005843 Ga0068860_100017345 Ga0068860_1000173456 295
177 3300006237 Ga0097621_100008788 Ga0097621_1000087883 295
178 3300006353 Ga0075370_10152155 Ga0075370_101521552 295
179 3300006358 Ga0068871_100003909 Ga0068871_1000039095 295
180 3300009093 Ga0105240_10000010 Ga0105240_10000010137 295
181 3300009098 Ga0105245_10161547 Ga0105245_101615472 295
182 3300009101 Ga0105247_10003236 Ga0105247_100032362 295
183 3300009174 Ga0105241_10001283 Ga0105241_1000128313 295
184 3300009174 Ga0105241_10275737 Ga0105241_102757371 295
185 3300009545 Ga0105237_10000243 Ga0105237_1000024353 295
186 3300009545 Ga0105237_10027743 Ga0105237_100277433 295
187 3300009545 Ga0105237_10065090 Ga0105237_100650902 295
188 3300009553 Ga0105249_10032278 Ga0105249_100322782 295
189 3300010375 Ga0105239_10002950 Ga0105239_100029501 295
190 3300010375 Ga0105239_10021213 Ga0105239_100212136 295
191 3300010375 Ga0105239_10071467 Ga0105239_100714674 295
192 3300010375 Ga0105239_10396104 Ga0105239_103961042 295
193 3300010375 Ga0105239_10396531 Ga0105239_103965312 295
194 3300011119 Ga0105246_10019245 Ga0105246_100192452 295
195 3300013102 Ga0157371_10101943 Ga0157371_101019432 295
196 3300013296 Ga0157374_10130382 Ga0157374_101303822 295
197 3300013306 Ga0163162_10000483 Ga0163162_1000048310 295
198 3300013306 Ga0163162_10018296 Ga0163162_100182964 295
199 3300013306 Ga0163162_10184585 Ga0163162_101845852 295
200 3300013307 Ga0157372_10002519 Ga0157372_100025195 295
201 3300013307 Ga0157372_10137430 Ga0157372_101374302 295
202 3300013308 Ga0157375_10915353 Ga0157375_109153531 295
203 3300014325 Ga0163163_10117413 Ga0163163_101174131 295
204 3300014968 Ga0157379_10136754 Ga0157379_101367542 295
205 3300014969 Ga0157376_10375723 Ga0157376_103757231 295
206 3300017792 Ga0163161_10020376 Ga0163161_100203761 295
207 3300025242 Ga0209258_100252 Ga0209258_10025269 295
208 3300025246 Ga0209646_1000009 Ga0209646_100000937 295
209 3300025250 Ga0209026_1000188 Ga0209026_100018837 295
210 3300025254 Ga0209148_1000217 Ga0209148_100021769 295
211 3300025295 Ga0209564_1000921 Ga0209564_100092117 295
212 3300025297 Ga0209758_1001338 Ga0209758_100133811 295
213 3300025302 Ga0207426_1000019 Ga0207426_1000019146 295
214 3300025302 Ga0207426_1000793 Ga0207426_10007937 295
215 3300025302 Ga0207426_1029521 Ga0207426_10295212 295
216 3300025304 Ga0209257_1000013 Ga0209257_1000013768 295
217 3300025911 Ga0207654_10154528 Ga0207654_101545281 295
218 3300025913 Ga0207695_10000019 Ga0207695_10000019315 295
219 3300025914 Ga0207671_10003546 Ga0207671_100035462 295
220 3300025914 Ga0207671_10019260 Ga0207671_100192602 295
221 3300025931 Ga0207644_10181165 Ga0207644_101811652 295
222 3300025940 Ga0207691_10161571 Ga0207691_101615712 295
223 3300025949 Ga0207667_10129263 Ga0207667_101292632 295
224 3300026023 Ga0207677_10100165 Ga0207677_101001652 295
225 3300026035 Ga0207703_10093926 Ga0207703_100939261 295
226 3300028381 Ga0268264_10000013 Ga0268264_10000013389 295
227 3300028381 Ga0268264_10011046 Ga0268264_100110466 295
228 3300030521 Ga0307511_10000085 Ga0307511_1000008514 295
229 3300030731 Ga0316177_1170030 Ga0316177_11700303 295
230 3300030732 Ga0316176_1030179 Ga0316176_10301795 295
231 3300030742 Ga0316183_1160060 Ga0316183_116006013 295
232 3300030744 Ga0316181_1186179 Ga0316181_11861792 295
233 3300031251 Ga0265327_10000410 Ga0265327_1000041034 295
234 3300031251 Ga0265327_10018943 Ga0265327_100189433 295
235 3300031595 Ga0265313_10066958 Ga0265313_100669582 295
236 3300031730 Ga0307516_10000119 Ga0307516_1000011910 295
237 3300031730 Ga0307516_10131109 Ga0307516_101311092 295
238 3300031731 Ga0307405_10026010 Ga0307405_100260102 295
239 3300032004 Ga0307414_10026586 Ga0307414_100265864 295
240 3300044658 Ga0466972_0000035 Ga0466972_0000035_82134_83027 295
241 3300044672 Ga0466982_0025786 Ga0466982_0025786_1745_2641 295
242 3300044765 Ga0466970_0103787 Ga0466970_0103787_277_1170 295
243 3300046453 Ga0495627_004066 Ga0495627_004066_4846_5739 295
244 3300046460 Ga0495638_0184101 Ga0495638_0184101_128_1021 295
245 3300046523 Ga0495644_0110577 Ga0495644_0110577_57_947 295
246 3300046524 Ga0495648_0007052 Ga0495648_0007052_1832_2728 295
247 3300046558 Ga0495633_0000104 Ga0495633_0000104_82289_83182 295
248 3300046660 Ga0495625_0123350 Ga0495625_0123350_375_1271 295
249 3300047443 Ga0495687_000010 Ga0495687_000010_190469_191365 295
250 3300047472 Ga0495686_0165387 Ga0495686_0165387_204_1100 295
251 3300048908 Ga0496105_0193161 Ga0496105_0193161_181_1068 295
252 3300048927 Ga0496124_0031473 Ga0496124_0031473_26_964 295
253 3300048929 Ga0496126_0006252 Ga0496126_0006252_10401_11294 295
254 3300049581 Ga0501047_0019555 Ga0501047_0019555_4033_5001 295
255 3300049758 Ga0501241_002283 Ga0501241_002283_539_1543 295
256 3300049823 Ga0501044_0058437 Ga0501044_0058437_2463_3431 295
257 3300050496 nmdc:mga07m45_148576_c1 nmdc:mga07m45_148576_c1_273_1178 295
258 3300053092 Ga0500583_0047335 Ga0500583_0047335_472_1368 295
259 3300053093 Ga0500651_0011515 Ga0500651_0011515_4175_5068 295
260 3300053134 Ga0500658_0006305 Ga0500658_0006305_2810_3766 295
261 3300053139 Ga0500568_0021895 Ga0500568_0021895_40_933 295
262 3300053142 Ga0500577_0000631 Ga0500577_0000631_4854_5810 295
263 3300053156 Ga0500622_0000010 Ga0500622_0000010_208133_209026 295
264 3300053156 Ga0500622_0000035 Ga0500622_0000035_187_1077 295
265 3300053156 Ga0500622_0007667 Ga0500622_0007667_2341_3237 295
266 iso_pu_bacteria 2522125168 2522548408 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

38

318

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ysp-assembly1.cif.gz_A pyrophosphate-dependent kinase in the ribokinase family complexed with a pyrophosphate analog and myo-inositol 0.9282 4 284
5ysq-assembly2.cif.gz_B sulfate-complex structure of a pyrophosphate-dependent kinase in the ribokinase family provides insight into the donor-binding mode 0.9206 4 285
5ysp-assembly1.cif.gz_A pyrophosphate-dependent kinase in the ribokinase family complexed with a pyrophosphate analog and myo-inositol 0.9185 4 284
5ysq-assembly2.cif.gz_B sulfate-complex structure of a pyrophosphate-dependent kinase in the ribokinase family provides insight into the donor-binding mode 0.9112 4 285
5ysp-assembly2.cif.gz_B pyrophosphate-dependent kinase in the ribokinase family complexed with a pyrophosphate analog and myo-inositol 0.9046 4 285
ID Description Score Start End Superfamily
5yspA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9281 4 284 3.40.1190.20
5yspA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9184 4 284 3.40.1190.20
3w4sB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.868 3 288 3.40.1190.20
af_Q54Q47_46_338_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8524 20 250 3.40.1190.20
3w4sB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8439 3 288 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A355XWJ9-F1-model_v4 Ribokinase 0.9741 140 286 GO:0006796
GO:0016301
AF-A0A1C5YK11-F1-model_v4 Hexose kinase, 1-phosphofructokinase family 0.9667 96 289 GO:0016301
AF-A0A357SYJ5-F1-model_v4 Ribokinase 0.9641 68 289 GO:0016301
AF-A0A353H3V4-F1-model_v4 Carbohydrate kinase 0.9621 2 287
AF-U2MUC2-F1-model_v4 Carbohydrate kinase, PfkB family 0.9614 1 275 GO:0016301

Feature Viewer

pLDDT pTM Quality
92.96 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map