F374205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 46 | 532 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0419118|Ga0316574_0419118_66_509 |
| Length | 147 |
| Sequence | VIENTMEGGITMTDKESKDLQVKPKQEVSSLAEQTRPGLVFTPSVDIFETDHEITLLADMPGVSADNLTIDLRENTLTLTGEVAPFEGANEEDILIEYEIGKYYRQFNLSSLIDQSKIDAKLNDGVLRLSLPKVEEVKPRKIEIKTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 2 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 3 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 4 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 5 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 6 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 7 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 8 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 9 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 10 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 11 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 12 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 13 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 15 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 16 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 17 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 18 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 19 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 20 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 21 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 22 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 29 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 30 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 31 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 32 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 33 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 34 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 35 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 36 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 37 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 38 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 39 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 40 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 41 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 42 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 43 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 45 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 46 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.8 |
| Metatranscriptomes | 30.83 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316574_0419118 | 3300035398 | Unclassified | 841 |
| 2 | Ga0068853_100007312 | 3300005539 | Bacteria | 8837 |
| 3 | Ga0068853_100073839 | 3300005539 | Unclassified | 2975 |
| 4 | Ga0068861_101649648 | 3300005719 | Unclassified | 633 |
| 5 | Ga0068862_101363700 | 3300005844 | Unclassified | 712 |
| 6 | Ga0111539_10042211 | 3300009094 | Bacteria | 5480 |
| 7 | Ga0105245_10594195 | 3300009098 | Bacteria | 1133 |
| 8 | Ga0114129_10213825 | 3300009147 | Unclassified | 2605 |
| 9 | Ga0105237_11341815 | 3300009545 | Bacteria | 721 |
| 10 | Ga0105249_10062358 | 3300009553 | Bacteria | 3423 |
| 11 | Ga0157378_11099072 | 3300013297 | Bacteria | 832 |
| 12 | Ga0163161_10519406 | 3300017792 | Bacteria | 972 |
| 13 | Ga0207639_10005077 | 3300026041 | Bacteria | 8867 |
| 14 | Ga0207639_10068615 | 3300026041 | Bacteria | 2763 |
| 15 | Ga0207675_100169756 | 3300026118 | Bacteria | 2085 |
| 16 | Ga0316575_10005162 | 3300031665 | Bacteria | 4640 |
| 17 | Ga0316575_10006328 | 3300031665 | Bacteria | 4250 |
| 18 | Ga0316575_10008098 | 3300031665 | Bacteria | 3821 |
| 19 | Ga0316575_10027682 | 3300031665 | Bacteria | 2205 |
| 20 | Ga0316575_10041992 | 3300031665 | Bacteria | 1810 |
| 21 | Ga0316575_10086402 | 3300031665 | Archaea | 1268 |
| 22 | Ga0316575_10128013 | 3300031665 | Unclassified | 1041 |
| 23 | Ga0316575_10429459 | 3300031665 | Bacteria | 568 |
| 24 | Ga0316579_10001633 | 3300031691 | Bacteria | 8221 |
| 25 | Ga0316579_10007026 | 3300031691 | Bacteria | 4629 |
| 26 | Ga0316579_10007110 | 3300031691 | Bacteria | 4607 |
| 27 | Ga0316579_10034024 | 3300031691 | Bacteria | 2342 |
| 28 | Ga0316579_10038692 | 3300031691 | Bacteria | 2206 |
| 29 | Ga0316579_10061460 | 3300031691 | Unclassified | 1768 |
| 30 | Ga0316579_10061883 | 3300031691 | Bacteria | 1762 |
| 31 | Ga0316579_10089399 | 3300031691 | Bacteria | 1470 |
| 32 | Ga0316579_10244093 | 3300031691 | Bacteria | 869 |
| 33 | Ga0316579_10546055 | 3300031691 | Bacteria | 561 |
| 34 | Ga0316579_10578482 | 3300031691 | Bacteria | 544 |
| 35 | Ga0316579_10580178 | 3300031691 | Unclassified | 543 |
| 36 | Ga0316576_10005239 | 3300031727 | Bacteria | 7891 |
| 37 | Ga0316576_10005895 | 3300031727 | Bacteria | 7563 |
| 38 | Ga0316576_10021940 | 3300031727 | Unclassified | 4426 |
| 39 | Ga0316576_10024800 | 3300031727 | Bacteria | 4191 |
| 40 | Ga0316576_10027510 | 3300031727 | Unclassified | 4000 |
| 41 | Ga0316576_10039559 | 3300031727 | Bacteria | 3386 |
| 42 | Ga0316576_10085008 | 3300031727 | Bacteria | 2352 |
| 43 | Ga0316576_10257855 | 3300031727 | Bacteria | 1308 |
| 44 | Ga0316576_10300469 | 3300031727 | Unclassified | 1200 |
| 45 | Ga0316576_10307892 | 3300031727 | Bacteria | 1183 |
| 46 | Ga0316576_10338790 | 3300031727 | Bacteria | 1120 |
| 47 | Ga0316576_10486401 | 3300031727 | Bacteria | 909 |
| 48 | Ga0316576_10700540 | 3300031727 | Unclassified | 734 |
| 49 | Ga0316576_10944138 | 3300031727 | Bacteria | 616 |
| 50 | Ga0316576_11128743 | 3300031727 | Bacteria | 555 |
| 51 | Ga0316576_11143452 | 3300031727 | Unclassified | 551 |
| 52 | Ga0316578_10011236 | 3300031728 | Bacteria | 4676 |
| 53 | Ga0316578_10023352 | 3300031728 | Bacteria | 3459 |
| 54 | Ga0316578_10048907 | 3300031728 | Bacteria | 2470 |
| 55 | Ga0316578_10069998 | 3300031728 | Unclassified | 2076 |
| 56 | Ga0316578_10084341 | 3300031728 | Bacteria | 1893 |
| 57 | Ga0316578_10156582 | 3300031728 | Unclassified | 1373 |
| 58 | Ga0316578_10170067 | 3300031728 | Bacteria | 1313 |
| 59 | Ga0316578_10178964 | 3300031728 | Bacteria | 1278 |
| 60 | Ga0316578_10207897 | 3300031728 | Bacteria | 1178 |
| 61 | Ga0316578_10229652 | 3300031728 | Bacteria | 1115 |
| 62 | Ga0316578_10254260 | 3300031728 | Bacteria | 1054 |
| 63 | Ga0316578_10323883 | 3300031728 | Bacteria | 920 |
| 64 | Ga0316578_10365472 | 3300031728 | Bacteria | 858 |
| 65 | Ga0316578_10377108 | 3300031728 | Bacteria | 842 |
| 66 | Ga0316578_10390524 | 3300031728 | Unclassified | 825 |
| 67 | Ga0316578_10445307 | 3300031728 | Bacteria | 765 |
| 68 | Ga0316578_10481050 | 3300031728 | Unclassified | 732 |
| 69 | Ga0316578_10757301 | 3300031728 | Bacteria | 564 |
| 70 | Ga0316577_10007003 | 3300031733 | Bacteria | 5996 |
| 71 | Ga0316577_10019908 | 3300031733 | Bacteria | 3718 |
| 72 | Ga0316577_10025324 | 3300031733 | Bacteria | 3300 |
| 73 | Ga0316577_10039787 | 3300031733 | Bacteria | 2629 |
| 74 | Ga0316577_10085980 | 3300031733 | Bacteria | 1760 |
| 75 | Ga0316577_10108839 | 3300031733 | Bacteria | 1555 |
| 76 | Ga0316577_10113783 | 3300031733 | Bacteria | 1519 |
| 77 | Ga0316577_10191673 | 3300031733 | Bacteria | 1155 |
| 78 | Ga0316577_10411044 | 3300031733 | Bacteria | 769 |
| 79 | Ga0316577_10415650 | 3300031733 | Unclassified | 764 |
| 80 | Ga0316583_10010525 | 3300032133 | Bacteria | 3337 |
| 81 | Ga0316583_10029853 | 3300032133 | Bacteria | 1943 |
| 82 | Ga0316583_10054110 | 3300032133 | Bacteria | 1411 |
| 83 | Ga0316583_10056683 | 3300032133 | Bacteria | 1376 |
| 84 | Ga0316583_10066949 | 3300032133 | Viruses | 1257 |
| 85 | Ga0316583_10068817 | 3300032133 | Unclassified | 1238 |
| 86 | Ga0316583_10140850 | 3300032133 | Bacteria | 840 |
| 87 | Ga0316583_10144874 | 3300032133 | Bacteria | 827 |
| 88 | Ga0316583_10229294 | 3300032133 | Bacteria | 644 |
| 89 | Ga0316585_10002357 | 3300032137 | Bacteria | 5088 |
| 90 | Ga0316585_10004446 | 3300032137 | Bacteria | 3902 |
| 91 | Ga0316585_10013760 | 3300032137 | Bacteria | 2410 |
| 92 | Ga0316585_10016670 | 3300032137 | Bacteria | 2215 |
| 93 | Ga0316585_10017614 | 3300032137 | Bacteria | 2161 |
| 94 | Ga0316585_10038846 | 3300032137 | Bacteria | 1512 |
| 95 | Ga0316580_10004112 | 3300032139 | Bacteria | 4195 |
| 96 | Ga0316580_10004619 | 3300032139 | Bacteria | 3998 |
| 97 | Ga0316580_10020893 | 3300032139 | Unclassified | 2017 |
| 98 | Ga0316580_10029026 | 3300032139 | Unclassified | 1710 |
| 99 | Ga0316580_10080928 | 3300032139 | Bacteria | 993 |
| 100 | Ga0316580_10082756 | 3300032139 | Unclassified | 981 |
| 101 | Ga0316580_10159430 | 3300032139 | Viruses | 693 |
| 102 | Ga0316593_10020809 | 3300032168 | Unclassified | 2045 |
| 103 | Ga0316593_10021270 | 3300032168 | Bacteria | 2027 |
| 104 | Ga0316593_10021998 | 3300032168 | Bacteria | 1999 |
| 105 | Ga0316593_10026794 | 3300032168 | Viruses | 1845 |
| 106 | Ga0316593_10027884 | 3300032168 | Bacteria | 1816 |
| 107 | Ga0316593_10029652 | 3300032168 | Unclassified | 1771 |
| 108 | Ga0316593_10031282 | 3300032168 | Bacteria | 1733 |
| 109 | Ga0316593_10033345 | 3300032168 | Bacteria | 1685 |
| 110 | Ga0316593_10035652 | 3300032168 | Bacteria | 1637 |
| 111 | Ga0316593_10036336 | 3300032168 | Bacteria | 1624 |
| 112 | Ga0316593_10036528 | 3300032168 | Unclassified | 1620 |
| 113 | Ga0316593_10044012 | 3300032168 | Bacteria | 1493 |
| 114 | Ga0316593_10044190 | 3300032168 | Bacteria | 1490 |
| 115 | Ga0316593_10044825 | 3300032168 | Bacteria | 1481 |
| 116 | Ga0316593_10047025 | 3300032168 | Unclassified | 1450 |
| 117 | Ga0316593_10047536 | 3300032168 | Unclassified | 1443 |
| 118 | Ga0316593_10051030 | 3300032168 | Unclassified | 1397 |
| 119 | Ga0316593_10053416 | 3300032168 | Bacteria | 1369 |
| 120 | Ga0316593_10054982 | 3300032168 | Bacteria | 1352 |
| 121 | Ga0316593_10057937 | 3300032168 | Bacteria | 1320 |
| 122 | Ga0316593_10058947 | 3300032168 | Bacteria | 1310 |
| 123 | Ga0316593_10063951 | 3300032168 | Bacteria | 1262 |
| 124 | Ga0316593_10068224 | 3300032168 | Bacteria | 1226 |
| 125 | Ga0316593_10070177 | 3300032168 | Bacteria | 1211 |
| 126 | Ga0316593_10070743 | 3300032168 | Bacteria | 1206 |
| 127 | Ga0316593_10072652 | 3300032168 | Bacteria | 1192 |
| 128 | Ga0316593_10082346 | 3300032168 | Unclassified | 1125 |
| 129 | Ga0316593_10084707 | 3300032168 | Unclassified | 1110 |
| 130 | Ga0316593_10085836 | 3300032168 | Bacteria | 1103 |
| 131 | Ga0316593_10087003 | 3300032168 | Unclassified | 1097 |
| 132 | Ga0316593_10094833 | 3300032168 | Bacteria | 1053 |
| 133 | Ga0316593_10096254 | 3300032168 | Bacteria | 1046 |
| 134 | Ga0316593_10099504 | 3300032168 | Unclassified | 1030 |
| 135 | Ga0316593_10103401 | 3300032168 | Bacteria | 1012 |
| 136 | Ga0316593_10106207 | 3300032168 | Bacteria | 1000 |
| 137 | Ga0316593_10110924 | 3300032168 | Bacteria | 979 |
| 138 | Ga0316593_10118618 | 3300032168 | Bacteria | 949 |
| 139 | Ga0316593_10119185 | 3300032168 | Bacteria | 947 |
| 140 | Ga0316593_10120867 | 3300032168 | Unclassified | 941 |
| 141 | Ga0316593_10124426 | 3300032168 | Unclassified | 927 |
| 142 | Ga0316593_10125656 | 3300032168 | Bacteria | 923 |
| 143 | Ga0316593_10127221 | 3300032168 | Bacteria | 918 |
| 144 | Ga0316593_10149609 | 3300032168 | Bacteria | 849 |
| 145 | Ga0316593_10150963 | 3300032168 | Bacteria | 845 |
| 146 | Ga0316593_10190084 | 3300032168 | Unclassified | 757 |
| 147 | Ga0316593_10193006 | 3300032168 | Bacteria | 751 |
| 148 | Ga0316593_10226365 | 3300032168 | Unclassified | 696 |
| 149 | Ga0316593_10299017 | 3300032168 | Bacteria | 609 |
| 150 | Ga0316593_10326647 | 3300032168 | Bacteria | 584 |
| 151 | Ga0316593_10386565 | 3300032168 | Bacteria | 539 |
| 152 | Ga0316593_10418313 | 3300032168 | Bacteria | 520 |
| 153 | Ga0316592_1032225 | 3300033524 | Unclassified | 1143 |
| 154 | Ga0316592_1033326 | 3300033524 | Unclassified | 1126 |
| 155 | Ga0316592_1035959 | 3300033524 | Bacteria | 1087 |
| 156 | Ga0316592_1040050 | 3300033524 | Bacteria | 1036 |
| 157 | Ga0316592_1042024 | 3300033524 | Bacteria | 1013 |
| 158 | Ga0316592_1042468 | 3300033524 | Bacteria | 1008 |
| 159 | Ga0316592_1046921 | 3300033524 | Bacteria | 962 |
| 160 | Ga0316592_1051550 | 3300033524 | Bacteria | 919 |
| 161 | Ga0316592_1102915 | 3300033524 | Unclassified | 658 |
| 162 | Ga0316586_1061146 | 3300033527 | Unclassified | 685 |
| 163 | Ga0316586_1121065 | 3300033527 | Unclassified | 510 |
| 164 | Ga0316588_1018827 | 3300033528 | Bacteria | 1549 |
| 165 | Ga0316588_1046872 | 3300033528 | Bacteria | 1043 |
| 166 | Ga0316588_1049446 | 3300033528 | Unclassified | 1018 |
| 167 | Ga0316588_1081276 | 3300033528 | Unclassified | 803 |
| 168 | Ga0316587_1016506 | 3300033529 | Bacteria | 1232 |
| 169 | Ga0316596_1005725 | 3300033541 | Unclassified | 2855 |
| 170 | Ga0316596_1033157 | 3300033541 | Bacteria | 1345 |
| 171 | Ga0316596_1033833 | 3300033541 | Viruses | 1333 |
| 172 | Ga0316596_1042309 | 3300033541 | Bacteria | 1198 |
| 173 | Ga0316596_1057175 | 3300033541 | Archaea | 1038 |
| 174 | Ga0316596_1061249 | 3300033541 | Unclassified | 1004 |
| 175 | Ga0316596_1064151 | 3300033541 | Bacteria | 981 |
| 176 | Ga0316596_1064765 | 3300033541 | Bacteria | 976 |
| 177 | Ga0316596_1068352 | 3300033541 | Bacteria | 950 |
| 178 | Ga0316596_1073655 | 3300033541 | Bacteria | 915 |
| 179 | Ga0316596_1114903 | 3300033541 | Unclassified | 731 |
| 180 | Ga0316596_1145158 | 3300033541 | Archaea | 651 |
| 181 | Ga0316596_1210337 | 3300033541 | Unclassified | 543 |
| 182 | Ga0316596_1228840 | 3300033541 | Unclassified | 521 |
| 183 | Ga0316596_1232571 | 3300033541 | Bacteria | 517 |
| 184 | Ga0316574_0000031 | 3300035398 | Bacteria | 35670 |
| 185 | Ga0316574_0000573 | 3300035398 | Bacteria | 15188 |
| 186 | Ga0316574_0003990 | 3300035398 | Bacteria | 7686 |
| 187 | Ga0316574_0009363 | 3300035398 | Bacteria | 5485 |
| 188 | Ga0316574_0015932 | 3300035398 | Bacteria | 4370 |
| 189 | Ga0316574_0032385 | 3300035398 | Bacteria | 3177 |
| 190 | Ga0316574_0151430 | 3300035398 | Bacteria | 1494 |
| 191 | Ga0316574_0166753 | 3300035398 | Bacteria | 1418 |
| 192 | Ga0316574_0192867 | 3300035398 | Unclassified | 1310 |
| 193 | Ga0316574_0324683 | 3300035398 | Unclassified | 977 |
| 194 | Ga0316574_0333604 | 3300035398 | Bacteria | 961 |
| 195 | Ga0316574_0675172 | 3300035398 | Unclassified | 635 |
| 196 | Ga0316574_0699580 | 3300035398 | Unclassified | 621 |
| 197 | Ga0316574_0965200 | 3300035398 | Bacteria | 514 |
| 198 | Ga0316582_0001148 | 3300036647 | Bacteria | 11277 |
| 199 | Ga0316582_0001437 | 3300036647 | Bacteria | 10435 |
| 200 | Ga0316582_0002718 | 3300036647 | Bacteria | 8397 |
| 201 | Ga0316582_0003462 | 3300036647 | Bacteria | 7745 |
| 202 | Ga0316582_0006732 | 3300036647 | Bacteria | 6064 |
| 203 | Ga0316582_0012839 | 3300036647 | Unclassified | 4692 |
| 204 | Ga0316582_0041754 | 3300036647 | Unclassified | 2869 |
| 205 | Ga0316582_0056708 | 3300036647 | Bacteria | 2500 |
| 206 | Ga0316582_0069758 | 3300036647 | Bacteria | 2273 |
| 207 | Ga0316582_0101968 | 3300036647 | Bacteria | 1902 |
| 208 | Ga0316582_0365785 | 3300036647 | Unclassified | 992 |
| 209 | Ga0316582_0441458 | 3300036647 | Unclassified | 897 |
| 210 | Ga0316582_0454958 | 3300036647 | Bacteria | 882 |
| 211 | Ga0316582_0490720 | 3300036647 | Bacteria | 846 |
| 212 | Ga0316582_0921577 | 3300036647 | Unclassified | 597 |
| 213 | Ga0316582_0997286 | 3300036647 | Bacteria | 572 |
| 214 | Ga0316584_0001748 | 3300036712 | Bacteria | 13352 |
| 215 | Ga0316584_0007330 | 3300036712 | Bacteria | 7533 |
| 216 | Ga0316584_0009423 | 3300036712 | Bacteria | 6778 |
| 217 | Ga0316584_0010600 | 3300036712 | Bacteria | 6450 |
| 218 | Ga0316584_0015021 | 3300036712 | Bacteria | 5531 |
| 219 | Ga0316584_0015246 | 3300036712 | Bacteria | 5492 |
| 220 | Ga0316584_0017995 | 3300036712 | Bacteria | 5091 |
| 221 | Ga0316584_0036698 | 3300036712 | Bacteria | 3638 |
| 222 | Ga0316584_0038878 | 3300036712 | Bacteria | 3540 |
| 223 | Ga0316584_0045380 | 3300036712 | Bacteria | 3280 |
| 224 | Ga0316584_0055565 | 3300036712 | Bacteria | 2964 |
| 225 | Ga0316584_0066630 | 3300036712 | Bacteria | 2698 |
| 226 | Ga0316584_0099381 | 3300036712 | Bacteria | 2179 |
| 227 | Ga0316584_0135075 | 3300036712 | Bacteria | 1842 |
| 228 | Ga0316584_0142215 | 3300036712 | Bacteria | 1789 |
| 229 | Ga0316584_0265702 | 3300036712 | Unclassified | 1250 |
| 230 | Ga0316584_0320882 | 3300036712 | Bacteria | 1117 |
| 231 | Ga0316584_0343316 | 3300036712 | Unclassified | 1073 |
| 232 | Ga0316584_0383674 | 3300036712 | Bacteria | 1004 |
| 233 | Ga0316584_0393997 | 3300036712 | Unclassified | 988 |
| 234 | Ga0316584_0417318 | 3300036712 | Bacteria | 954 |
| 235 | Ga0316584_0509759 | 3300036712 | Unclassified | 844 |
| 236 | Ga0316584_1050668 | 3300036712 | Unclassified | 542 |
| 237 | Ga0316581_0006165 | 3300037588 | Bacteria | 3160 |
| 238 | Ga0316581_0011602 | 3300037588 | Bacteria | 2467 |
| 239 | Ga0316581_0067958 | 3300037588 | Bacteria | 1094 |
| 240 | Ga0316581_0081583 | 3300037588 | Unclassified | 995 |
| 241 | Ga0316581_0125006 | 3300037588 | Bacteria | 793 |
| 242 | Ga0400484_02678 | 3300038725 | Bacteria | 9964 |
| 243 | Ga0400484_24606 | 3300038725 | Bacteria | 3164 |
| 244 | Ga0400484_42879 | 3300038725 | Bacteria | 1459 |
| 245 | Ga0400490_02251 | 3300038726 | Bacteria | 1554 |
| 246 | Ga0400490_48484 | 3300038726 | Bacteria | 5337 |
| 247 | Ga0400491_15969 | 3300038727 | Bacteria | 1466 |
| 248 | Ga0400485_12190 | 3300038735 | Bacteria | 1023 |
| 249 | Ga0400485_17873 | 3300038735 | Bacteria | 24379 |
| 250 | Ga0400488_09035 | 3300038741 | Bacteria | 1986 |
| 251 | Ga0400488_40185 | 3300038741 | Bacteria | 7960 |
| 252 | Ga0400486_23273 | 3300038742 | Bacteria | 28833 |
| 253 | Ga0400483_145762 | 3300039062 | Bacteria | 1033 |
| 254 | Ga0400483_182962 | 3300039062 | Unclassified | 1341 |
| 255 | Ga0400483_221377 | 3300039062 | Bacteria | 2615 |
| 256 | Ga0400483_279540 | 3300039062 | Bacteria | 6341 |
| 257 | Ga0400489_37263 | 3300039093 | Bacteria | 1547 |
| 258 | Ga0400487_03138 | 3300039110 | Bacteria | 4349 |
| 259 | Ga0400487_63934 | 3300039110 | Bacteria | 30817 |
| 260 | Ga0451577_0648694 | 3300042876 | Bacteria | 957 |
| 261 | Ga0453683_0153859 | 3300044673 | Bacteria | 1454 |
| 262 | Ga0453684_0008129 | 3300044712 | Bacteria | 18941 |
| 263 | Ga0495586_0670987 | 3300046535 | Unclassified | 599 |
| 264 | nmdc:mga05p37_71095_c1 | 3300050507 | Bacteria | 3033 |
| 265 | nmdc:mga0qj67_234648_c1 | 3300050509 | Bacteria | 1488 |
| 266 | 2740994198 | 2740891818 | Bacteria | 6711283 |
| 267 | Ga0316574_0419118 | |||
| 268 | Ga0068853_100007312 | |||
| 269 | Ga0068853_100073839 | |||
| 270 | Ga0068861_101649648 | |||
| 271 | Ga0068862_101363700 | |||
| 272 | Ga0111539_10042211 | |||
| 273 | Ga0105245_10594195 | |||
| 274 | Ga0114129_10213825 | |||
| 275 | Ga0105237_11341815 | |||
| 276 | Ga0105249_10062358 | |||
| 277 | Ga0157378_11099072 | |||
| 278 | Ga0163161_10519406 | |||
| 279 | Ga0207639_10005077 | |||
| 280 | Ga0207639_10068615 | |||
| 281 | Ga0207675_100169756 | |||
| 282 | Ga0316575_10005162 | |||
| 283 | Ga0316575_10006328 | |||
| 284 | Ga0316575_10008098 | |||
| 285 | Ga0316575_10027682 | |||
| 286 | Ga0316575_10041992 | |||
| 287 | Ga0316575_10086402 | |||
| 288 | Ga0316575_10128013 | |||
| 289 | Ga0316575_10429459 | |||
| 290 | Ga0316579_10001633 | |||
| 291 | Ga0316579_10007026 | |||
| 292 | Ga0316579_10007110 | |||
| 293 | Ga0316579_10034024 | |||
| 294 | Ga0316579_10038692 | |||
| 295 | Ga0316579_10061460 | |||
| 296 | Ga0316579_10061883 | |||
| 297 | Ga0316579_10089399 | |||
| 298 | Ga0316579_10244093 | |||
| 299 | Ga0316579_10546055 | |||
| 300 | Ga0316579_10578482 | |||
| 301 | Ga0316579_10580178 | |||
| 302 | Ga0316576_10005239 | |||
| 303 | Ga0316576_10005895 | |||
| 304 | Ga0316576_10021940 | |||
| 305 | Ga0316576_10024800 | |||
| 306 | Ga0316576_10027510 | |||
| 307 | Ga0316576_10039559 | |||
| 308 | Ga0316576_10085008 | |||
| 309 | Ga0316576_10257855 | |||
| 310 | Ga0316576_10300469 | |||
| 311 | Ga0316576_10307892 | |||
| 312 | Ga0316576_10338790 | |||
| 313 | Ga0316576_10486401 | |||
| 314 | Ga0316576_10700540 | |||
| 315 | Ga0316576_10944138 | |||
| 316 | Ga0316576_11128743 | |||
| 317 | Ga0316576_11143452 | |||
| 318 | Ga0316578_10011236 | |||
| 319 | Ga0316578_10023352 | |||
| 320 | Ga0316578_10048907 | |||
| 321 | Ga0316578_10069998 | |||
| 322 | Ga0316578_10084341 | |||
| 323 | Ga0316578_10156582 | |||
| 324 | Ga0316578_10170067 | |||
| 325 | Ga0316578_10178964 | |||
| 326 | Ga0316578_10207897 | |||
| 327 | Ga0316578_10229652 | |||
| 328 | Ga0316578_10254260 | |||
| 329 | Ga0316578_10323883 | |||
| 330 | Ga0316578_10365472 | |||
| 331 | Ga0316578_10377108 | |||
| 332 | Ga0316578_10390524 | |||
| 333 | Ga0316578_10445307 | |||
| 334 | Ga0316578_10481050 | |||
| 335 | Ga0316578_10757301 | |||
| 336 | Ga0316577_10007003 | |||
| 337 | Ga0316577_10019908 | |||
| 338 | Ga0316577_10025324 | |||
| 339 | Ga0316577_10039787 | |||
| 340 | Ga0316577_10085980 | |||
| 341 | Ga0316577_10108839 | |||
| 342 | Ga0316577_10113783 | |||
| 343 | Ga0316577_10191673 | |||
| 344 | Ga0316577_10411044 | |||
| 345 | Ga0316577_10415650 | |||
| 346 | Ga0316583_10010525 | |||
| 347 | Ga0316583_10029853 | |||
| 348 | Ga0316583_10054110 | |||
| 349 | Ga0316583_10056683 | |||
| 350 | Ga0316583_10066949 | |||
| 351 | Ga0316583_10068817 | |||
| 352 | Ga0316583_10140850 | |||
| 353 | Ga0316583_10144874 | |||
| 354 | Ga0316583_10229294 | |||
| 355 | Ga0316585_10002357 | |||
| 356 | Ga0316585_10004446 | |||
| 357 | Ga0316585_10013760 | |||
| 358 | Ga0316585_10016670 | |||
| 359 | Ga0316585_10017614 | |||
| 360 | Ga0316585_10038846 | |||
| 361 | Ga0316580_10004112 | |||
| 362 | Ga0316580_10004619 | |||
| 363 | Ga0316580_10020893 | |||
| 364 | Ga0316580_10029026 | |||
| 365 | Ga0316580_10080928 | |||
| 366 | Ga0316580_10082756 | |||
| 367 | Ga0316580_10159430 | |||
| 368 | Ga0316593_10020809 | |||
| 369 | Ga0316593_10021270 | |||
| 370 | Ga0316593_10021998 | |||
| 371 | Ga0316593_10026794 | |||
| 372 | Ga0316593_10027884 | |||
| 373 | Ga0316593_10029652 | |||
| 374 | Ga0316593_10031282 | |||
| 375 | Ga0316593_10033345 | |||
| 376 | Ga0316593_10035652 | |||
| 377 | Ga0316593_10036336 | |||
| 378 | Ga0316593_10036528 | |||
| 379 | Ga0316593_10044012 | |||
| 380 | Ga0316593_10044190 | |||
| 381 | Ga0316593_10044825 | |||
| 382 | Ga0316593_10047025 | |||
| 383 | Ga0316593_10047536 | |||
| 384 | Ga0316593_10051030 | |||
| 385 | Ga0316593_10053416 | |||
| 386 | Ga0316593_10054982 | |||
| 387 | Ga0316593_10057937 | |||
| 388 | Ga0316593_10058947 | |||
| 389 | Ga0316593_10063951 | |||
| 390 | Ga0316593_10068224 | |||
| 391 | Ga0316593_10070177 | |||
| 392 | Ga0316593_10070743 | |||
| 393 | Ga0316593_10072652 | |||
| 394 | Ga0316593_10082346 | |||
| 395 | Ga0316593_10084707 | |||
| 396 | Ga0316593_10085836 | |||
| 397 | Ga0316593_10087003 | |||
| 398 | Ga0316593_10094833 | |||
| 399 | Ga0316593_10096254 | |||
| 400 | Ga0316593_10099504 | |||
| 401 | Ga0316593_10103401 | |||
| 402 | Ga0316593_10106207 | |||
| 403 | Ga0316593_10110924 | |||
| 404 | Ga0316593_10118618 | |||
| 405 | Ga0316593_10119185 | |||
| 406 | Ga0316593_10120867 | |||
| 407 | Ga0316593_10124426 | |||
| 408 | Ga0316593_10125656 | |||
| 409 | Ga0316593_10127221 | |||
| 410 | Ga0316593_10149609 | |||
| 411 | Ga0316593_10150963 | |||
| 412 | Ga0316593_10190084 | |||
| 413 | Ga0316593_10193006 | |||
| 414 | Ga0316593_10226365 | |||
| 415 | Ga0316593_10299017 | |||
| 416 | Ga0316593_10326647 | |||
| 417 | Ga0316593_10386565 | |||
| 418 | Ga0316593_10418313 | |||
| 419 | Ga0316592_1032225 | |||
| 420 | Ga0316592_1033326 | |||
| 421 | Ga0316592_1035959 | |||
| 422 | Ga0316592_1040050 | |||
| 423 | Ga0316592_1042024 | |||
| 424 | Ga0316592_1042468 | |||
| 425 | Ga0316592_1046921 | |||
| 426 | Ga0316592_1051550 | |||
| 427 | Ga0316592_1102915 | |||
| 428 | Ga0316586_1061146 | |||
| 429 | Ga0316586_1121065 | |||
| 430 | Ga0316588_1018827 | |||
| 431 | Ga0316588_1046872 | |||
| 432 | Ga0316588_1049446 | |||
| 433 | Ga0316588_1081276 | |||
| 434 | Ga0316587_1016506 | |||
| 435 | Ga0316596_1005725 | |||
| 436 | Ga0316596_1033157 | |||
| 437 | Ga0316596_1033833 | |||
| 438 | Ga0316596_1042309 | |||
| 439 | Ga0316596_1057175 | |||
| 440 | Ga0316596_1061249 | |||
| 441 | Ga0316596_1064151 | |||
| 442 | Ga0316596_1064765 | |||
| 443 | Ga0316596_1068352 | |||
| 444 | Ga0316596_1073655 | |||
| 445 | Ga0316596_1114903 | |||
| 446 | Ga0316596_1145158 | |||
| 447 | Ga0316596_1210337 | |||
| 448 | Ga0316596_1228840 | |||
| 449 | Ga0316596_1232571 | |||
| 450 | Ga0316574_0000031 | |||
| 451 | Ga0316574_0000573 | |||
| 452 | Ga0316574_0003990 | |||
| 453 | Ga0316574_0009363 | |||
| 454 | Ga0316574_0015932 | |||
| 455 | Ga0316574_0032385 | |||
| 456 | Ga0316574_0151430 | |||
| 457 | Ga0316574_0166753 | |||
| 458 | Ga0316574_0192867 | |||
| 459 | Ga0316574_0324683 | |||
| 460 | Ga0316574_0333604 | |||
| 461 | Ga0316574_0675172 | |||
| 462 | Ga0316574_0699580 | |||
| 463 | Ga0316574_0965200 | |||
| 464 | Ga0316582_0001148 | |||
| 465 | Ga0316582_0001437 | |||
| 466 | Ga0316582_0002718 | |||
| 467 | Ga0316582_0003462 | |||
| 468 | Ga0316582_0006732 | |||
| 469 | Ga0316582_0012839 | |||
| 470 | Ga0316582_0041754 | |||
| 471 | Ga0316582_0056708 | |||
| 472 | Ga0316582_0069758 | |||
| 473 | Ga0316582_0101968 | |||
| 474 | Ga0316582_0365785 | |||
| 475 | Ga0316582_0441458 | |||
| 476 | Ga0316582_0454958 | |||
| 477 | Ga0316582_0490720 | |||
| 478 | Ga0316582_0921577 | |||
| 479 | Ga0316582_0997286 | |||
| 480 | Ga0316584_0001748 | |||
| 481 | Ga0316584_0007330 | |||
| 482 | Ga0316584_0009423 | |||
| 483 | Ga0316584_0010600 | |||
| 484 | Ga0316584_0015021 | |||
| 485 | Ga0316584_0015246 | |||
| 486 | Ga0316584_0017995 | |||
| 487 | Ga0316584_0036698 | |||
| 488 | Ga0316584_0038878 | |||
| 489 | Ga0316584_0045380 | |||
| 490 | Ga0316584_0055565 | |||
| 491 | Ga0316584_0066630 | |||
| 492 | Ga0316584_0099381 | |||
| 493 | Ga0316584_0135075 | |||
| 494 | Ga0316584_0142215 | |||
| 495 | Ga0316584_0265702 | |||
| 496 | Ga0316584_0320882 | |||
| 497 | Ga0316584_0343316 | |||
| 498 | Ga0316584_0383674 | |||
| 499 | Ga0316584_0393997 | |||
| 500 | Ga0316584_0417318 | |||
| 501 | Ga0316584_0509759 | |||
| 502 | Ga0316584_1050668 | |||
| 503 | Ga0316581_0006165 | |||
| 504 | Ga0316581_0011602 | |||
| 505 | Ga0316581_0067958 | |||
| 506 | Ga0316581_0081583 | |||
| 507 | Ga0316581_0125006 | |||
| 508 | Ga0400484_02678 | |||
| 509 | Ga0400484_24606 | |||
| 510 | Ga0400484_42879 | |||
| 511 | Ga0400490_02251 | |||
| 512 | Ga0400490_48484 | |||
| 513 | Ga0400491_15969 | |||
| 514 | Ga0400485_12190 | |||
| 515 | Ga0400485_17873 | |||
| 516 | Ga0400488_09035 | |||
| 517 | Ga0400488_40185 | |||
| 518 | Ga0400486_23273 | |||
| 519 | Ga0400483_145762 | |||
| 520 | Ga0400483_182962 | |||
| 521 | Ga0400483_221377 | |||
| 522 | Ga0400483_279540 | |||
| 523 | Ga0400489_37263 | |||
| 524 | Ga0400487_03138 | |||
| 525 | Ga0400487_63934 | |||
| 526 | Ga0451577_0648694 | |||
| 527 | Ga0453683_0153859 | |||
| 528 | Ga0453684_0008129 | |||
| 529 | Ga0495586_0670987 | |||
| 530 | nmdc:mga05p37_71095_c1 | |||
| 531 | nmdc:mga0qj67_234648_c1 | |||
| 532 | 2740994198 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rzk-assembly1.cif.gz_B | crystal structure of sulfolobus solfataricus hsp20.1 acd | 0.8716 | 30 | 128 |
| 4rzk-assembly1.cif.gz_B | crystal structure of sulfolobus solfataricus hsp20.1 acd | 0.8534 | 30 | 128 |
| 5ds1-assembly2.cif.gz_C | core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum | 0.8393 | 38 | 128 |
| 4m5t-assembly3.cif.gz_A | disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide | 0.8252 | 41 | 131 |
| 5ds1-assembly2.cif.gz_C | core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum | 0.8225 | 38 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rzkB00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8716 | 30 | 128 | 2.60.40.790 |
| af_A4I9J1_8_137_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.867 | 37 | 127 | 2.60.40.790 |
| af_Q8S1F2_1_96_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8656 | 31 | 134 | 2.60.40.790 |
| 4rzkB00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8534 | 30 | 128 | 2.60.40.790 |
| af_Q0JL44_161_266_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8452 | 38 | 128 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5DFF3-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8422 | 30 | 130 |
|
| AF-A0A2N1STN0-F1-model_v4 | deleted | 0.8359 | 33 | 142 |
|
| AF-A0A3M1G604-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8245 | 31 | 141 |
|
| AF-F4PR58-F1-model_v4 | SHSP domain-containing protein | 0.8203 | 37 | 132 |
|
| AF-A0A2N1STN0-F1-model_v4 | deleted | 0.816 | 33 | 142 |
|