F374115

General Info

Members Datasets Scaffolds Average Seq Length
266 165 266 188

Family's Representative Sequence

Representative Sequence 3300025893|Ga0207682_10074181|Ga0207682_100741811
Length 200
Sequence VANELQGKRVAFLATDMVEQVELTEPWKAIEQAGATPELISLEEGEIQGFNHYDKADTFQVDRTVEDAGVDDYDGLVIPGGVGNPDTMRADENAVRFVREFMESGKPLAVICHGPWMLVEADVVRGRTVTSWPSLHTDLRNAGADWVDREVVTDEGLVTSRKPDDIPAFNKKMIEEFGEGVHEGQRRAARRSTQPEAAAG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
62 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
63 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 11.28
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001952 3300003373 Bacteria 4789
2 JGI25407J50210_10014755 3300003373 Bacteria 2014
3 Ga0070683_100005028 3300005329 Bacteria 10975
4 Ga0070683_100365303 3300005329 Bacteria 1375
5 Ga0070666_10305847 3300005335 Bacteria 1133
6 Ga0070691_10130791 3300005341 Bacteria 1272
7 Ga0070687_100257650 3300005343 Bacteria 1087
8 Ga0070687_100800161 3300005343 Bacteria 668
9 Ga0070661_100835033 3300005344 Bacteria 758
10 Ga0070668_100821590 3300005347 Bacteria 827
11 Ga0070671_100308087 3300005355 Bacteria 1348
12 Ga0070709_10036489 3300005434 Bacteria 2995
13 Ga0070713_100009838 3300005436 Bacteria 6877
14 Ga0070713_100103915 3300005436 Bacteria 2466
15 Ga0070705_100170448 3300005440 Bacteria 1464
16 Ga0070663_100412828 3300005455 Bacteria 1106
17 Ga0070684_100007921 3300005535 Bacteria 8291
18 Ga0070686_100071406 3300005544 Bacteria 2273
19 Ga0070696_100161922 3300005546 Bacteria 1649
20 Ga0070693_100016082 3300005547 Bacteria 3865
21 Ga0070704_100446183 3300005549 Bacteria 1113
22 Ga0070664_100066121 3300005564 Bacteria 3087
23 Ga0068857_100006898 3300005577 Bacteria 9779
24 Ga0068854_100660345 3300005578 Bacteria 899
25 Ga0068856_100054886 3300005614 Bacteria 3931
26 Ga0068856_100484641 3300005614 Bacteria 1258
27 Ga0070702_100275033 3300005615 Bacteria 1153
28 Ga0081455_10007255 3300005937 Bacteria 11703
29 Ga0081455_10017144 3300005937 Bacteria 6956
30 Ga0081455_10035603 3300005937 Bacteria 4446
31 Ga0081455_10108579 3300005937 Bacteria 2210
32 Ga0081455_10147008 3300005937 Bacteria 1822
33 Ga0081538_10000194 3300005981 Bacteria 67012
34 Ga0081538_10118759 3300005981 Bacteria 1276
35 Ga0075365_10360994 3300006038 Bacteria 1024
36 Ga0075428_100007970 3300006844 Bacteria 11751
37 Ga0075431_100201038 3300006847 Bacteria 2039
38 Ga0075433_10021924 3300006852 Bacteria 5359
39 Ga0075434_100000261 3300006871 Bacteria 37401
40 Ga0075429_100328614 3300006880 Bacteria 1338
41 Ga0075435_100078243 3300007076 Bacteria 2712
42 Ga0075435_100421392 3300007076 Bacteria 1150
43 Ga0111539_10058946 3300009094 Bacteria 4554
44 Ga0111539_10407419 3300009094 Bacteria 1584
45 Ga0105245_10537682 3300009098 Bacteria 1189
46 Ga0114129_10005909 3300009147 Bacteria 17316
47 Ga0114129_10175914 3300009147 Bacteria 2915
48 Ga0114129_12343724 3300009147 Bacteria 640
49 Ga0105248_10758084 3300009177 Bacteria 1095
50 Ga0105238_10291806 3300009551 Bacteria 1613
51 Ga0105239_10042310 3300010375 Bacteria 4993
52 Ga0105246_10172955 3300011119 Bacteria 1656
53 Ga0157371_10261145 3300013102 Bacteria 1248
54 Ga0157372_10182292 3300013307 Bacteria 2431
55 Ga0157375_10261016 3300013308 Bacteria 1894
56 Ga0163163_10224977 3300014325 Bacteria 1925
57 Ga0163163_10459883 3300014325 Unclassified 1333
58 Ga0206350_10436137 3300020080 Bacteria 968
59 Ga0207682_10074181 3300025893 Bacteria 1446
60 Ga0207699_10010551 3300025906 Bacteria 4642
61 Ga0207654_10192635 3300025911 Bacteria 1337
62 Ga0207657_10140050 3300025919 Bacteria 1977
63 Ga0207694_10324054 3300025924 Bacteria 1272
64 Ga0207687_10090091 3300025927 Bacteria 2234
65 Ga0207700_10000002 3300025928 Bacteria 775978
66 Ga0207704_10592658 3300025938 Bacteria 906
67 Ga0207711_10531916 3300025941 Bacteria 1096
68 Ga0207661_10024254 3300025944 Bacteria 4594
69 Ga0207679_10490611 3300025945 Unclassified 1095
70 Ga0207679_10771192 3300025945 Bacteria 875
71 Ga0207708_10069615 3300026075 Bacteria 2694
72 Ga0207702_10024536 3300026078 Bacteria 5003
73 Ga0207702_10585234 3300026078 Bacteria 1094
74 Ga0207676_10017918 3300026095 Bacteria 5139
75 Ga0207674_10002594 3300026116 Bacteria 22767
76 Ga0207428_10314227 3300027907 Bacteria 1158
77 Ga0307416_100309267 3300032002 Bacteria 1576
78 Ga0373938_0143732 3300034957 Bacteria 631
79 Ga0373926_0100333 3300035083 Bacteria 1082
80 Ga0373945_0056455 3300035116 Bacteria 1456
81 Ga0373943_0004098 3300035170 Bacteria 6618
82 Ga0373946_0168919 3300035171 Bacteria 1031
83 Ga0373935_0087530 3300035692 Bacteria 2034
84 Ga0373927_0260304 3300035695 Bacteria 1141
85 Ga0373947_0001496 3300035725 Bacteria 14341
86 Ga0373937_0260545 3300036401 Bacteria 1635
87 Ga0373925_0048863 3300037068 Bacteria 3153
88 Ga0395899_0041899 3300037312 Bacteria 3419
89 Ga0395899_0057048 3300037312 Bacteria 2884
90 Ga0395899_0214251 3300037312 Bacteria 1337
91 Ga0395900_0062729 3300037418 Bacteria 3820
92 Ga0395900_0064089 3300037418 Bacteria 3778
93 Ga0395900_0108796 3300037418 Bacteria 2847
94 Ga0395900_0157023 3300037418 Bacteria 2323
95 Ga0395900_0275986 3300037418 Bacteria 1674
96 Ga0395900_1069386 3300037418 Bacteria 725
97 Ga0395898_0080798 3300037466 Bacteria 3135
98 Ga0395898_0155605 3300037466 Bacteria 2186
99 Ga0395898_0196358 3300037466 Bacteria 1927
100 Ga0395898_0260117 3300037466 Bacteria 1655
101 Ga0395898_0269043 3300037466 Bacteria 1625
102 Ga0395905_0019989 3300037471 Bacteria 6346
103 Ga0395905_0024549 3300037471 Bacteria 5688
104 Ga0395905_0065952 3300037471 Bacteria 3390
105 Ga0395905_0066771 3300037471 Bacteria 3368
106 Ga0395905_0094936 3300037471 Bacteria 2798
107 Ga0395905_0209710 3300037471 Bacteria 1825
108 Ga0395905_0777462 3300037471 Bacteria 860
109 Ga0395905_1528891 3300037471 Bacteria 572
110 Ga0395901_0079016 3300038443 Bacteria 3435
111 Ga0395901_0100614 3300038443 Bacteria 3032
112 Ga0395901_0110204 3300038443 Bacteria 2890
113 Ga0395901_0268899 3300038443 Bacteria 1773
114 Ga0395901_0457834 3300038443 Bacteria 1304
115 Ga0395901_0511777 3300038443 Bacteria 1221
116 Ga0451853_4116710 3300041512 Bacteria 1678
117 Ga0495592_0319818 3300046454 Bacteria 1003
118 Ga0495603_0000246 3300046455 Bacteria 28231
119 Ga0495641_0000977 3300046461 Bacteria 24511
120 Ga0495582_0017322 3300046473 Bacteria 3942
121 Ga0495639_0068536 3300046475 Bacteria 1636
122 Ga0495664_0323956 3300046477 Bacteria 929
123 Ga0495584_0147839 3300046491 Bacteria 1194
124 Ga0495594_0000379 3300046499 Bacteria 22307
125 Ga0495596_0059581 3300046500 Bacteria 1488
126 Ga0495596_0083484 3300046500 Bacteria 1240
127 Ga0495628_0259578 3300046516 Bacteria 1295
128 Ga0495630_0468009 3300046517 Bacteria 966
129 Ga0495644_0097278 3300046523 Bacteria 1113
130 Ga0495666_0042858 3300046526 Bacteria 2187
131 Ga0495622_0059545 3300046557 Bacteria 1768
132 Ga0495667_0005295 3300046559 Bacteria 8721
133 Ga0495656_0136572 3300046615 Bacteria 1172
134 Ga0495588_0003313 3300046674 Bacteria 6989
135 Ga0495647_0278011 3300046681 Bacteria 750
136 Ga0495670_0318677 3300046691 Bacteria 835
137 Ga0495676_0001134 3300047321 Bacteria 22600
138 Ga0495602_0929975 3300048088 Bacteria 577
139 Ga0495614_0227603 3300048089 Bacteria 849
140 Ga0496100_0582367 3300048903 Bacteria 868
141 Ga0496101_0056525 3300048904 Bacteria 2837
142 Ga0496101_0224388 3300048904 Bacteria 1459
143 Ga0496103_0167783 3300048906 Bacteria 1409
144 Ga0496104_0013967 3300048907 Bacteria 7244
145 Ga0496105_0000143 3300048908 Bacteria 47026
146 Ga0496105_0860636 3300048908 Bacteria 685
147 Ga0496106_0097081 3300048909 Bacteria 2281
148 Ga0496106_0312793 3300048909 Bacteria 1260
149 Ga0496107_0157545 3300048910 Bacteria 1682
150 Ga0496108_0001652 3300048911 Bacteria 17680
151 Ga0496108_0007358 3300048911 Bacteria 8924
152 Ga0496108_0254564 3300048911 Unclassified 1528
153 Ga0496108_0315386 3300048911 Bacteria 1363
154 Ga0496109_0067434 3300048912 Bacteria 3278
155 Ga0496109_0584442 3300048912 Bacteria 1052
156 Ga0496109_0748284 3300048912 Bacteria 915
157 Ga0496110_0002191 3300048913 Bacteria 14598
158 Ga0496110_0050942 3300048913 Bacteria 3637
159 Ga0496110_0122597 3300048913 Bacteria 2343
160 Ga0496110_0422249 3300048913 Bacteria 1216
161 Ga0496110_0595994 3300048913 Bacteria 1003
162 Ga0496111_0000131 3300048914 Bacteria 33103
163 Ga0496111_0254504 3300048914 Bacteria 1303
164 Ga0496111_0383918 3300048914 Bacteria 1039
165 Ga0496112_0024160 3300048915 Bacteria 5816
166 Ga0496113_0000240 3300048916 Bacteria 25763
167 Ga0496114_0080029 3300048917 Bacteria 2759
168 Ga0496114_0584682 3300048917 Bacteria 985
169 Ga0496115_0014117 3300048918 Bacteria 6046
170 Ga0501031_0000382 3300049568 Bacteria 25981
171 Ga0501032_0008564 3300049569 Bacteria 7458
172 Ga0501032_0346415 3300049569 Bacteria 957
173 Ga0501033_0008594 3300049570 Bacteria 7903
174 Ga0501033_0101542 3300049570 Bacteria 2098
175 Ga0501034_0276164 3300049571 Bacteria 1620
176 Ga0501036_0003627 3300049572 Bacteria 12347
177 Ga0501036_0013466 3300049572 Bacteria 6797
178 Ga0501037_0003900 3300049573 Bacteria 10822
179 Ga0501037_0031608 3300049573 Bacteria 3909
180 Ga0501038_0008170 3300049574 Bacteria 9629
181 Ga0501038_0084226 3300049574 Bacteria 2675
182 Ga0501039_0013582 3300049575 Bacteria 6228
183 Ga0501039_0128368 3300049575 Bacteria 1989
184 Ga0501040_0003029 3300049576 Bacteria 10892
185 Ga0501040_0014329 3300049576 Bacteria 5223
186 Ga0501040_0767560 3300049576 Bacteria 697
187 Ga0501041_0005398 3300049577 Bacteria 7489
188 Ga0501041_0162895 3300049577 Bacteria 1394
189 Ga0501042_0003267 3300049578 Bacteria 10140
190 Ga0501042_0014414 3300049578 Bacteria 5395
191 Ga0501043_0002605 3300049579 Bacteria 15214
192 Ga0501043_0171090 3300049579 Bacteria 1695
193 Ga0501046_0005915 3300049580 Bacteria 10895
194 Ga0501047_0522716 3300049581 Bacteria 1012
195 Ga0501048_0003310 3300049582 Bacteria 12270
196 Ga0501048_0032999 3300049582 Bacteria 3741
197 Ga0501067_0063162 3300049583 Bacteria 2051
198 Ga0501067_0481060 3300049583 Bacteria 694
199 Ga0501068_0001427 3300049584 Bacteria 12690
200 Ga0501068_0001694 3300049584 Bacteria 11742
201 Ga0501068_0141704 3300049584 Bacteria 1507
202 Ga0501069_0001768 3300049585 Bacteria 10795
203 Ga0501069_0039126 3300049585 Bacteria 2619
204 Ga0501069_0051887 3300049585 Bacteria 2283
205 Ga0501069_0121224 3300049585 Bacteria 1493
206 Ga0501069_0151639 3300049585 Bacteria 1332
207 Ga0501070_0001660 3300049586 Bacteria 19720
208 Ga0501070_0052668 3300049586 Bacteria 3378
209 Ga0501071_0000334 3300049587 Bacteria 22757
210 Ga0501071_0080905 3300049587 Bacteria 2376
211 Ga0501072_0021310 3300049588 Bacteria 5026
212 Ga0501072_0471241 3300049588 Bacteria 994
213 Ga0501073_0003641 3300049589 Bacteria 11583
214 Ga0501074_0001075 3300049590 Bacteria 17840
215 Ga0501074_0081376 3300049590 Bacteria 2322
216 Ga0501074_0260963 3300049590 Bacteria 1232
217 Ga0501075_0010300 3300049591 Bacteria 6569
218 Ga0501075_0017213 3300049591 Bacteria 5218
219 Ga0501076_0002001 3300049592 Bacteria 13941
220 Ga0501076_0015251 3300049592 Bacteria 5805
221 Ga0501076_0371178 3300049592 Bacteria 1176
222 Ga0501077_0004992 3300049593 Bacteria 8043
223 Ga0501077_0012212 3300049593 Bacteria 5377
224 Ga0501253_099733 3300049683 Bacteria 679
225 Ga0501079_0008760 3300049741 Bacteria 7668
226 Ga0501080_0000525 3300049742 Bacteria 30085
227 Ga0501080_0016970 3300049742 Bacteria 6723
228 Ga0501081_0004992 3300049743 Bacteria 8540
229 Ga0501081_0011402 3300049743 Bacteria 5816
230 Ga0501081_0112610 3300049743 Bacteria 1932
231 Ga0501081_0727609 3300049743 Bacteria 745
232 Ga0501081_0776163 3300049743 Bacteria 721
233 Ga0501083_0009026 3300049744 Bacteria 7037
234 Ga0501035_0003502 3300049822 Bacteria 15007
235 Ga0501035_0072505 3300049822 Bacteria 3048
236 Ga0501044_0022641 3300049823 Bacteria 6692
237 Ga0501044_0031769 3300049823 Bacteria 5554
238 Ga0501045_0004848 3300049824 Bacteria 9309
239 Ga0501045_0009464 3300049824 Bacteria 6818
240 Ga0501045_0671202 3300049824 Bacteria 765
241 nmdc:mga0yw44_560444_c1 3300050492 Bacteria 776
242 nmdc:mga05p37_3642_c1 3300050507 Bacteria 18015
243 nmdc:mga05p37_422756_c1 3300050507 Bacteria 1550
244 nmdc:mga09592_382311_c1 3300050508 Bacteria 1217
245 nmdc:mga06r32_117303_c1 3300050510 Bacteria 2623
246 nmdc:mga08y16_97522_c1 3300050511 Bacteria 3061
247 nmdc:mga0n895_3105_c1 3300050512 Bacteria 13232
248 nmdc:mga0rr50_343761_c1 3300050513 Bacteria 1254
249 nmdc:mga0a205_1024756_c1 3300050515 Bacteria 672
250 nmdc:mga0a205_2231_c2 3300050515 Bacteria 13289
251 Ga0501084_0041896 3300054114 Bacteria 3829
252 Ga0501084_0517663 3300054114 Bacteria 1008
253 Ga0587073_0032958 3300059492 Bacteria 1082
254 Ga0587082_026241 3300059504 Bacteria 985
255 Ga0587106_031131 3300059605 Bacteria 857
256 Ga0587099_011675 3300059622 Bacteria 894
257 Ga0587113_012251 3300059625 Bacteria 813
258 Ga0587128_028972 3300059630 Bacteria 905
259 Ga0587114_012738 3300059655 Bacteria 1071
260 Ga0587114_020895 3300059655 Bacteria 922
261 Ga0501082_0010480 3300060353 Bacteria 7976
262 Ga0501082_0010554 3300060353 Bacteria 7950
263 Ga0501082_0207421 3300060353 Bacteria 1705
264 Ga0530510_0008620 3300061734 Bacteria 7123
265 Ga0530510_0074744 3300061734 Bacteria 2460
266 Ga0530510_0340567 3300061734 Bacteria 1126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0005295 Ga0495667_0005295_549_1058 147
2 3300049576 Ga0501040_0767560 Ga0501040_0767560_189_677 153
3 3300034957 Ga0373938_0143732 Ga0373938_0143732_100_618 162
4 3300049585 Ga0501069_0151639 Ga0501069_0151639_19_546 163
5 3300037471 Ga0395905_1528891 Ga0395905_1528891_16_543 168
6 3300048088 Ga0495602_0929975 Ga0495602_0929975_29_565 168
7 3300050507 nmdc:mga05p37_422756_c1 nmdc:mga05p37_422756_c1_988_1530 168
8 3300005937 Ga0081455_10108579 Ga0081455_101085793 170
9 3300049569 Ga0501032_0346415 Ga0501032_0346415_296_835 173
10 3300049570 Ga0501033_0101542 Ga0501033_0101542_174_713 173
11 3300049572 Ga0501036_0003627 Ga0501036_0003627_4044_4583 173
12 3300049573 Ga0501037_0031608 Ga0501037_0031608_105_644 173
13 3300049574 Ga0501038_0084226 Ga0501038_0084226_357_896 173
14 3300049575 Ga0501039_0128368 Ga0501039_0128368_285_824 173
15 3300049576 Ga0501040_0014329 Ga0501040_0014329_180_719 173
16 3300049577 Ga0501041_0162895 Ga0501041_0162895_688_1227 173
17 3300049578 Ga0501042_0014414 Ga0501042_0014414_366_905 173
18 3300049579 Ga0501043_0171090 Ga0501043_0171090_357_896 173
19 3300049582 Ga0501048_0032999 Ga0501048_0032999_1422_1961 173
20 3300049584 Ga0501068_0141704 Ga0501068_0141704_284_823 173
21 3300049585 Ga0501069_0051887 Ga0501069_0051887_1405_1944 173
22 3300049586 Ga0501070_0052668 Ga0501070_0052668_109_648 173
23 3300049587 Ga0501071_0080905 Ga0501071_0080905_885_1424 173
24 3300049590 Ga0501074_0081376 Ga0501074_0081376_528_1067 173
25 3300049591 Ga0501075_0017213 Ga0501075_0017213_611_1150 173
26 3300049592 Ga0501076_0002001 Ga0501076_0002001_4945_5484 173
27 3300049593 Ga0501077_0012212 Ga0501077_0012212_3886_4425 173
28 3300049742 Ga0501080_0016970 Ga0501080_0016970_2444_2983 173
29 3300049743 Ga0501081_0011402 Ga0501081_0011402_1960_2499 173
30 3300049822 Ga0501035_0072505 Ga0501035_0072505_32_571 173
31 3300049823 Ga0501044_0031769 Ga0501044_0031769_4059_4598 173
32 3300049824 Ga0501045_0004848 Ga0501045_0004848_3541_4080 173
33 3300054114 Ga0501084_0517663 Ga0501084_0517663_437_976 173
34 3300060353 Ga0501082_0010554 Ga0501082_0010554_2543_3082 173
35 3300061734 Ga0530510_0074744 Ga0530510_0074744_614_1153 173
36 3300005937 Ga0081455_10147008 Ga0081455_101470083 176
37 3300014325 Ga0163163_10459883 Ga0163163_104598832 176
38 3300025945 Ga0207679_10490611 Ga0207679_104906112 176
39 3300041512 Ga0451853_4116710 Ga0451853_4116710_1013_1582 176
40 3300048911 Ga0496108_0254564 Ga0496108_0254564_401_967 176
41 3300049583 Ga0501067_0063162 Ga0501067_0063162_187_753 176
42 3300049583 Ga0501067_0481060 Ga0501067_0481060_21_587 176
43 3300049584 Ga0501068_0001427 Ga0501068_0001427_1211_1777 176
44 3300049585 Ga0501069_0121224 Ga0501069_0121224_548_1114 176
45 3300049588 Ga0501072_0471241 Ga0501072_0471241_283_840 176
46 3300049590 Ga0501074_0260963 Ga0501074_0260963_24_581 176
47 3300049743 Ga0501081_0727609 Ga0501081_0727609_16_573 176
48 3300060353 Ga0501082_0207421 Ga0501082_0207421_164_721 176
49 3300061734 Ga0530510_0340567 Ga0530510_0340567_169_735 176
50 3300059605 Ga0587106_031131 Ga0587106_031131_167_736 177
51 3300046491 Ga0495584_0147839 Ga0495584_0147839_357_911 179
52 3300037471 Ga0395905_0777462 Ga0395905_0777462_180_746 180
53 3300050515 nmdc:mga0a205_1024756_c1 nmdc:mga0a205_1024756_c1_73_639 181
54 3300005436 Ga0070713_100103915 Ga0070713_1001039155 182
55 3300005440 Ga0070705_100170448 Ga0070705_1001704483 182
56 3300011119 Ga0105246_10172955 Ga0105246_101729552 182
57 3300014325 Ga0163163_10224977 Ga0163163_102249771 182
58 3300020080 Ga0206350_10436137 Ga0206350_104361371 182
59 3300026095 Ga0207676_10017918 Ga0207676_100179182 182
60 3300037312 Ga0395899_0214251 Ga0395899_0214251_16_585 182
61 3300037466 Ga0395898_0269043 Ga0395898_0269043_926_1495 182
62 3300037471 Ga0395905_0209710 Ga0395905_0209710_89_658 182
63 3300038443 Ga0395901_0110204 Ga0395901_0110204_1069_1638 182
64 3300046500 Ga0495596_0059581 Ga0495596_0059581_636_1208 182
65 3300046523 Ga0495644_0097278 Ga0495644_0097278_377_949 182
66 3300048906 Ga0496103_0167783 Ga0496103_0167783_600_1172 182
67 3300048907 Ga0496104_0013967 Ga0496104_0013967_1550_2122 182
68 3300048908 Ga0496105_0000143 Ga0496105_0000143_44266_44838 182
69 3300048909 Ga0496106_0097081 Ga0496106_0097081_268_840 182
70 3300048910 Ga0496107_0157545 Ga0496107_0157545_426_998 182
71 3300048911 Ga0496108_0001652 Ga0496108_0001652_4177_4749 182
72 3300048912 Ga0496109_0584442 Ga0496109_0584442_290_862 182
73 3300048913 Ga0496110_0002191 Ga0496110_0002191_4190_4762 182
74 3300048914 Ga0496111_0000131 Ga0496111_0000131_5763_6335 182
75 3300048915 Ga0496112_0024160 Ga0496112_0024160_4201_4773 182
76 3300048916 Ga0496113_0000240 Ga0496113_0000240_20991_21563 182
77 3300048917 Ga0496114_0080029 Ga0496114_0080029_1208_1780 182
78 3300048918 Ga0496115_0014117 Ga0496115_0014117_1299_1871 182
79 3300049683 Ga0501253_099733 Ga0501253_099733_58_642 182
80 3300003373 JGI25407J50210_10001952 JGI25407J50210_100019523 183
81 3300003373 JGI25407J50210_10014755 JGI25407J50210_100147552 183
82 3300005329 Ga0070683_100005028 Ga0070683_10000502814 183
83 3300005329 Ga0070683_100365303 Ga0070683_1003653032 183
84 3300005335 Ga0070666_10305847 Ga0070666_103058471 183
85 3300005341 Ga0070691_10130791 Ga0070691_101307913 183
86 3300005343 Ga0070687_100257650 Ga0070687_1002576502 183
87 3300005343 Ga0070687_100800161 Ga0070687_1008001611 183
88 3300005344 Ga0070661_100835033 Ga0070661_1008350331 183
89 3300005347 Ga0070668_100821590 Ga0070668_1008215902 183
90 3300005355 Ga0070671_100308087 Ga0070671_1003080872 183
91 3300005434 Ga0070709_10036489 Ga0070709_100364895 183
92 3300005436 Ga0070713_100009838 Ga0070713_1000098384 183
93 3300005455 Ga0070663_100412828 Ga0070663_1004128282 183
94 3300005535 Ga0070684_100007921 Ga0070684_1000079214 183
95 3300005544 Ga0070686_100071406 Ga0070686_1000714064 183
96 3300005546 Ga0070696_100161922 Ga0070696_1001619223 183
97 3300005547 Ga0070693_100016082 Ga0070693_1000160823 183
98 3300005549 Ga0070704_100446183 Ga0070704_1004461832 183
99 3300005564 Ga0070664_100066121 Ga0070664_1000661214 183
100 3300005577 Ga0068857_100006898 Ga0068857_1000068982 183
101 3300005578 Ga0068854_100660345 Ga0068854_1006603452 183
102 3300005614 Ga0068856_100054886 Ga0068856_1000548865 183
103 3300005614 Ga0068856_100484641 Ga0068856_1004846412 183
104 3300005615 Ga0070702_100275033 Ga0070702_1002750332 183
105 3300005937 Ga0081455_10007255 Ga0081455_1000725514 183
106 3300005937 Ga0081455_10017144 Ga0081455_1001714410 183
107 3300005937 Ga0081455_10035603 Ga0081455_100356032 183
108 3300005981 Ga0081538_10000194 Ga0081538_1000019441 183
109 3300005981 Ga0081538_10118759 Ga0081538_101187592 183
110 3300006038 Ga0075365_10360994 Ga0075365_103609942 183
111 3300006844 Ga0075428_100007970 Ga0075428_1000079705 183
112 3300006847 Ga0075431_100201038 Ga0075431_1002010384 183
113 3300006852 Ga0075433_10021924 Ga0075433_100219243 183
114 3300006871 Ga0075434_100000261 Ga0075434_10000026117 183
115 3300006880 Ga0075429_100328614 Ga0075429_1003286142 183
116 3300007076 Ga0075435_100078243 Ga0075435_1000782433 183
117 3300007076 Ga0075435_100421392 Ga0075435_1004213923 183
118 3300009094 Ga0111539_10058946 Ga0111539_100589464 183
119 3300009094 Ga0111539_10407419 Ga0111539_104074193 183
120 3300009098 Ga0105245_10537682 Ga0105245_105376824 183
121 3300009147 Ga0114129_10005909 Ga0114129_1000590913 183
122 3300009147 Ga0114129_10175914 Ga0114129_101759145 183
123 3300009147 Ga0114129_12343724 Ga0114129_123437241 183
124 3300009177 Ga0105248_10758084 Ga0105248_107580842 183
125 3300009551 Ga0105238_10291806 Ga0105238_102918062 183
126 3300010375 Ga0105239_10042310 Ga0105239_100423105 183
127 3300013102 Ga0157371_10261145 Ga0157371_102611452 183
128 3300013307 Ga0157372_10182292 Ga0157372_101822925 183
129 3300013308 Ga0157375_10261016 Ga0157375_102610164 183
130 3300025893 Ga0207682_10074181 Ga0207682_100741811 183
131 3300025906 Ga0207699_10010551 Ga0207699_100105512 183
132 3300025911 Ga0207654_10192635 Ga0207654_101926351 183
133 3300025919 Ga0207657_10140050 Ga0207657_101400504 183
134 3300025924 Ga0207694_10324054 Ga0207694_103240542 183
135 3300025927 Ga0207687_10090091 Ga0207687_100900913 183
136 3300025928 Ga0207700_10000002 Ga0207700_10000002799 183
137 3300025938 Ga0207704_10592658 Ga0207704_105926582 183
138 3300025941 Ga0207711_10531916 Ga0207711_105319162 183
139 3300025944 Ga0207661_10024254 Ga0207661_100242546 183
140 3300025945 Ga0207679_10771192 Ga0207679_107711922 183
141 3300026075 Ga0207708_10069615 Ga0207708_100696152 183
142 3300026078 Ga0207702_10024536 Ga0207702_100245365 183
143 3300026078 Ga0207702_10585234 Ga0207702_105852342 183
144 3300026116 Ga0207674_10002594 Ga0207674_1000259413 183
145 3300027907 Ga0207428_10314227 Ga0207428_103142273 183
146 3300032002 Ga0307416_100309267 Ga0307416_1003092672 183
147 3300035083 Ga0373926_0100333 Ga0373926_0100333_214_795 183
148 3300035116 Ga0373945_0056455 Ga0373945_0056455_496_1077 183
149 3300035170 Ga0373943_0004098 Ga0373943_0004098_439_1020 183
150 3300035171 Ga0373946_0168919 Ga0373946_0168919_131_712 183
151 3300035692 Ga0373935_0087530 Ga0373935_0087530_507_1088 183
152 3300035695 Ga0373927_0260304 Ga0373927_0260304_263_844 183
153 3300035725 Ga0373947_0001496 Ga0373947_0001496_7550_8131 183
154 3300036401 Ga0373937_0260545 Ga0373937_0260545_269_853 183
155 3300037068 Ga0373925_0048863 Ga0373925_0048863_1390_1971 183
156 3300037312 Ga0395899_0041899 Ga0395899_0041899_1555_2106 183
157 3300037312 Ga0395899_0057048 Ga0395899_0057048_1610_2212 183
158 3300037418 Ga0395900_0062729 Ga0395900_0062729_222_824 183
159 3300037418 Ga0395900_0064089 Ga0395900_0064089_462_1040 183
160 3300037418 Ga0395900_0108796 Ga0395900_0108796_834_1385 183
161 3300037418 Ga0395900_0157023 Ga0395900_0157023_1346_1918 183
162 3300037418 Ga0395900_0275986 Ga0395900_0275986_445_1002 183
163 3300037418 Ga0395900_1069386 Ga0395900_1069386_98_691 183
164 3300037466 Ga0395898_0080798 Ga0395898_0080798_1123_1725 183
165 3300037466 Ga0395898_0155605 Ga0395898_0155605_1254_1805 183
166 3300037466 Ga0395898_0196358 Ga0395898_0196358_1326_1907 183
167 3300037466 Ga0395898_0260117 Ga0395898_0260117_381_962 183
168 3300037471 Ga0395905_0019989 Ga0395905_0019989_85_681 183
169 3300037471 Ga0395905_0024549 Ga0395905_0024549_130_711 183
170 3300037471 Ga0395905_0065952 Ga0395905_0065952_808_1410 183
171 3300037471 Ga0395905_0066771 Ga0395905_0066771_1846_2397 183
172 3300037471 Ga0395905_0094936 Ga0395905_0094936_2119_2676 183
173 3300038443 Ga0395901_0079016 Ga0395901_0079016_2589_3161 183
174 3300038443 Ga0395901_0100614 Ga0395901_0100614_1738_2340 183
175 3300038443 Ga0395901_0268899 Ga0395901_0268899_782_1339 183
176 3300038443 Ga0395901_0457834 Ga0395901_0457834_540_1133 183
177 3300038443 Ga0395901_0511777 Ga0395901_0511777_355_906 183
178 3300046454 Ga0495592_0319818 Ga0495592_0319818_31_615 183
179 3300046455 Ga0495603_0000246 Ga0495603_0000246_11433_12014 183
180 3300046461 Ga0495641_0000977 Ga0495641_0000977_6831_7412 183
181 3300046473 Ga0495582_0017322 Ga0495582_0017322_2823_3404 183
182 3300046475 Ga0495639_0068536 Ga0495639_0068536_105_686 183
183 3300046477 Ga0495664_0323956 Ga0495664_0323956_200_784 183
184 3300046499 Ga0495594_0000379 Ga0495594_0000379_15027_15608 183
185 3300046500 Ga0495596_0083484 Ga0495596_0083484_171_722 183
186 3300046516 Ga0495628_0259578 Ga0495628_0259578_52_636 183
187 3300046517 Ga0495630_0468009 Ga0495630_0468009_262_846 183
188 3300046526 Ga0495666_0042858 Ga0495666_0042858_1161_1742 183
189 3300046557 Ga0495622_0059545 Ga0495622_0059545_1107_1688 183
190 3300046615 Ga0495656_0136572 Ga0495656_0136572_499_1077 183
191 3300046674 Ga0495588_0003313 Ga0495588_0003313_2112_2693 183
192 3300046681 Ga0495647_0278011 Ga0495647_0278011_159_740 183
193 3300046691 Ga0495670_0318677 Ga0495670_0318677_90_668 183
194 3300047321 Ga0495676_0001134 Ga0495676_0001134_6675_7256 183
195 3300048089 Ga0495614_0227603 Ga0495614_0227603_211_792 183
196 3300048903 Ga0496100_0582367 Ga0496100_0582367_214_804 183
197 3300048904 Ga0496101_0056525 Ga0496101_0056525_85_666 183
198 3300048904 Ga0496101_0224388 Ga0496101_0224388_466_1041 183
199 3300048908 Ga0496105_0860636 Ga0496105_0860636_59_640 183
200 3300048909 Ga0496106_0312793 Ga0496106_0312793_509_1090 183
201 3300048911 Ga0496108_0007358 Ga0496108_0007358_6025_6606 183
202 3300048911 Ga0496108_0315386 Ga0496108_0315386_323_907 183
203 3300048912 Ga0496109_0067434 Ga0496109_0067434_579_1163 183
204 3300048912 Ga0496109_0748284 Ga0496109_0748284_216_800 183
205 3300048913 Ga0496110_0050942 Ga0496110_0050942_1021_1611 183
206 3300048913 Ga0496110_0122597 Ga0496110_0122597_222_803 183
207 3300048913 Ga0496110_0422249 Ga0496110_0422249_611_1195 183
208 3300048913 Ga0496110_0595994 Ga0496110_0595994_181_765 183
209 3300048914 Ga0496111_0254504 Ga0496111_0254504_104_685 183
210 3300048914 Ga0496111_0383918 Ga0496111_0383918_291_875 183
211 3300048917 Ga0496114_0584682 Ga0496114_0584682_20_601 183
212 3300049568 Ga0501031_0000382 Ga0501031_0000382_17185_17736 183
213 3300049569 Ga0501032_0008564 Ga0501032_0008564_5344_5895 183
214 3300049570 Ga0501033_0008594 Ga0501033_0008594_6993_7544 183
215 3300049571 Ga0501034_0276164 Ga0501034_0276164_160_711 183
216 3300049572 Ga0501036_0013466 Ga0501036_0013466_4880_5431 183
217 3300049573 Ga0501037_0003900 Ga0501037_0003900_4167_4718 183
218 3300049574 Ga0501038_0008170 Ga0501038_0008170_7712_8263 183
219 3300049575 Ga0501039_0013582 Ga0501039_0013582_356_907 183
220 3300049576 Ga0501040_0003029 Ga0501040_0003029_4576_5127 183
221 3300049577 Ga0501041_0005398 Ga0501041_0005398_1629_2180 183
222 3300049578 Ga0501042_0003267 Ga0501042_0003267_8095_8646 183
223 3300049579 Ga0501043_0002605 Ga0501043_0002605_10497_11048 183
224 3300049580 Ga0501046_0005915 Ga0501046_0005915_4262_4813 183
225 3300049581 Ga0501047_0522716 Ga0501047_0522716_435_986 183
226 3300049582 Ga0501048_0003310 Ga0501048_0003310_10353_10904 183
227 3300049584 Ga0501068_0001694 Ga0501068_0001694_3476_4027 183
228 3300049585 Ga0501069_0001768 Ga0501069_0001768_651_1202 183
229 3300049585 Ga0501069_0039126 Ga0501069_0039126_1768_2358 183
230 3300049586 Ga0501070_0001660 Ga0501070_0001660_7074_7625 183
231 3300049587 Ga0501071_0000334 Ga0501071_0000334_14112_14663 183
232 3300049588 Ga0501072_0021310 Ga0501072_0021310_1681_2232 183
233 3300049589 Ga0501073_0003641 Ga0501073_0003641_7052_7603 183
234 3300049590 Ga0501074_0001075 Ga0501074_0001075_5322_5873 183
235 3300049591 Ga0501075_0010300 Ga0501075_0010300_1553_2104 183
236 3300049592 Ga0501076_0015251 Ga0501076_0015251_4899_5450 183
237 3300049592 Ga0501076_0371178 Ga0501076_0371178_425_1009 183
238 3300049593 Ga0501077_0004992 Ga0501077_0004992_538_1089 183
239 3300049741 Ga0501079_0008760 Ga0501079_0008760_1808_2359 183
240 3300049742 Ga0501080_0000525 Ga0501080_0000525_21358_21909 183
241 3300049743 Ga0501081_0004992 Ga0501081_0004992_3510_4061 183
242 3300049743 Ga0501081_0112610 Ga0501081_0112610_721_1272 183
243 3300049743 Ga0501081_0776163 Ga0501081_0776163_11_571 183
244 3300049744 Ga0501083_0009026 Ga0501083_0009026_5242_5793 183
245 3300049822 Ga0501035_0003502 Ga0501035_0003502_1745_2296 183
246 3300049823 Ga0501044_0022641 Ga0501044_0022641_1494_2045 183
247 3300049824 Ga0501045_0009464 Ga0501045_0009464_5940_6491 183
248 3300049824 Ga0501045_0671202 Ga0501045_0671202_142_726 183
249 3300050492 nmdc:mga0yw44_560444_c1 nmdc:mga0yw44_560444_c1_138_719 183
250 3300050507 nmdc:mga05p37_3642_c1 nmdc:mga05p37_3642_c1_7148_7699 183
251 3300050508 nmdc:mga09592_382311_c1 nmdc:mga09592_382311_c1_369_947 183
252 3300050510 nmdc:mga06r32_117303_c1 nmdc:mga06r32_117303_c1_655_1206 183
253 3300050511 nmdc:mga08y16_97522_c1 nmdc:mga08y16_97522_c1_1169_1750 183
254 3300050512 nmdc:mga0n895_3105_c1 nmdc:mga0n895_3105_c1_7641_8225 183
255 3300050513 nmdc:mga0rr50_343761_c1 nmdc:mga0rr50_343761_c1_112_702 183
256 3300050515 nmdc:mga0a205_2231_c2 nmdc:mga0a205_2231_c2_2693_3277 183
257 3300054114 Ga0501084_0041896 Ga0501084_0041896_2923_3474 183
258 3300059492 Ga0587073_0032958 Ga0587073_0032958_204_794 183
259 3300059504 Ga0587082_026241 Ga0587082_026241_316_897 183
260 3300059622 Ga0587099_011675 Ga0587099_011675_126_716 183
261 3300059625 Ga0587113_012251 Ga0587113_012251_163_753 183
262 3300059630 Ga0587128_028972 Ga0587128_028972_184_774 183
263 3300059655 Ga0587114_012738 Ga0587114_012738_159_749 183
264 3300059655 Ga0587114_020895 Ga0587114_020895_43_633 183
265 3300060353 Ga0501082_0010480 Ga0501082_0010480_484_1035 183
266 3300061734 Ga0530510_0008620 Ga0530510_0008620_484_1035 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

8

176

0.99

PF00117

GATase

Glutamine amidotransferase class-I

39

156

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9803 4 177
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9564 8 172
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9547 7 172
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9546 8 172
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9504 8 172
ID Description Score Start End Superfamily
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9746 4 177 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9546 8 172 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9454 6 172 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9423 4 177 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9377 8 172 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A3F2V1W1-F1-model_v4 Type 1 glutamine amidotransferase 0.9962 2 174 GO:0016740
AF-A0A6J4KWU9-F1-model_v4 Intracellular protease 0.9961 3 174 GO:0006508
GO:0008233
AF-Q0C397-F1-model_v4 Intracellular protease, PfpI family 0.996 2 173 GO:0006508
GO:0008233
AF-A0A346Y3S2-F1-model_v4 ThiJ/PfpI family protein 0.9959 4 174
AF-A0A6I4UD63-F1-model_v4 DJ-1/PfpI/YhbO family deglycase/protease 0.9959 4 176 GO:0006508
GO:0008233

Feature Viewer

pLDDT pTM Quality
96.17 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map