F374231

General Info

Members Datasets Scaffolds Average Seq Length
266 182 532 186

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0740785|Ga0436363_0740785_112_777
Length 221
Sequence MSDARSAAPVSIPAPAETLCLSFVNTRSWRGTQRPTEELTTPADLLGWIASNAGLGSAITDAVASRWQTRPDEAAATLDTALTVREAIYGVITDAIRGRPIPDTALEVLNAALAATMPRSRLRPGSEPGWEGTLALEPVRAASLLAPVLWSAGDLLSGKRMARVRQCANPSCGWLFLDDSRSGNRRWCSMSSCGNRAKVHRHYRRRRDQKLFSDSPTGPND

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
181 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
182 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.53
Nodule 0
Rhizoplane 0.75
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0740785 3300039450 Unclassified 977
2 Ga0070658_10003696 3300005327 Bacteria 12514
3 Ga0070683_100080973 3300005329 Bacteria 3039
4 Ga0070680_101120842 3300005336 Unclassified 680
5 Ga0070682_100660873 3300005337 Bacteria 833
6 Ga0070689_100262849 3300005340 Bacteria 1427
7 Ga0070691_10082241 3300005341 Bacteria 1578
8 Ga0070669_100090269 3300005353 Bacteria 2296
9 Ga0070675_100241190 3300005354 Bacteria 1579
10 Ga0070671_100677242 3300005355 Bacteria 894
11 Ga0070709_10028021 3300005434 Bacteria 3356
12 Ga0070714_100049663 3300005435 Bacteria 3571
13 Ga0070714_101117024 3300005435 Bacteria 768
14 Ga0070713_100071578 3300005436 Bacteria 2930
15 Ga0070711_100036982 3300005439 Bacteria 3273
16 Ga0070708_100276026 3300005445 Bacteria 1581
17 Ga0070681_10003315 3300005458 Bacteria 15044
18 Ga0070681_10115288 3300005458 Bacteria 2625
19 Ga0070681_11289753 3300005458 Unclassified 653
20 Ga0070707_100166731 3300005468 Bacteria 2147
21 Ga0070707_101022327 3300005468 Bacteria 792
22 Ga0070698_100000912 3300005471 Bacteria 32323
23 Ga0070699_100132243 3300005518 Bacteria 2200
24 Ga0070679_100049813 3300005530 Bacteria 4172
25 Ga0070684_100083011 3300005535 Bacteria 2838
26 Ga0068853_101316406 3300005539 Bacteria 698
27 Ga0070665_100016913 3300005548 Bacteria 7313
28 Ga0070665_100397107 3300005548 Bacteria 1387
29 Ga0070665_100843168 3300005548 Bacteria 930
30 Ga0068855_100020791 3300005563 Bacteria 7870
31 Ga0068855_100796229 3300005563 Bacteria 1005
32 Ga0068857_100072322 3300005577 Bacteria 3073
33 Ga0068857_100129823 3300005577 Bacteria 2272
34 Ga0068854_100737406 3300005578 Bacteria 854
35 Ga0068856_100065307 3300005614 Bacteria 3596
36 Ga0068852_100233441 3300005616 Bacteria 1754
37 Ga0068859_100149472 3300005617 Bacteria 2412
38 Ga0068859_100808528 3300005617 Bacteria 1025
39 Ga0068870_10299901 3300005840 Bacteria 1014
40 Ga0068870_10664770 3300005840 Bacteria 715
41 Ga0068860_100479981 3300005843 Bacteria 1239
42 Ga0081455_10001761 3300005937 Bacteria 26159
43 Ga0081455_10056829 3300005937 Bacteria 3320
44 Ga0081455_10168685 3300005937 Bacteria 1670
45 Ga0081540_1049490 3300005983 Bacteria 2096
46 Ga0081539_10007317 3300005985 Bacteria 10127
47 Ga0070717_10507071 3300006028 Bacteria 1091
48 Ga0075365_10006721 3300006038 Bacteria 6361
49 Ga0075365_10012471 3300006038 Bacteria 5051
50 Ga0075365_10172624 3300006038 Bacteria 1509
51 Ga0075365_10240783 3300006038 Bacteria 1271
52 Ga0075365_10305180 3300006038 Bacteria 1120
53 Ga0075368_10053540 3300006042 Bacteria 1607
54 Ga0075363_100096851 3300006048 Bacteria 1629
55 Ga0070712_100007307 3300006175 Bacteria 6893
56 Ga0070712_100141424 3300006175 Bacteria 1837
57 Ga0075362_10480321 3300006177 Bacteria 634
58 Ga0075367_10047552 3300006178 Bacteria 2524
59 Ga0075367_10335186 3300006178 Bacteria 954
60 Ga0075369_10061983 3300006186 Bacteria 1633
61 Ga0075366_10047629 3300006195 Bacteria 2541
62 Ga0075366_10542825 3300006195 Bacteria 720
63 Ga0075370_10027774 3300006353 Bacteria 3143
64 Ga0075370_10074569 3300006353 Bacteria 1944
65 Ga0097620_100149470 3300006931 Bacteria 2412
66 Ga0097620_100808438 3300006931 Bacteria 1025
67 Ga0105240_10051312 3300009093 Bacteria 5192
68 Ga0111539_10383762 3300009094 Bacteria 1636
69 Ga0105245_10284236 3300009098 Bacteria 1618
70 Ga0105245_10434030 3300009098 Bacteria 1319
71 Ga0105242_10326842 3300009176 Bacteria 1409
72 Ga0105248_10022395 3300009177 Bacteria 7009
73 Ga0105248_11077704 3300009177 Bacteria 908
74 Ga0105237_10500379 3300009545 Bacteria 1222
75 Ga0105238_10050469 3300009551 Bacteria 4188
76 Ga0105238_10136704 3300009551 Bacteria 2428
77 Ga0105239_10051412 3300010375 Bacteria 4517
78 Ga0105239_10123577 3300010375 Bacteria 2875
79 Ga0157371_10411812 3300013102 Unclassified 990
80 Ga0157370_10054854 3300013104 Bacteria 3799
81 Ga0157369_10497317 3300013105 Bacteria 1262
82 Ga0157374_10088568 3300013296 Bacteria 2948
83 Ga0157372_10281080 3300013307 Bacteria 1935
84 Ga0163163_10085382 3300014325 Bacteria 3164
85 Ga0157376_10193028 3300014969 Bacteria 1869
86 Ga0206356_10758040 3300020070 Bacteria 779
87 Ga0213872_10019083 3300021361 Bacteria 3159
88 Ga0213876_10203366 3300021384 Bacteria 1053
89 Ga0213871_10016259 3300021441 Bacteria 1790
90 Ga0207426_1009480 3300025302 Bacteria 3850
91 Ga0207699_10208423 3300025906 Bacteria 1328
92 Ga0207645_10142944 3300025907 Bacteria 1559
93 Ga0207705_10028646 3300025909 Bacteria 3970
94 Ga0207707_10084667 3300025912 Bacteria 2769
95 Ga0207707_10638838 3300025912 Unclassified 898
96 Ga0207693_10026438 3300025915 Bacteria 4594
97 Ga0207693_10556058 3300025915 Bacteria 895
98 Ga0207660_10091634 3300025917 Bacteria 2255
99 Ga0207660_10636007 3300025917 Bacteria 870
100 Ga0207649_10250516 3300025920 Bacteria 1275
101 Ga0207652_10219936 3300025921 Bacteria 1711
102 Ga0207646_10164407 3300025922 Bacteria 2003
103 Ga0207646_10979581 3300025922 Bacteria 748
104 Ga0207681_10468950 3300025923 Bacteria 1027
105 Ga0207694_10172895 3300025924 Bacteria 1750
106 Ga0207694_10505121 3300025924 Bacteria 1013
107 Ga0207659_10524871 3300025926 Bacteria 1004
108 Ga0207687_11835403 3300025927 Bacteria 519
109 Ga0207700_10146839 3300025928 Bacteria 1945
110 Ga0207700_10318052 3300025928 Bacteria 1348
111 Ga0207700_11297574 3300025928 Bacteria 649
112 Ga0207664_10031927 3300025929 Bacteria 4033
113 Ga0207686_10649107 3300025934 Bacteria 835
114 Ga0207670_10727172 3300025936 Bacteria 823
115 Ga0207669_11029562 3300025937 Bacteria 693
116 Ga0207665_10167493 3300025939 Bacteria 1585
117 Ga0207711_10265495 3300025941 Bacteria 1578
118 Ga0207661_10051959 3300025944 Bacteria 3272
119 Ga0207667_10020659 3300025949 Bacteria 7318
120 Ga0207667_10042292 3300025949 Bacteria 4844
121 Ga0207651_10429347 3300025960 Bacteria 1130
122 Ga0207712_10862995 3300025961 Bacteria 798
123 Ga0207658_10324327 3300025986 Bacteria 1334
124 Ga0207658_11623258 3300025986 Bacteria 591
125 Ga0207702_10013695 3300026078 Bacteria 6736
126 Ga0207674_10031882 3300026116 Bacteria 5532
127 Ga0207674_10259738 3300026116 Bacteria 1684
128 Ga0207683_10490362 3300026121 Bacteria 1134
129 Ga0209813_10043190 3300027866 Bacteria 1380
130 Ga0268266_10004191 3300028379 Bacteria 13892
131 Ga0268266_10031062 3300028379 Bacteria 4536
132 Ga0268266_10041445 3300028379 Bacteria 3929
133 Ga0268264_10803415 3300028381 Bacteria 940
134 Ga0265334_10037623 3300028573 Bacteria 1907
135 Ga0265332_10154569 3300031238 Bacteria 959
136 Ga0265342_10197822 3300031712 Bacteria 1094
137 Ga0307416_100798561 3300032002 Bacteria 1039
138 Ga0373934_0142285 3300035086 Bacteria 981
139 Ga0373940_0074063 3300035088 Bacteria 996
140 Ga0373923_0032398 3300035111 Bacteria 2111
141 Ga0373923_0095083 3300035111 Bacteria 1308
142 Ga0373936_0056157 3300035113 Bacteria 1600
143 Ga0373939_0058582 3300035114 Bacteria 1219
144 Ga0373945_0081881 3300035116 Bacteria 1238
145 Ga0373953_0009776 3300035117 Bacteria 3315
146 Ga0373954_0027969 3300035118 Bacteria 2591
147 Ga0373954_0054087 3300035118 Bacteria 1888
148 Ga0373954_0364207 3300035118 Bacteria 714
149 Ga0373956_0015383 3300035119 Bacteria 3203
150 Ga0373956_0280898 3300035119 Bacteria 792
151 Ga0373957_0029169 3300035120 Bacteria 2014
152 Ga0373943_0163992 3300035170 Bacteria 1212
153 Ga0373946_0490199 3300035171 Bacteria 629
154 Ga0373955_0205571 3300035172 Bacteria 1173
155 Ga0373955_0206514 3300035172 Bacteria 1170
156 Ga0373924_0008008 3300035410 Bacteria 3825
157 Ga0373924_0362109 3300035410 Bacteria 647
158 Ga0373931_0198789 3300035691 Bacteria 1196
159 Ga0373931_0543770 3300035691 Bacteria 754
160 Ga0373935_0020903 3300035692 Bacteria 4004
161 Ga0373935_0162644 3300035692 Bacteria 1522
162 Ga0373935_0420627 3300035692 Bacteria 962
163 Ga0373927_0121798 3300035695 Bacteria 1702
164 Ga0373927_0187548 3300035695 Bacteria 1357
165 Ga0373927_0384358 3300035695 Bacteria 926
166 Ga0373933_0008085 3300035724 Bacteria 5740
167 Ga0373933_0142592 3300035724 Bacteria 1513
168 Ga0373933_0427922 3300035724 Bacteria 865
169 Ga0373933_0793416 3300035724 Bacteria 623
170 Ga0373947_0195735 3300035725 Bacteria 1321
171 Ga0373947_0220917 3300035725 Bacteria 1245
172 Ga0373937_0001694 3300036401 Bacteria 18535
173 Ga0373937_0111774 3300036401 Bacteria 2541
174 Ga0373937_0143793 3300036401 Bacteria 2232
175 Ga0373937_0248649 3300036401 Bacteria 1676
176 Ga0373937_0577599 3300036401 Bacteria 1067
177 Ga0373925_0647021 3300037068 Bacteria 871
178 Ga0373925_0978526 3300037068 Bacteria 697
179 Ga0395899_0120477 3300037312 Bacteria 1880
180 Ga0395899_0169067 3300037312 Bacteria 1540
181 Ga0395899_0303675 3300037312 Bacteria 1079
182 Ga0395900_0004412 3300037418 Bacteria 14917
183 Ga0395900_0033390 3300037418 Bacteria 5296
184 Ga0395900_0080264 3300037418 Bacteria 3352
185 Ga0395900_0139763 3300037418 Bacteria 2480
186 Ga0395900_0185593 3300037418 Bacteria 2111
187 Ga0395898_0060454 3300037466 Bacteria 3682
188 Ga0395898_1343067 3300037466 Bacteria 643
189 Ga0395905_0614706 3300037471 Bacteria 989
190 Ga0395901_0003795 3300038443 Bacteria 15219
191 Ga0395901_0044371 3300038443 Bacteria 4611
192 Ga0436365_0357870 3300039437 Bacteria 1853
193 Ga0436360_0175600 3300039438 Bacteria 9178
194 Ga0436361_0854916 3300039447 Bacteria 3832
195 Ga0436362_1234638 3300039453 Bacteria 988
196 Ga0466963_0015408 3300044694 Bacteria 4733
197 Ga0466957_0066591 3300044842 Bacteria 2221
198 Ga0466967_0007868 3300045976 Bacteria 7746
199 Ga0466967_1294229 3300045976 Bacteria 726
200 Ga0495592_0070377 3300046454 Bacteria 2549
201 Ga0495651_0151205 3300046462 Unclassified 1673
202 Ga0495664_0002639 3300046477 Bacteria 9650
203 Ga0495608_0079568 3300046511 Bacteria 2131
204 Ga0495608_0137714 3300046511 Bacteria 1559
205 Ga0495628_0022654 3300046516 Bacteria 5160
206 Ga0495630_0223218 3300046517 Unclassified 1439
207 Ga0495652_0061989 3300046529 Bacteria 3155
208 Ga0495587_0191848 3300046536 Bacteria 1157
209 Ga0495587_0508118 3300046536 Bacteria 666
210 Ga0495645_0000705 3300046543 Bacteria 22911
211 Ga0495667_0023245 3300046559 Bacteria 4176
212 Ga0495635_0042296 3300046663 Bacteria 3146
213 Ga0495635_0148940 3300046663 Bacteria 1593
214 Ga0495657_0072339 3300046675 Bacteria 2249
215 Ga0495599_0037154 3300046678 Bacteria 3059
216 Ga0495599_0460193 3300046678 Bacteria 752
217 Ga0495623_0143042 3300046679 Bacteria 1421
218 Ga0495604_0089879 3300047317 Bacteria 2282
219 Ga0495674_0110179 3300047319 Bacteria 2335
220 Ga0495674_0242991 3300047319 Bacteria 1483
221 Ga0495680_0059948 3300047322 Bacteria 2936
222 Ga0495675_0026867 3300047444 Bacteria 3669
223 Ga0495684_0050619 3300047471 Bacteria 3171
224 Ga0495602_0000162 3300048088 Bacteria 62143
225 Ga0495602_0145187 3300048088 Bacteria 1873
226 Ga0496112_0673068 3300048915 Bacteria 964
227 Ga0496113_0654620 3300048916 Bacteria 840
228 Ga0496126_0187653 3300048929 Bacteria 1752
229 Ga0501034_0009799 3300049571 Bacteria 10018
230 Ga0501034_0017829 3300049571 Bacteria 7282
231 Ga0501034_0041417 3300049571 Bacteria 4660
232 Ga0501034_0532623 3300049571 Bacteria 1085
233 Ga0501037_0026129 3300049573 Bacteria 4315
234 Ga0501038_0182235 3300049574 Bacteria 1694
235 Ga0501038_0844117 3300049574 Bacteria 679
236 Ga0501046_0271813 3300049580 Bacteria 1243
237 Ga0501068_0041357 3300049584 Bacteria 2769
238 Ga0501070_0181659 3300049586 Bacteria 1731
239 Ga0501044_0013865 3300049823 Bacteria 8712
240 Ga0501044_0879980 3300049823 Bacteria 771
241 nmdc:mga00v17_174476_c1 3300050491 Bacteria 1386
242 nmdc:mga0yw44_135682_c1 3300050492 Bacteria 1596
243 nmdc:mga0yw44_404156_c1 3300050492 Bacteria 924
244 nmdc:mga0yw44_69581_c1 3300050492 Bacteria 2180
245 nmdc:mga0k408_114161_c1 3300050493 Bacteria 1597
246 nmdc:mga0k408_37547_c1 3300050493 Bacteria 2781
247 nmdc:mga06z11_17930_c1 3300050494 Bacteria 3224
248 nmdc:mga06z11_503298_c1 3300050494 Bacteria 734
249 nmdc:mga04h51_21817_c1 3300050495 Bacteria 1930
250 nmdc:mga07m45_11597_c1 3300050496 Bacteria 1215
251 nmdc:mga08y16_122435_c1 3300050511 Bacteria 2706
252 nmdc:mga0sz30_19700_c1 3300050516 Bacteria 2715
253 nmdc:mga0sz30_83303_c1 3300050516 Bacteria 1385
254 Ga0495601_0005260 3300053077 Bacteria 7530
255 Ga0495612_0000413 3300053078 Bacteria 17054
256 Ga0495612_0155169 3300053078 Bacteria 998
257 Ga0495595_0351170 3300053084 Bacteria 744
258 Ga0495619_0009785 3300053085 Bacteria 6046
259 Ga0495619_0503831 3300053085 Bacteria 832
260 Ga0500647_0065334 3300053091 Bacteria 1750
261 Ga0500641_0009737 3300053096 Bacteria 3458
262 Ga0500595_040112 3300053119 Bacteria 1512
263 Ga0500616_0001489 3300053153 Bacteria 22213
264 Ga0500620_050814 3300053155 Bacteria 1389
265 Ga0500609_007411 3300053731 Bacteria 1483
266 Ga0500552_001108 3300053733 Bacteria 2551
267 Ga0436363_0740785
268 Ga0070658_10003696
269 Ga0070683_100080973
270 Ga0070680_101120842
271 Ga0070682_100660873
272 Ga0070689_100262849
273 Ga0070691_10082241
274 Ga0070669_100090269
275 Ga0070675_100241190
276 Ga0070671_100677242
277 Ga0070709_10028021
278 Ga0070714_100049663
279 Ga0070714_101117024
280 Ga0070713_100071578
281 Ga0070711_100036982
282 Ga0070708_100276026
283 Ga0070681_10003315
284 Ga0070681_10115288
285 Ga0070681_11289753
286 Ga0070707_100166731
287 Ga0070707_101022327
288 Ga0070698_100000912
289 Ga0070699_100132243
290 Ga0070679_100049813
291 Ga0070684_100083011
292 Ga0068853_101316406
293 Ga0070665_100016913
294 Ga0070665_100397107
295 Ga0070665_100843168
296 Ga0068855_100020791
297 Ga0068855_100796229
298 Ga0068857_100072322
299 Ga0068857_100129823
300 Ga0068854_100737406
301 Ga0068856_100065307
302 Ga0068852_100233441
303 Ga0068859_100149472
304 Ga0068859_100808528
305 Ga0068870_10299901
306 Ga0068870_10664770
307 Ga0068860_100479981
308 Ga0081455_10001761
309 Ga0081455_10056829
310 Ga0081455_10168685
311 Ga0081540_1049490
312 Ga0081539_10007317
313 Ga0070717_10507071
314 Ga0075365_10006721
315 Ga0075365_10012471
316 Ga0075365_10172624
317 Ga0075365_10240783
318 Ga0075365_10305180
319 Ga0075368_10053540
320 Ga0075363_100096851
321 Ga0070712_100007307
322 Ga0070712_100141424
323 Ga0075362_10480321
324 Ga0075367_10047552
325 Ga0075367_10335186
326 Ga0075369_10061983
327 Ga0075366_10047629
328 Ga0075366_10542825
329 Ga0075370_10027774
330 Ga0075370_10074569
331 Ga0097620_100149470
332 Ga0097620_100808438
333 Ga0105240_10051312
334 Ga0111539_10383762
335 Ga0105245_10284236
336 Ga0105245_10434030
337 Ga0105242_10326842
338 Ga0105248_10022395
339 Ga0105248_11077704
340 Ga0105237_10500379
341 Ga0105238_10050469
342 Ga0105238_10136704
343 Ga0105239_10051412
344 Ga0105239_10123577
345 Ga0157371_10411812
346 Ga0157370_10054854
347 Ga0157369_10497317
348 Ga0157374_10088568
349 Ga0157372_10281080
350 Ga0163163_10085382
351 Ga0157376_10193028
352 Ga0206356_10758040
353 Ga0213872_10019083
354 Ga0213876_10203366
355 Ga0213871_10016259
356 Ga0207426_1009480
357 Ga0207699_10208423
358 Ga0207645_10142944
359 Ga0207705_10028646
360 Ga0207707_10084667
361 Ga0207707_10638838
362 Ga0207693_10026438
363 Ga0207693_10556058
364 Ga0207660_10091634
365 Ga0207660_10636007
366 Ga0207649_10250516
367 Ga0207652_10219936
368 Ga0207646_10164407
369 Ga0207646_10979581
370 Ga0207681_10468950
371 Ga0207694_10172895
372 Ga0207694_10505121
373 Ga0207659_10524871
374 Ga0207687_11835403
375 Ga0207700_10146839
376 Ga0207700_10318052
377 Ga0207700_11297574
378 Ga0207664_10031927
379 Ga0207686_10649107
380 Ga0207670_10727172
381 Ga0207669_11029562
382 Ga0207665_10167493
383 Ga0207711_10265495
384 Ga0207661_10051959
385 Ga0207667_10020659
386 Ga0207667_10042292
387 Ga0207651_10429347
388 Ga0207712_10862995
389 Ga0207658_10324327
390 Ga0207658_11623258
391 Ga0207702_10013695
392 Ga0207674_10031882
393 Ga0207674_10259738
394 Ga0207683_10490362
395 Ga0209813_10043190
396 Ga0268266_10004191
397 Ga0268266_10031062
398 Ga0268266_10041445
399 Ga0268264_10803415
400 Ga0265334_10037623
401 Ga0265332_10154569
402 Ga0265342_10197822
403 Ga0307416_100798561
404 Ga0373934_0142285
405 Ga0373940_0074063
406 Ga0373923_0032398
407 Ga0373923_0095083
408 Ga0373936_0056157
409 Ga0373939_0058582
410 Ga0373945_0081881
411 Ga0373953_0009776
412 Ga0373954_0027969
413 Ga0373954_0054087
414 Ga0373954_0364207
415 Ga0373956_0015383
416 Ga0373956_0280898
417 Ga0373957_0029169
418 Ga0373943_0163992
419 Ga0373946_0490199
420 Ga0373955_0205571
421 Ga0373955_0206514
422 Ga0373924_0008008
423 Ga0373924_0362109
424 Ga0373931_0198789
425 Ga0373931_0543770
426 Ga0373935_0020903
427 Ga0373935_0162644
428 Ga0373935_0420627
429 Ga0373927_0121798
430 Ga0373927_0187548
431 Ga0373927_0384358
432 Ga0373933_0008085
433 Ga0373933_0142592
434 Ga0373933_0427922
435 Ga0373933_0793416
436 Ga0373947_0195735
437 Ga0373947_0220917
438 Ga0373937_0001694
439 Ga0373937_0111774
440 Ga0373937_0143793
441 Ga0373937_0248649
442 Ga0373937_0577599
443 Ga0373925_0647021
444 Ga0373925_0978526
445 Ga0395899_0120477
446 Ga0395899_0169067
447 Ga0395899_0303675
448 Ga0395900_0004412
449 Ga0395900_0033390
450 Ga0395900_0080264
451 Ga0395900_0139763
452 Ga0395900_0185593
453 Ga0395898_0060454
454 Ga0395898_1343067
455 Ga0395905_0614706
456 Ga0395901_0003795
457 Ga0395901_0044371
458 Ga0436365_0357870
459 Ga0436360_0175600
460 Ga0436361_0854916
461 Ga0436362_1234638
462 Ga0466963_0015408
463 Ga0466957_0066591
464 Ga0466967_0007868
465 Ga0466967_1294229
466 Ga0495592_0070377
467 Ga0495651_0151205
468 Ga0495664_0002639
469 Ga0495608_0079568
470 Ga0495608_0137714
471 Ga0495628_0022654
472 Ga0495630_0223218
473 Ga0495652_0061989
474 Ga0495587_0191848
475 Ga0495587_0508118
476 Ga0495645_0000705
477 Ga0495667_0023245
478 Ga0495635_0042296
479 Ga0495635_0148940
480 Ga0495657_0072339
481 Ga0495599_0037154
482 Ga0495599_0460193
483 Ga0495623_0143042
484 Ga0495604_0089879
485 Ga0495674_0110179
486 Ga0495674_0242991
487 Ga0495680_0059948
488 Ga0495675_0026867
489 Ga0495684_0050619
490 Ga0495602_0000162
491 Ga0495602_0145187
492 Ga0496112_0673068
493 Ga0496113_0654620
494 Ga0496126_0187653
495 Ga0501034_0009799
496 Ga0501034_0017829
497 Ga0501034_0041417
498 Ga0501034_0532623
499 Ga0501037_0026129
500 Ga0501038_0182235
501 Ga0501038_0844117
502 Ga0501046_0271813
503 Ga0501068_0041357
504 Ga0501070_0181659
505 Ga0501044_0013865
506 Ga0501044_0879980
507 nmdc:mga00v17_174476_c1
508 nmdc:mga0yw44_135682_c1
509 nmdc:mga0yw44_404156_c1
510 nmdc:mga0yw44_69581_c1
511 nmdc:mga0k408_114161_c1
512 nmdc:mga0k408_37547_c1
513 nmdc:mga06z11_17930_c1
514 nmdc:mga06z11_503298_c1
515 nmdc:mga04h51_21817_c1
516 nmdc:mga07m45_11597_c1
517 nmdc:mga08y16_122435_c1
518 nmdc:mga0sz30_19700_c1
519 nmdc:mga0sz30_83303_c1
520 Ga0495601_0005260
521 Ga0495612_0000413
522 Ga0495612_0155169
523 Ga0495595_0351170
524 Ga0495619_0009785
525 Ga0495619_0503831
526 Ga0500647_0065334
527 Ga0500641_0009737
528 Ga0500595_040112
529 Ga0500616_0001489
530 Ga0500620_050814
531 Ga0500609_007411
532 Ga0500552_001108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

163

206

0.99

PF07336

ABATE

Putative stress-induced transcription regulator

17

159

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.7604 2 169
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.7269 2 169
2qsr-assembly1.cif.gz_A crystal structure of c-terminal domain of transcription-repair coupling factor 0.3365 72 117
1iqv-assembly1.cif.gz_A crystal structure analysis of the archaebacterial ribosomal protein s7 0.3002 32 123
1tgm-assembly1.cif.gz_A crystal structure of a complex formed between group ii phospholipase a2 and aspirin at 1.86 a resolution 0.2966 73 139
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7612 2 169 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7279 2 169 1.10.3300.10
3m92B01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Protein of unknown function (DUF2498) 0.5098 72 118 3.30.300.360
af_A0A7I9BBC6_346_521_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.452 57 116 3.40.50.1000
3m92B01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Protein of unknown function (DUF2498) 0.4006 72 118 3.30.300.360
ID Description Score Start End GO Terms
AF-A0A6N6ZKA1-F1-model_v4 deleted 0.9324 1 173
AF-A0A6N6ZKA1-F1-model_v4 deleted 0.9127 1 173
AF-A0A1Q3V1P4-F1-model_v4 Zinc finger CGNR domain-containing protein 0.889 3 172
AF-A0A537QKU2-F1-model_v4 Zinc finger CGNR domain-containing protein 0.8858 45 173
AF-A0A833V1Q1-F1-model_v4 Zinc finger CGNR domain-containing protein 0.866 4 171

Map