F374098
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 169 | 254 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10136232|Ga0157380_101362323 |
| Length | 280 |
| Sequence | LDGEFGELTSEQADILQRIESYKREEIAAAKTLRPWNEVVAEAHDAPPVRRFLSALKKKRDSGDFALIAEVKKASPSKGLIRPDFNPSEIARAYELGGAACLSVLTDRPSFQGAPNYLIEARAATGLPVLRKDFMFETYQVAEARAWGADCILIILAAVGDDTARYLLDAAEEWRMDALVEVHDQIELDRALALDAEFIGINNRNLRTFETTLQTSVDLALGIPRNVHLVAESGIANYADVTKLHDTAGIGTFLVGESLMRQADVTKATQLLLWGDKGRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 2 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 3 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 4 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 5 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 6 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 7 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 8 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 9 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 10 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 11 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 12 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 107 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 121 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 122 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 123 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 124 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 128 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 129 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 130 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 131 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 135 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 136 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 137 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 138 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 139 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 140 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 155 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 164 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 165 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 166 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 167 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 168 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.11 |
| Metatranscriptomes | 0.38 |
| Isolates | 4.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.26 |
| Nodule | 0.75 |
| Rhizoplane | 3.76 |
| Rhizosphere | 84.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10022614 | 3300003320 | Bacteria | 18271 |
| 2 | rootH1_10052655 | 3300003323 | Bacteria | 2604 |
| 3 | Ga0070658_10082588 | 3300005327 | Bacteria | 2640 |
| 4 | Ga0070658_10103713 | 3300005327 | Bacteria | 2352 |
| 5 | Ga0070670_100441093 | 3300005331 | Bacteria | 1153 |
| 6 | Ga0068869_100057534 | 3300005334 | Bacteria | 2839 |
| 7 | Ga0070680_100068517 | 3300005336 | Bacteria | 2913 |
| 8 | Ga0070682_100004622 | 3300005337 | Bacteria | 7649 |
| 9 | Ga0070660_100002968 | 3300005339 | Bacteria | 11672 |
| 10 | Ga0070660_100052066 | 3300005339 | Bacteria | 3155 |
| 11 | Ga0070660_100053205 | 3300005339 | Bacteria | 3122 |
| 12 | Ga0070661_100012312 | 3300005344 | Bacteria | 5982 |
| 13 | Ga0070661_100031635 | 3300005344 | Bacteria | 3827 |
| 14 | Ga0070661_100054787 | 3300005344 | Bacteria | 2921 |
| 15 | Ga0070661_100068284 | 3300005344 | Bacteria | 2612 |
| 16 | Ga0070692_10189095 | 3300005345 | Bacteria | 1198 |
| 17 | Ga0070674_100004416 | 3300005356 | Bacteria | 8018 |
| 18 | Ga0070673_100211124 | 3300005364 | Bacteria | 1676 |
| 19 | Ga0070659_100055487 | 3300005366 | Bacteria | 3123 |
| 20 | Ga0070659_100276970 | 3300005366 | Bacteria | 1395 |
| 21 | Ga0070659_100382216 | 3300005366 | Bacteria | 1186 |
| 22 | Ga0070659_100449780 | 3300005366 | Bacteria | 1092 |
| 23 | Ga0070667_100114131 | 3300005367 | Bacteria | 2345 |
| 24 | Ga0070667_100721766 | 3300005367 | Bacteria | 923 |
| 25 | Ga0070705_100012284 | 3300005440 | Bacteria | 4350 |
| 26 | Ga0070663_100010838 | 3300005455 | Bacteria | 5695 |
| 27 | Ga0070678_100121018 | 3300005456 | Bacteria | 2064 |
| 28 | Ga0070681_10246537 | 3300005458 | Bacteria | 1699 |
| 29 | Ga0068853_100020831 | 3300005539 | Bacteria | 5455 |
| 30 | Ga0068853_100021007 | 3300005539 | Bacteria | 5435 |
| 31 | Ga0068853_100056516 | 3300005539 | Bacteria | 3384 |
| 32 | Ga0068853_100113097 | 3300005539 | Bacteria | 2413 |
| 33 | Ga0068853_100207522 | 3300005539 | Bacteria | 1785 |
| 34 | Ga0070695_100008996 | 3300005545 | Bacteria | 5935 |
| 35 | Ga0070696_100022622 | 3300005546 | Bacteria | 4272 |
| 36 | Ga0070693_100034509 | 3300005547 | Bacteria | 2799 |
| 37 | Ga0070693_100197264 | 3300005547 | Bacteria | 1305 |
| 38 | Ga0070665_100074548 | 3300005548 | Bacteria | 3399 |
| 39 | Ga0070704_100103592 | 3300005549 | Bacteria | 2150 |
| 40 | Ga0068855_100127544 | 3300005563 | Bacteria | 2908 |
| 41 | Ga0068855_100139516 | 3300005563 | Bacteria | 2765 |
| 42 | Ga0068855_100213599 | 3300005563 | Bacteria | 2167 |
| 43 | Ga0068855_100267926 | 3300005563 | Bacteria | 1900 |
| 44 | Ga0070664_100073809 | 3300005564 | Bacteria | 2928 |
| 45 | Ga0068854_100011271 | 3300005578 | Bacteria | 5813 |
| 46 | Ga0068854_100021101 | 3300005578 | Bacteria | 4417 |
| 47 | Ga0068854_100088365 | 3300005578 | Bacteria | 2301 |
| 48 | Ga0068856_100082111 | 3300005614 | Bacteria | 3198 |
| 49 | Ga0068856_100084801 | 3300005614 | Bacteria | 3147 |
| 50 | Ga0068856_100413408 | 3300005614 | Bacteria | 1369 |
| 51 | Ga0068852_100003997 | 3300005616 | Bacteria | 10368 |
| 52 | Ga0068852_100015070 | 3300005616 | Bacteria | 5980 |
| 53 | Ga0068852_100136214 | 3300005616 | Bacteria | 2267 |
| 54 | Ga0068852_100239922 | 3300005616 | Bacteria | 1732 |
| 55 | Ga0068851_10004462 | 3300005834 | Bacteria | 6314 |
| 56 | Ga0068851_10053981 | 3300005834 | Bacteria | 2046 |
| 57 | Ga0081455_10024174 | 3300005937 | Bacteria | 5635 |
| 58 | Ga0075365_10037642 | 3300006038 | Bacteria | 3141 |
| 59 | Ga0075362_10006745 | 3300006177 | Bacteria | 4291 |
| 60 | Ga0075367_10063303 | 3300006178 | Bacteria | 2211 |
| 61 | Ga0075370_10033198 | 3300006353 | Bacteria | 2888 |
| 62 | Ga0075428_100241356 | 3300006844 | Bacteria | 1949 |
| 63 | Ga0075428_100788265 | 3300006844 | Bacteria | 1010 |
| 64 | Ga0075431_100208081 | 3300006847 | Bacteria | 1999 |
| 65 | Ga0075434_100268009 | 3300006871 | Bacteria | 1727 |
| 66 | Ga0075434_100601349 | 3300006871 | Bacteria | 1119 |
| 67 | Ga0075429_100077534 | 3300006880 | Bacteria | 2895 |
| 68 | Ga0079104_1000209 | 3300006946 | Bacteria | 81844 |
| 69 | Ga0105240_10032467 | 3300009093 | Bacteria | 6759 |
| 70 | Ga0114129_10000549 | 3300009147 | Bacteria | 45986 |
| 71 | Ga0114129_10036520 | 3300009147 | Bacteria | 6937 |
| 72 | Ga0114129_10128017 | 3300009147 | Bacteria | 3490 |
| 73 | Ga0114129_10316924 | 3300009147 | Bacteria | 2074 |
| 74 | Ga0105241_10235582 | 3300009174 | Bacteria | 1545 |
| 75 | Ga0105241_10320095 | 3300009174 | Bacteria | 1337 |
| 76 | Ga0105241_10417043 | 3300009174 | Bacteria | 1181 |
| 77 | Ga0105237_10000301 | 3300009545 | Bacteria | 68372 |
| 78 | Ga0105238_10137529 | 3300009551 | Bacteria | 2420 |
| 79 | Ga0105239_10001991 | 3300010375 | Bacteria | 26554 |
| 80 | Ga0105239_10006926 | 3300010375 | Bacteria | 13076 |
| 81 | Ga0105239_10050725 | 3300010375 | Bacteria | 4550 |
| 82 | Ga0105239_10074143 | 3300010375 | Bacteria | 3742 |
| 83 | Ga0105246_10357383 | 3300011119 | Bacteria | 1199 |
| 84 | Ga0157373_10013660 | 3300013100 | Bacteria | 5954 |
| 85 | Ga0157373_10102268 | 3300013100 | Bacteria | 2016 |
| 86 | Ga0157371_10228976 | 3300013102 | Bacteria | 1336 |
| 87 | Ga0157370_10182314 | 3300013104 | Bacteria | 1951 |
| 88 | Ga0157369_10084592 | 3300013105 | Bacteria | 3391 |
| 89 | Ga0157374_10297908 | 3300013296 | Bacteria | 1595 |
| 90 | Ga0157372_10451132 | 3300013307 | Bacteria | 1499 |
| 91 | Ga0163163_10129639 | 3300014325 | Bacteria | 2562 |
| 92 | Ga0163163_10178898 | 3300014325 | Bacteria | 2168 |
| 93 | Ga0157380_10136232 | 3300014326 | Bacteria | 2102 |
| 94 | Ga0206356_11812984 | 3300020070 | Bacteria | 1881 |
| 95 | Ga0207427_107497 | 3300025231 | Bacteria | 1276 |
| 96 | Ga0209233_1000639 | 3300025261 | Bacteria | 17464 |
| 97 | Ga0209758_1041629 | 3300025297 | Bacteria | 1715 |
| 98 | Ga0207656_10023639 | 3300025321 | Bacteria | 2477 |
| 99 | Ga0207656_10051077 | 3300025321 | Bacteria | 1787 |
| 100 | Ga0207647_10105001 | 3300025904 | Bacteria | 1674 |
| 101 | Ga0207643_10130695 | 3300025908 | Bacteria | 1494 |
| 102 | Ga0207705_10030745 | 3300025909 | Bacteria | 3832 |
| 103 | Ga0207705_10054246 | 3300025909 | Bacteria | 2889 |
| 104 | Ga0207654_10095828 | 3300025911 | Bacteria | 1818 |
| 105 | Ga0207654_10100749 | 3300025911 | Bacteria | 1779 |
| 106 | Ga0207654_10156085 | 3300025911 | Bacteria | 1470 |
| 107 | Ga0207707_10200390 | 3300025912 | Bacteria | 1740 |
| 108 | Ga0207695_10053895 | 3300025913 | Bacteria | 4204 |
| 109 | Ga0207671_10000227 | 3300025914 | Bacteria | 84794 |
| 110 | Ga0207660_10122018 | 3300025917 | Bacteria | 1974 |
| 111 | Ga0207657_10000991 | 3300025919 | Bacteria | 30156 |
| 112 | Ga0207657_10006142 | 3300025919 | Bacteria | 12485 |
| 113 | Ga0207657_10059028 | 3300025919 | Bacteria | 3299 |
| 114 | Ga0207657_10092444 | 3300025919 | Bacteria | 2521 |
| 115 | Ga0207649_10004184 | 3300025920 | Bacteria | 7858 |
| 116 | Ga0207649_10019344 | 3300025920 | Bacteria | 3890 |
| 117 | Ga0207652_10113829 | 3300025921 | Bacteria | 2401 |
| 118 | Ga0207694_10241536 | 3300025924 | Bacteria | 1476 |
| 119 | Ga0207690_10061409 | 3300025932 | Bacteria | 2555 |
| 120 | Ga0207669_10123612 | 3300025937 | Bacteria | 1762 |
| 121 | Ga0207691_10018213 | 3300025940 | Bacteria | 6652 |
| 122 | Ga0207689_10044638 | 3300025942 | Bacteria | 3665 |
| 123 | Ga0207667_10002734 | 3300025949 | Bacteria | 21808 |
| 124 | Ga0207667_10018876 | 3300025949 | Bacteria | 7716 |
| 125 | Ga0207667_10193027 | 3300025949 | Bacteria | 2089 |
| 126 | Ga0207667_10205122 | 3300025949 | Bacteria | 2022 |
| 127 | Ga0207668_10259260 | 3300025972 | Bacteria | 1416 |
| 128 | Ga0207640_10017718 | 3300025981 | Bacteria | 4173 |
| 129 | Ga0207640_10157085 | 3300025981 | Bacteria | 1678 |
| 130 | Ga0207640_10208567 | 3300025981 | Bacteria | 1487 |
| 131 | Ga0207639_10000957 | 3300026041 | Bacteria | 19589 |
| 132 | Ga0207639_10015119 | 3300026041 | Bacteria | 5438 |
| 133 | Ga0207639_10137375 | 3300026041 | Bacteria | 2032 |
| 134 | Ga0207639_10534240 | 3300026041 | Bacteria | 1075 |
| 135 | Ga0207678_10000100 | 3300026067 | Bacteria | 70537 |
| 136 | Ga0207678_10423439 | 3300026067 | Bacteria | 1155 |
| 137 | Ga0207702_10016053 | 3300026078 | Bacteria | 6201 |
| 138 | Ga0207702_10056102 | 3300026078 | Bacteria | 3343 |
| 139 | Ga0207702_10143068 | 3300026078 | Bacteria | 2167 |
| 140 | Ga0207702_10363753 | 3300026078 | Bacteria | 1387 |
| 141 | Ga0207648_10017394 | 3300026089 | Bacteria | 6541 |
| 142 | Ga0207676_10151313 | 3300026095 | Bacteria | 1999 |
| 143 | Ga0207674_10027209 | 3300026116 | Bacteria | 6055 |
| 144 | Ga0207674_10038100 | 3300026116 | Bacteria | 4995 |
| 145 | Ga0207683_10085077 | 3300026121 | Bacteria | 2811 |
| 146 | Ga0207698_10024853 | 3300026142 | Bacteria | 4210 |
| 147 | Ga0207698_10460936 | 3300026142 | Bacteria | 1229 |
| 148 | Ga0209281_1000374 | 3300027111 | Bacteria | 71684 |
| 149 | Ga0209974_10079997 | 3300027876 | Bacteria | 1123 |
| 150 | Ga0268266_10001992 | 3300028379 | Bacteria | 22881 |
| 151 | Ga0268266_10077196 | 3300028379 | Bacteria | 2896 |
| 152 | Ga0268266_10224779 | 3300028379 | Bacteria | 1727 |
| 153 | Ga0265334_10105275 | 3300028573 | Bacteria | 1018 |
| 154 | Ga0265338_10016042 | 3300028800 | Bacteria | 8183 |
| 155 | Ga0265332_10087543 | 3300031238 | Bacteria | 1319 |
| 156 | Ga0265325_10007193 | 3300031241 | Bacteria | 6695 |
| 157 | Ga0265325_10015955 | 3300031241 | Bacteria | 4208 |
| 158 | Ga0265340_10101413 | 3300031247 | Bacteria | 1337 |
| 159 | Ga0265340_10135632 | 3300031247 | Bacteria | 1127 |
| 160 | Ga0265339_10005568 | 3300031249 | Bacteria | 8373 |
| 161 | Ga0265339_10006469 | 3300031249 | Bacteria | 7681 |
| 162 | Ga0265331_10102455 | 3300031250 | Bacteria | 1316 |
| 163 | Ga0265313_10000121 | 3300031595 | Bacteria | 78280 |
| 164 | Ga0265314_10077124 | 3300031711 | Bacteria | 2212 |
| 165 | Ga0265314_10104281 | 3300031711 | Bacteria | 1816 |
| 166 | Ga0316578_10092039 | 3300031728 | Bacteria | 1812 |
| 167 | Ga0307414_10109037 | 3300032004 | Bacteria | 2102 |
| 168 | Ga0373931_0034148 | 3300035691 | Bacteria | 2639 |
| 169 | Ga0373931_0147184 | 3300035691 | Unclassified | 1370 |
| 170 | Ga0395899_0036205 | 3300037312 | Bacteria | 3702 |
| 171 | Ga0395899_0060604 | 3300037312 | Bacteria | 2788 |
| 172 | Ga0395900_0031520 | 3300037418 | Bacteria | 5448 |
| 173 | Ga0395900_0169476 | 3300037418 | Bacteria | 2223 |
| 174 | Ga0395898_0173556 | 3300037466 | Bacteria | 2060 |
| 175 | Ga0395898_0331542 | 3300037466 | Bacteria | 1451 |
| 176 | Ga0395898_0427156 | 3300037466 | Bacteria | 1262 |
| 177 | Ga0395905_0195034 | 3300037471 | Bacteria | 1899 |
| 178 | Ga0395901_0105911 | 3300038443 | Bacteria | 2951 |
| 179 | Ga0436363_0818450 | 3300039450 | Bacteria | 2850 |
| 180 | Ga0439465_0092665 | 3300041413 | Bacteria | 1035 |
| 181 | Ga0439432_084479 | 3300042006 | Bacteria | 959 |
| 182 | Ga0451577_0732439 | 3300042876 | Bacteria | 895 |
| 183 | Ga0495654_0004235 | 3300046530 | Bacteria | 8574 |
| 184 | Ga0495686_0175270 | 3300047472 | Bacteria | 1245 |
| 185 | Ga0496100_0050719 | 3300048903 | Bacteria | 2690 |
| 186 | Ga0496102_0046856 | 3300048905 | Bacteria | 3927 |
| 187 | Ga0496103_0002057 | 3300048906 | Bacteria | 12872 |
| 188 | Ga0496104_0182285 | 3300048907 | Bacteria | 2010 |
| 189 | Ga0496105_0035176 | 3300048908 | Bacteria | 4122 |
| 190 | Ga0496106_0016953 | 3300048909 | Bacteria | 5391 |
| 191 | Ga0496107_0015395 | 3300048910 | Bacteria | 5359 |
| 192 | Ga0496108_0260347 | 3300048911 | Bacteria | 1510 |
| 193 | Ga0496114_0023607 | 3300048917 | Bacteria | 5020 |
| 194 | Ga0496115_0061807 | 3300048918 | Bacteria | 3021 |
| 195 | Ga0496121_0121812 | 3300048924 | Bacteria | 1969 |
| 196 | Ga0496121_0169900 | 3300048924 | Bacteria | 1585 |
| 197 | Ga0496124_0045346 | 3300048927 | Bacteria | 3769 |
| 198 | Ga0496125_0051478 | 3300048928 | Bacteria | 3396 |
| 199 | Ga0496126_0067318 | 3300048929 | Bacteria | 3200 |
| 200 | Ga0501032_0002955 | 3300049569 | Bacteria | 13201 |
| 201 | Ga0501033_0051092 | 3300049570 | Bacteria | 3064 |
| 202 | Ga0501034_0000077 | 3300049571 | Bacteria | 173873 |
| 203 | Ga0501034_0003327 | 3300049571 | Bacteria | 18346 |
| 204 | Ga0501034_0137530 | 3300049571 | Bacteria | 2423 |
| 205 | Ga0501034_0167645 | 3300049571 | Bacteria | 2164 |
| 206 | Ga0501034_0492749 | 3300049571 | Bacteria | 1140 |
| 207 | Ga0501034_0854349 | 3300049571 | Bacteria | 800 |
| 208 | Ga0501036_0013442 | 3300049572 | Bacteria | 6803 |
| 209 | Ga0501036_0030097 | 3300049572 | Bacteria | 4586 |
| 210 | Ga0501037_0001058 | 3300049573 | Bacteria | 20382 |
| 211 | Ga0501037_0027557 | 3300049573 | Bacteria | 4198 |
| 212 | Ga0501038_0015626 | 3300049574 | Bacteria | 6899 |
| 213 | Ga0501038_0190227 | 3300049574 | Bacteria | 1652 |
| 214 | Ga0501039_0000131 | 3300049575 | Bacteria | 52205 |
| 215 | Ga0501039_0246651 | 3300049575 | Bacteria | 1404 |
| 216 | Ga0501046_0001156 | 3300049580 | Bacteria | 25669 |
| 217 | Ga0501046_0053418 | 3300049580 | Bacteria | 3182 |
| 218 | Ga0501047_0000129 | 3300049581 | Bacteria | 91572 |
| 219 | Ga0501047_0021343 | 3300049581 | Bacteria | 6216 |
| 220 | Ga0501047_0034059 | 3300049581 | Bacteria | 4917 |
| 221 | Ga0501047_0275688 | 3300049581 | Bacteria | 1527 |
| 222 | Ga0501067_0000213 | 3300049583 | Bacteria | 32191 |
| 223 | Ga0501067_0093565 | 3300049583 | Bacteria | 1669 |
| 224 | Ga0501070_0007025 | 3300049586 | Bacteria | 9577 |
| 225 | Ga0501070_0210855 | 3300049586 | Bacteria | 1594 |
| 226 | Ga0501070_0377336 | 3300049586 | Bacteria | 1149 |
| 227 | Ga0501070_0626009 | 3300049586 | Bacteria | 856 |
| 228 | Ga0501073_0020183 | 3300049589 | Bacteria | 4806 |
| 229 | Ga0501073_0115794 | 3300049589 | Bacteria | 1858 |
| 230 | Ga0501073_0380409 | 3300049589 | Bacteria | 975 |
| 231 | Ga0501074_0030372 | 3300049590 | Bacteria | 3916 |
| 232 | Ga0501080_0000053 | 3300049742 | Bacteria | 74409 |
| 233 | Ga0501080_0110497 | 3300049742 | Bacteria | 2548 |
| 234 | Ga0501080_0371029 | 3300049742 | Bacteria | 1290 |
| 235 | Ga0501280_000153 | 3300049776 | Bacteria | 17816 |
| 236 | Ga0501035_0000010 | 3300049822 | Bacteria | 309349 |
| 237 | Ga0501044_0000006 | 3300049823 | Bacteria | 291413 |
| 238 | Ga0501044_0077312 | 3300049823 | Bacteria | 3376 |
| 239 | Ga0501044_0228654 | 3300049823 | Bacteria | 1808 |
| 240 | Ga0501045_0009226 | 3300049824 | Bacteria | 6897 |
| 241 | nmdc:mga03683_82988_c1 | 3300050489 | Bacteria | 1387 |
| 242 | nmdc:mga05p37_2727_c1 | 3300050507 | Bacteria | 20518 |
| 243 | nmdc:mga06r32_372598_c1 | 3300050510 | Bacteria | 1411 |
| 244 | nmdc:mga0n895_46771_c1 | 3300050512 | Bacteria | 4229 |
| 245 | nmdc:mga0n895_54130_c1 | 3300050512 | Bacteria | 3945 |
| 246 | nmdc:mga0n895_66663_c1 | 3300050512 | Bacteria | 3564 |
| 247 | nmdc:mga0a205_5929_c1 | 3300050515 | Bacteria | 11013 |
| 248 | Ga0500572_077346 | 3300053111 | Bacteria | 1038 |
| 249 | Ga0500618_000917 | 3300053125 | Bacteria | 15292 |
| 250 | Ga0500604_0000091 | 3300053151 | Bacteria | 29061 |
| 251 | Ga0500616_0042844 | 3300053153 | Bacteria | 2422 |
| 252 | Ga0500624_005320 | 3300053157 | Bacteria | 1710 |
| 253 | Ga0500634_0000058 | 3300053161 | Bacteria | 47751 |
| 254 | Ga0501082_0022263 | 3300060353 | Bacteria | 5461 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0626009 | Ga0501070_0626009_146_832 | 224 |
| 2 | 3300042876 | Ga0451577_0732439 | Ga0451577_0732439_193_879 | 228 |
| 3 | 3300009147 | Ga0114129_10000549 | Ga0114129_1000054938 | 230 |
| 4 | 3300050507 | nmdc:mga05p37_2727_c1 | nmdc:mga05p37_2727_c1_1975_2766 | 230 |
| 5 | 3300050512 | nmdc:mga0n895_46771_c1 | nmdc:mga0n895_46771_c1_1853_2644 | 230 |
| 6 | 3300050515 | nmdc:mga0a205_5929_c1 | nmdc:mga0a205_5929_c1_3278_4069 | 230 |
| 7 | 3300006844 | Ga0075428_100788265 | Ga0075428_1007882652 | 238 |
| 8 | 3300049571 | Ga0501034_0854349 | Ga0501034_0854349_34_756 | 240 |
| 9 | 3300031241 | Ga0265325_10007193 | Ga0265325_100071935 | 242 |
| 10 | 3300031247 | Ga0265340_10101413 | Ga0265340_101014132 | 242 |
| 11 | 3300031249 | Ga0265339_10006469 | Ga0265339_100064693 | 242 |
| 12 | 3300006038 | Ga0075365_10037642 | Ga0075365_100376423 | 248 |
| 13 | 3300006844 | Ga0075428_100241356 | Ga0075428_1002413562 | 250 |
| 14 | 3300014325 | Ga0163163_10178898 | Ga0163163_101788983 | 257 |
| 15 | 3300006847 | Ga0075431_100208081 | Ga0075431_1002080813 | 258 |
| 16 | 3300006871 | Ga0075434_100268009 | Ga0075434_1002680091 | 258 |
| 17 | 3300006871 | Ga0075434_100601349 | Ga0075434_1006013491 | 258 |
| 18 | 3300006880 | Ga0075429_100077534 | Ga0075429_1000775344 | 258 |
| 19 | 3300009147 | Ga0114129_10036520 | Ga0114129_100365206 | 258 |
| 20 | 3300009147 | Ga0114129_10128017 | Ga0114129_101280174 | 258 |
| 21 | 3300009147 | Ga0114129_10316924 | Ga0114129_103169242 | 258 |
| 22 | 3300014325 | Ga0163163_10129639 | Ga0163163_101296392 | 258 |
| 23 | 3300035691 | Ga0373931_0147184 | Ga0373931_0147184_231_1022 | 258 |
| 24 | 3300050510 | nmdc:mga06r32_372598_c1 | nmdc:mga06r32_372598_c1_451_1242 | 258 |
| 25 | 3300050512 | nmdc:mga0n895_66663_c1 | nmdc:mga0n895_66663_c1_2615_3406 | 258 |
| 26 | 3300031728 | Ga0316578_10092039 | Ga0316578_100920392 | 259 |
| 27 | iso_pu_bacteria | 2643221629 | 2644167440 | 259 |
| 28 | iso_pu_bacteria | 2643221662 | 2644347203 | 259 |
| 29 | iso_pu_bacteria | 3000017691 | 3000018005 | 259 |
| 30 | 3300049571 | Ga0501034_0137530 | Ga0501034_0137530_249_1040 | 263 |
| 31 | iso_pu_bacteria | 2889790730 | 2889792197 | 263 |
| 32 | iso_pu_bacteria | 2889914905 | 2889917057 | 263 |
| 33 | 3300005366 | Ga0070659_100276970 | Ga0070659_1002769702 | 264 |
| 34 | 3300049569 | Ga0501032_0002955 | Ga0501032_0002955_1546_2340 | 264 |
| 35 | 3300049571 | Ga0501034_0000077 | Ga0501034_0000077_56069_56863 | 264 |
| 36 | 3300049571 | Ga0501034_0492749 | Ga0501034_0492749_224_1018 | 264 |
| 37 | 3300049572 | Ga0501036_0013442 | Ga0501036_0013442_5053_5847 | 264 |
| 38 | 3300049573 | Ga0501037_0001058 | Ga0501037_0001058_8039_8833 | 264 |
| 39 | 3300049574 | Ga0501038_0015626 | Ga0501038_0015626_1869_2663 | 264 |
| 40 | 3300049575 | Ga0501039_0000131 | Ga0501039_0000131_15984_16778 | 264 |
| 41 | 3300049580 | Ga0501046_0001156 | Ga0501046_0001156_18633_19427 | 264 |
| 42 | 3300049581 | Ga0501047_0000129 | Ga0501047_0000129_65591_66385 | 264 |
| 43 | 3300049583 | Ga0501067_0000213 | Ga0501067_0000213_11161_11955 | 264 |
| 44 | 3300049586 | Ga0501070_0007025 | Ga0501070_0007025_6875_7669 | 264 |
| 45 | 3300049742 | Ga0501080_0000053 | Ga0501080_0000053_19111_19905 | 264 |
| 46 | 3300049776 | Ga0501280_000153 | Ga0501280_000153_5980_6816 | 264 |
| 47 | 3300049822 | Ga0501035_0000010 | Ga0501035_0000010_192389_193183 | 264 |
| 48 | 3300049823 | Ga0501044_0000006 | Ga0501044_0000006_20051_20845 | 264 |
| 49 | 3300049824 | Ga0501045_0009226 | Ga0501045_0009226_4739_5533 | 264 |
| 50 | 3300053153 | Ga0500616_0042844 | Ga0500616_0042844_250_1044 | 264 |
| 51 | 3300060353 | Ga0501082_0022263 | Ga0501082_0022263_1312_2106 | 264 |
| 52 | iso_pu_bacteria | 2671180139 | 2671694095 | 264 |
| 53 | iso_pu_bacteria | 2821123053 | 2821127805 | 264 |
| 54 | iso_pu_bacteria | 2857531043 | 2857534454 | 264 |
| 55 | 3300025297 | Ga0209758_1041629 | Ga0209758_10416292 | 265 |
| 56 | iso_pu_bacteria | 2643221580 | 2643910647 | 265 |
| 57 | iso_pu_bacteria | 2643221591 | 2643963525 | 265 |
| 58 | iso_pu_bacteria | 2643221674 | 2644410467 | 265 |
| 59 | iso_pu_bacteria | 2932401849 | 2932403175 | 265 |
| 60 | 3300005339 | Ga0070660_100002968 | Ga0070660_1000029687 | 266 |
| 61 | 3300005366 | Ga0070659_100382216 | Ga0070659_1003822162 | 266 |
| 62 | 3300005563 | Ga0068855_100267926 | Ga0068855_1002679262 | 266 |
| 63 | 3300005937 | Ga0081455_10024174 | Ga0081455_100241746 | 266 |
| 64 | 3300025909 | Ga0207705_10030745 | Ga0207705_100307453 | 266 |
| 65 | 3300025919 | Ga0207657_10000991 | Ga0207657_100009916 | 266 |
| 66 | 3300025949 | Ga0207667_10018876 | Ga0207667_100188764 | 266 |
| 67 | 3300026067 | Ga0207678_10423439 | Ga0207678_104234392 | 266 |
| 68 | 3300005334 | Ga0068869_100057534 | Ga0068869_1000575342 | 267 |
| 69 | 3300005336 | Ga0070680_100068517 | Ga0070680_1000685172 | 267 |
| 70 | 3300005337 | Ga0070682_100004622 | Ga0070682_1000046228 | 267 |
| 71 | 3300005339 | Ga0070660_100052066 | Ga0070660_1000520663 | 267 |
| 72 | 3300005345 | Ga0070692_10189095 | Ga0070692_101890951 | 267 |
| 73 | 3300005366 | Ga0070659_100055487 | Ga0070659_1000554873 | 267 |
| 74 | 3300005367 | Ga0070667_100114131 | Ga0070667_1001141313 | 267 |
| 75 | 3300005440 | Ga0070705_100012284 | Ga0070705_1000122843 | 267 |
| 76 | 3300005455 | Ga0070663_100010838 | Ga0070663_1000108384 | 267 |
| 77 | 3300005456 | Ga0070678_100121018 | Ga0070678_1001210182 | 267 |
| 78 | 3300005458 | Ga0070681_10246537 | Ga0070681_102465371 | 267 |
| 79 | 3300005539 | Ga0068853_100056516 | Ga0068853_1000565163 | 267 |
| 80 | 3300005545 | Ga0070695_100008996 | Ga0070695_1000089965 | 267 |
| 81 | 3300005546 | Ga0070696_100022622 | Ga0070696_1000226226 | 267 |
| 82 | 3300005547 | Ga0070693_100034509 | Ga0070693_1000345092 | 267 |
| 83 | 3300005549 | Ga0070704_100103592 | Ga0070704_1001035923 | 267 |
| 84 | 3300005563 | Ga0068855_100139516 | Ga0068855_1001395163 | 267 |
| 85 | 3300005564 | Ga0070664_100073809 | Ga0070664_1000738093 | 267 |
| 86 | 3300005578 | Ga0068854_100088365 | Ga0068854_1000883653 | 267 |
| 87 | 3300009174 | Ga0105241_10417043 | Ga0105241_104170432 | 267 |
| 88 | 3300011119 | Ga0105246_10357383 | Ga0105246_103573832 | 267 |
| 89 | 3300013296 | Ga0157374_10297908 | Ga0157374_102979082 | 267 |
| 90 | 3300025908 | Ga0207643_10130695 | Ga0207643_101306952 | 267 |
| 91 | 3300025911 | Ga0207654_10156085 | Ga0207654_101560852 | 267 |
| 92 | 3300025912 | Ga0207707_10200390 | Ga0207707_102003901 | 267 |
| 93 | 3300025917 | Ga0207660_10122018 | Ga0207660_101220183 | 267 |
| 94 | 3300025919 | Ga0207657_10059028 | Ga0207657_100590283 | 267 |
| 95 | 3300025921 | Ga0207652_10113829 | Ga0207652_101138292 | 267 |
| 96 | 3300025932 | Ga0207690_10061409 | Ga0207690_100614092 | 267 |
| 97 | 3300025942 | Ga0207689_10044638 | Ga0207689_100446384 | 267 |
| 98 | 3300025949 | Ga0207667_10193027 | Ga0207667_101930273 | 267 |
| 99 | 3300025981 | Ga0207640_10157085 | Ga0207640_101570851 | 267 |
| 100 | 3300026041 | Ga0207639_10534240 | Ga0207639_105342402 | 267 |
| 101 | 3300026067 | Ga0207678_10000100 | Ga0207678_1000010025 | 267 |
| 102 | 3300026095 | Ga0207676_10151313 | Ga0207676_101513132 | 267 |
| 103 | 3300026116 | Ga0207674_10038100 | Ga0207674_100381003 | 267 |
| 104 | 3300026121 | Ga0207683_10085077 | Ga0207683_100850773 | 267 |
| 105 | 3300028379 | Ga0268266_10224779 | Ga0268266_102247792 | 267 |
| 106 | 3300037466 | Ga0395898_0331542 | Ga0395898_0331542_223_1026 | 267 |
| 107 | 3300048903 | Ga0496100_0050719 | Ga0496100_0050719_402_1205 | 267 |
| 108 | 3300048905 | Ga0496102_0046856 | Ga0496102_0046856_2635_3438 | 267 |
| 109 | 3300048906 | Ga0496103_0002057 | Ga0496103_0002057_10828_11631 | 267 |
| 110 | 3300048907 | Ga0496104_0182285 | Ga0496104_0182285_1047_1850 | 267 |
| 111 | 3300048908 | Ga0496105_0035176 | Ga0496105_0035176_2495_3298 | 267 |
| 112 | 3300048909 | Ga0496106_0016953 | Ga0496106_0016953_4478_5281 | 267 |
| 113 | 3300048910 | Ga0496107_0015395 | Ga0496107_0015395_3321_4124 | 267 |
| 114 | 3300048917 | Ga0496114_0023607 | Ga0496114_0023607_674_1477 | 267 |
| 115 | 3300048918 | Ga0496115_0061807 | Ga0496115_0061807_667_1470 | 267 |
| 116 | 3300005539 | Ga0068853_100021007 | Ga0068853_1000210078 | 268 |
| 117 | 3300005548 | Ga0070665_100074548 | Ga0070665_1000745482 | 268 |
| 118 | 3300006946 | Ga0079104_1000209 | Ga0079104_100020931 | 268 |
| 119 | 3300009545 | Ga0105237_10000301 | Ga0105237_1000030128 | 268 |
| 120 | 3300010375 | Ga0105239_10001991 | Ga0105239_1000199110 | 268 |
| 121 | 3300010375 | Ga0105239_10006926 | Ga0105239_100069268 | 268 |
| 122 | 3300013100 | Ga0157373_10013660 | Ga0157373_100136605 | 268 |
| 123 | 3300025231 | Ga0207427_107497 | Ga0207427_1074971 | 268 |
| 124 | 3300025261 | Ga0209233_1000639 | Ga0209233_10006394 | 268 |
| 125 | 3300025904 | Ga0207647_10105001 | Ga0207647_101050013 | 268 |
| 126 | 3300025914 | Ga0207671_10000227 | Ga0207671_1000022726 | 268 |
| 127 | 3300026041 | Ga0207639_10000957 | Ga0207639_1000095710 | 268 |
| 128 | 3300027111 | Ga0209281_1000374 | Ga0209281_10003745 | 268 |
| 129 | 3300028379 | Ga0268266_10001992 | Ga0268266_1000199216 | 268 |
| 130 | 3300037312 | Ga0395899_0060604 | Ga0395899_0060604_902_1708 | 268 |
| 131 | 3300037418 | Ga0395900_0031520 | Ga0395900_0031520_1701_2507 | 268 |
| 132 | 3300037466 | Ga0395898_0427156 | Ga0395898_0427156_388_1194 | 268 |
| 133 | 3300038443 | Ga0395901_0105911 | Ga0395901_0105911_1040_1846 | 268 |
| 134 | 3300039450 | Ga0436363_0818450 | Ga0436363_0818450_936_1757 | 268 |
| 135 | 3300041413 | Ga0439465_0092665 | Ga0439465_0092665_151_957 | 268 |
| 136 | 3300042006 | Ga0439432_084479 | Ga0439432_084479_80_886 | 268 |
| 137 | 3300046530 | Ga0495654_0004235 | Ga0495654_0004235_2725_3555 | 268 |
| 138 | 3300047472 | Ga0495686_0175270 | Ga0495686_0175270_276_1106 | 268 |
| 139 | 3300048911 | Ga0496108_0260347 | Ga0496108_0260347_361_1179 | 268 |
| 140 | 3300048924 | Ga0496121_0169900 | Ga0496121_0169900_367_1185 | 268 |
| 141 | 3300048927 | Ga0496124_0045346 | Ga0496124_0045346_251_1069 | 268 |
| 142 | 3300048929 | Ga0496126_0067318 | Ga0496126_0067318_1358_2164 | 268 |
| 143 | 3300049574 | Ga0501038_0190227 | Ga0501038_0190227_602_1435 | 268 |
| 144 | 3300049580 | Ga0501046_0053418 | Ga0501046_0053418_100_906 | 268 |
| 145 | 3300049581 | Ga0501047_0021343 | Ga0501047_0021343_4909_5715 | 268 |
| 146 | 3300049581 | Ga0501047_0275688 | Ga0501047_0275688_281_1114 | 268 |
| 147 | 3300049583 | Ga0501067_0093565 | Ga0501067_0093565_555_1361 | 268 |
| 148 | 3300049586 | Ga0501070_0377336 | Ga0501070_0377336_168_1001 | 268 |
| 149 | 3300049589 | Ga0501073_0115794 | Ga0501073_0115794_509_1342 | 268 |
| 150 | 3300049823 | Ga0501044_0077312 | Ga0501044_0077312_2189_2995 | 268 |
| 151 | 3300049823 | Ga0501044_0228654 | Ga0501044_0228654_221_1051 | 268 |
| 152 | 3300050512 | nmdc:mga0n895_54130_c1 | nmdc:mga0n895_54130_c1_2798_3616 | 268 |
| 153 | 3300053125 | Ga0500618_000917 | Ga0500618_000917_11062_11892 | 268 |
| 154 | 3300003320 | rootH2_10022614 | rootH2_100226142 | 269 |
| 155 | 3300003323 | rootH1_10052655 | rootH1_100526552 | 269 |
| 156 | 3300005327 | Ga0070658_10082588 | Ga0070658_100825883 | 269 |
| 157 | 3300005327 | Ga0070658_10103713 | Ga0070658_101037132 | 269 |
| 158 | 3300005331 | Ga0070670_100441093 | Ga0070670_1004410932 | 269 |
| 159 | 3300005339 | Ga0070660_100053205 | Ga0070660_1000532052 | 269 |
| 160 | 3300005344 | Ga0070661_100012312 | Ga0070661_1000123122 | 269 |
| 161 | 3300005344 | Ga0070661_100031635 | Ga0070661_1000316354 | 269 |
| 162 | 3300005344 | Ga0070661_100054787 | Ga0070661_1000547871 | 269 |
| 163 | 3300005344 | Ga0070661_100068284 | Ga0070661_1000682843 | 269 |
| 164 | 3300005356 | Ga0070674_100004416 | Ga0070674_1000044168 | 269 |
| 165 | 3300005364 | Ga0070673_100211124 | Ga0070673_1002111242 | 269 |
| 166 | 3300005366 | Ga0070659_100449780 | Ga0070659_1004497801 | 269 |
| 167 | 3300005367 | Ga0070667_100721766 | Ga0070667_1007217661 | 269 |
| 168 | 3300005539 | Ga0068853_100020831 | Ga0068853_1000208313 | 269 |
| 169 | 3300005539 | Ga0068853_100113097 | Ga0068853_1001130972 | 269 |
| 170 | 3300005539 | Ga0068853_100207522 | Ga0068853_1002075222 | 269 |
| 171 | 3300005547 | Ga0070693_100197264 | Ga0070693_1001972642 | 269 |
| 172 | 3300005563 | Ga0068855_100127544 | Ga0068855_1001275442 | 269 |
| 173 | 3300005563 | Ga0068855_100213599 | Ga0068855_1002135992 | 269 |
| 174 | 3300005578 | Ga0068854_100011271 | Ga0068854_1000112712 | 269 |
| 175 | 3300005578 | Ga0068854_100021101 | Ga0068854_1000211016 | 269 |
| 176 | 3300005614 | Ga0068856_100082111 | Ga0068856_1000821112 | 269 |
| 177 | 3300005614 | Ga0068856_100084801 | Ga0068856_1000848014 | 269 |
| 178 | 3300005614 | Ga0068856_100413408 | Ga0068856_1004134082 | 269 |
| 179 | 3300005616 | Ga0068852_100003997 | Ga0068852_1000039976 | 269 |
| 180 | 3300005616 | Ga0068852_100015070 | Ga0068852_1000150702 | 269 |
| 181 | 3300005616 | Ga0068852_100136214 | Ga0068852_1001362142 | 269 |
| 182 | 3300005616 | Ga0068852_100239922 | Ga0068852_1002399222 | 269 |
| 183 | 3300005834 | Ga0068851_10004462 | Ga0068851_100044626 | 269 |
| 184 | 3300005834 | Ga0068851_10053981 | Ga0068851_100539812 | 269 |
| 185 | 3300006177 | Ga0075362_10006745 | Ga0075362_100067455 | 269 |
| 186 | 3300006178 | Ga0075367_10063303 | Ga0075367_100633032 | 269 |
| 187 | 3300006353 | Ga0075370_10033198 | Ga0075370_100331983 | 269 |
| 188 | 3300009093 | Ga0105240_10032467 | Ga0105240_100324679 | 269 |
| 189 | 3300009174 | Ga0105241_10235582 | Ga0105241_102355822 | 269 |
| 190 | 3300009174 | Ga0105241_10320095 | Ga0105241_103200952 | 269 |
| 191 | 3300009551 | Ga0105238_10137529 | Ga0105238_101375293 | 269 |
| 192 | 3300010375 | Ga0105239_10050725 | Ga0105239_100507256 | 269 |
| 193 | 3300010375 | Ga0105239_10074143 | Ga0105239_100741435 | 269 |
| 194 | 3300013100 | Ga0157373_10102268 | Ga0157373_101022682 | 269 |
| 195 | 3300013102 | Ga0157371_10228976 | Ga0157371_102289762 | 269 |
| 196 | 3300013104 | Ga0157370_10182314 | Ga0157370_101823143 | 269 |
| 197 | 3300013105 | Ga0157369_10084592 | Ga0157369_100845922 | 269 |
| 198 | 3300013307 | Ga0157372_10451132 | Ga0157372_104511322 | 269 |
| 199 | 3300014326 | Ga0157380_10136232 | Ga0157380_101362323 | 269 |
| 200 | 3300020070 | Ga0206356_11812984 | Ga0206356_118129842 | 269 |
| 201 | 3300025321 | Ga0207656_10023639 | Ga0207656_100236393 | 269 |
| 202 | 3300025321 | Ga0207656_10051077 | Ga0207656_100510773 | 269 |
| 203 | 3300025909 | Ga0207705_10054246 | Ga0207705_100542463 | 269 |
| 204 | 3300025911 | Ga0207654_10095828 | Ga0207654_100958281 | 269 |
| 205 | 3300025911 | Ga0207654_10100749 | Ga0207654_101007492 | 269 |
| 206 | 3300025913 | Ga0207695_10053895 | Ga0207695_100538954 | 269 |
| 207 | 3300025919 | Ga0207657_10006142 | Ga0207657_100061429 | 269 |
| 208 | 3300025919 | Ga0207657_10092444 | Ga0207657_100924442 | 269 |
| 209 | 3300025920 | Ga0207649_10004184 | Ga0207649_100041847 | 269 |
| 210 | 3300025920 | Ga0207649_10019344 | Ga0207649_100193443 | 269 |
| 211 | 3300025924 | Ga0207694_10241536 | Ga0207694_102415362 | 269 |
| 212 | 3300025937 | Ga0207669_10123612 | Ga0207669_101236122 | 269 |
| 213 | 3300025940 | Ga0207691_10018213 | Ga0207691_100182135 | 269 |
| 214 | 3300025949 | Ga0207667_10002734 | Ga0207667_1000273422 | 269 |
| 215 | 3300025949 | Ga0207667_10205122 | Ga0207667_102051223 | 269 |
| 216 | 3300025972 | Ga0207668_10259260 | Ga0207668_102592602 | 269 |
| 217 | 3300025981 | Ga0207640_10017718 | Ga0207640_100177183 | 269 |
| 218 | 3300025981 | Ga0207640_10208567 | Ga0207640_102085672 | 269 |
| 219 | 3300026041 | Ga0207639_10015119 | Ga0207639_100151193 | 269 |
| 220 | 3300026041 | Ga0207639_10137375 | Ga0207639_101373752 | 269 |
| 221 | 3300026078 | Ga0207702_10016053 | Ga0207702_100160532 | 269 |
| 222 | 3300026078 | Ga0207702_10056102 | Ga0207702_100561023 | 269 |
| 223 | 3300026078 | Ga0207702_10143068 | Ga0207702_101430682 | 269 |
| 224 | 3300026078 | Ga0207702_10363753 | Ga0207702_103637532 | 269 |
| 225 | 3300026089 | Ga0207648_10017394 | Ga0207648_100173945 | 269 |
| 226 | 3300026116 | Ga0207674_10027209 | Ga0207674_100272092 | 269 |
| 227 | 3300026142 | Ga0207698_10024853 | Ga0207698_100248532 | 269 |
| 228 | 3300026142 | Ga0207698_10460936 | Ga0207698_104609362 | 269 |
| 229 | 3300027876 | Ga0209974_10079997 | Ga0209974_100799971 | 269 |
| 230 | 3300028379 | Ga0268266_10077196 | Ga0268266_100771962 | 269 |
| 231 | 3300028573 | Ga0265334_10105275 | Ga0265334_101052752 | 269 |
| 232 | 3300028800 | Ga0265338_10016042 | Ga0265338_100160426 | 269 |
| 233 | 3300031238 | Ga0265332_10087543 | Ga0265332_100875432 | 269 |
| 234 | 3300031241 | Ga0265325_10015955 | Ga0265325_100159554 | 269 |
| 235 | 3300031247 | Ga0265340_10135632 | Ga0265340_101356321 | 269 |
| 236 | 3300031249 | Ga0265339_10005568 | Ga0265339_100055684 | 269 |
| 237 | 3300031250 | Ga0265331_10102455 | Ga0265331_101024552 | 269 |
| 238 | 3300031595 | Ga0265313_10000121 | Ga0265313_1000012111 | 269 |
| 239 | 3300031711 | Ga0265314_10077124 | Ga0265314_100771243 | 269 |
| 240 | 3300031711 | Ga0265314_10104281 | Ga0265314_101042813 | 269 |
| 241 | 3300032004 | Ga0307414_10109037 | Ga0307414_101090372 | 269 |
| 242 | 3300035691 | Ga0373931_0034148 | Ga0373931_0034148_73_882 | 269 |
| 243 | 3300037312 | Ga0395899_0036205 | Ga0395899_0036205_1183_1992 | 269 |
| 244 | 3300037418 | Ga0395900_0169476 | Ga0395900_0169476_277_1086 | 269 |
| 245 | 3300037466 | Ga0395898_0173556 | Ga0395898_0173556_363_1172 | 269 |
| 246 | 3300037471 | Ga0395905_0195034 | Ga0395905_0195034_918_1727 | 269 |
| 247 | 3300048924 | Ga0496121_0121812 | Ga0496121_0121812_120_929 | 269 |
| 248 | 3300048928 | Ga0496125_0051478 | Ga0496125_0051478_305_1117 | 269 |
| 249 | 3300049570 | Ga0501033_0051092 | Ga0501033_0051092_1487_2296 | 269 |
| 250 | 3300049571 | Ga0501034_0003327 | Ga0501034_0003327_6281_7093 | 269 |
| 251 | 3300049571 | Ga0501034_0167645 | Ga0501034_0167645_805_1614 | 269 |
| 252 | 3300049572 | Ga0501036_0030097 | Ga0501036_0030097_1904_2713 | 269 |
| 253 | 3300049573 | Ga0501037_0027557 | Ga0501037_0027557_2219_3028 | 269 |
| 254 | 3300049575 | Ga0501039_0246651 | Ga0501039_0246651_234_1043 | 269 |
| 255 | 3300049581 | Ga0501047_0034059 | Ga0501047_0034059_366_1175 | 269 |
| 256 | 3300049586 | Ga0501070_0210855 | Ga0501070_0210855_337_1146 | 269 |
| 257 | 3300049589 | Ga0501073_0020183 | Ga0501073_0020183_2733_3542 | 269 |
| 258 | 3300049589 | Ga0501073_0380409 | Ga0501073_0380409_131_940 | 269 |
| 259 | 3300049590 | Ga0501074_0030372 | Ga0501074_0030372_926_1735 | 269 |
| 260 | 3300049742 | Ga0501080_0110497 | Ga0501080_0110497_1114_1923 | 269 |
| 261 | 3300049742 | Ga0501080_0371029 | Ga0501080_0371029_428_1237 | 269 |
| 262 | 3300050489 | nmdc:mga03683_82988_c1 | nmdc:mga03683_82988_c1_55_864 | 269 |
| 263 | 3300053111 | Ga0500572_077346 | Ga0500572_077346_214_1023 | 269 |
| 264 | 3300053151 | Ga0500604_0000091 | Ga0500604_0000091_18927_19739 | 269 |
| 265 | 3300053157 | Ga0500624_005320 | Ga0500624_005320_29_841 | 269 |
| 266 | 3300053161 | Ga0500634_0000058 | Ga0500634_0000058_29681_30493 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6y88-assembly8.cif.gz_H | igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp | 0.9799 | 3 | 263 |
| 3t55-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) | 0.9662 | 4 | 264 |
| 6y88-assembly8.cif.gz_H | igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp | 0.9652 | 3 | 263 |
| 3t78-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate | 0.9609 | 4 | 266 |
| 1lbf-assembly1.cif.gz_A | crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9591 | 36 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JCI6_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9653 | 35 | 261 | 3.20.20.70 |
| 3t40A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9588 | 4 | 266 | 3.20.20.70 |
| af_P00909_2_259_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9565 | 4 | 264 | 3.20.20.70 |
| af_B4FS35_106_381_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9563 | 4 | 263 | 3.20.20.70 |
| 2c3zA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9497 | 37 | 263 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436E409-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9939 | 68 | 264 |
GO:0000162
GO:0004425 GO:0004640 |
| AF-A0A023XAN1-F1-model_v4 | deleted | 0.9928 | 3 | 262 |
|
| AF-A0A3M5WGY6-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9928 | 28 | 264 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
| AF-A0A529ZQ95-F1-model_v4 | deleted | 0.9921 | 67 | 264 |
|
| AF-A0A528BEV0-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9916 | 45 | 263 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar