F374098

General Info

Members Datasets Scaffolds Average Seq Length
266 169 254 267

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10136232|Ga0157380_101362323
Length 280
Sequence LDGEFGELTSEQADILQRIESYKREEIAAAKTLRPWNEVVAEAHDAPPVRRFLSALKKKRDSGDFALIAEVKKASPSKGLIRPDFNPSEIARAYELGGAACLSVLTDRPSFQGAPNYLIEARAATGLPVLRKDFMFETYQVAEARAWGADCILIILAAVGDDTARYLLDAAEEWRMDALVEVHDQIELDRALALDAEFIGINNRNLRTFETTLQTSVDLALGIPRNVHLVAESGIANYADVTKLHDTAGIGTFLVGESLMRQADVTKATQLLLWGDKGRP

Samples

Sample ID Description Type Environment
1 2643221580 Devosia sp. Root635 Isolate Unclassified
2 2643221591 Devosia sp. Root685 Isolate Unclassified
3 2643221629 Devosia sp. Root105 Isolate Unclassified
4 2643221662 Devosia sp. Root413D1 Isolate Unclassified
5 2643221674 Devosia sp. Root436 Isolate Unclassified
6 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
7 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
8 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
9 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
10 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
11 2932401849 Devosia sp. 2618 Isolate Rhizosphere
12 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.38
Isolates 4.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0.75
Rhizoplane 3.76
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10022614 3300003320 Bacteria 18271
2 rootH1_10052655 3300003323 Bacteria 2604
3 Ga0070658_10082588 3300005327 Bacteria 2640
4 Ga0070658_10103713 3300005327 Bacteria 2352
5 Ga0070670_100441093 3300005331 Bacteria 1153
6 Ga0068869_100057534 3300005334 Bacteria 2839
7 Ga0070680_100068517 3300005336 Bacteria 2913
8 Ga0070682_100004622 3300005337 Bacteria 7649
9 Ga0070660_100002968 3300005339 Bacteria 11672
10 Ga0070660_100052066 3300005339 Bacteria 3155
11 Ga0070660_100053205 3300005339 Bacteria 3122
12 Ga0070661_100012312 3300005344 Bacteria 5982
13 Ga0070661_100031635 3300005344 Bacteria 3827
14 Ga0070661_100054787 3300005344 Bacteria 2921
15 Ga0070661_100068284 3300005344 Bacteria 2612
16 Ga0070692_10189095 3300005345 Bacteria 1198
17 Ga0070674_100004416 3300005356 Bacteria 8018
18 Ga0070673_100211124 3300005364 Bacteria 1676
19 Ga0070659_100055487 3300005366 Bacteria 3123
20 Ga0070659_100276970 3300005366 Bacteria 1395
21 Ga0070659_100382216 3300005366 Bacteria 1186
22 Ga0070659_100449780 3300005366 Bacteria 1092
23 Ga0070667_100114131 3300005367 Bacteria 2345
24 Ga0070667_100721766 3300005367 Bacteria 923
25 Ga0070705_100012284 3300005440 Bacteria 4350
26 Ga0070663_100010838 3300005455 Bacteria 5695
27 Ga0070678_100121018 3300005456 Bacteria 2064
28 Ga0070681_10246537 3300005458 Bacteria 1699
29 Ga0068853_100020831 3300005539 Bacteria 5455
30 Ga0068853_100021007 3300005539 Bacteria 5435
31 Ga0068853_100056516 3300005539 Bacteria 3384
32 Ga0068853_100113097 3300005539 Bacteria 2413
33 Ga0068853_100207522 3300005539 Bacteria 1785
34 Ga0070695_100008996 3300005545 Bacteria 5935
35 Ga0070696_100022622 3300005546 Bacteria 4272
36 Ga0070693_100034509 3300005547 Bacteria 2799
37 Ga0070693_100197264 3300005547 Bacteria 1305
38 Ga0070665_100074548 3300005548 Bacteria 3399
39 Ga0070704_100103592 3300005549 Bacteria 2150
40 Ga0068855_100127544 3300005563 Bacteria 2908
41 Ga0068855_100139516 3300005563 Bacteria 2765
42 Ga0068855_100213599 3300005563 Bacteria 2167
43 Ga0068855_100267926 3300005563 Bacteria 1900
44 Ga0070664_100073809 3300005564 Bacteria 2928
45 Ga0068854_100011271 3300005578 Bacteria 5813
46 Ga0068854_100021101 3300005578 Bacteria 4417
47 Ga0068854_100088365 3300005578 Bacteria 2301
48 Ga0068856_100082111 3300005614 Bacteria 3198
49 Ga0068856_100084801 3300005614 Bacteria 3147
50 Ga0068856_100413408 3300005614 Bacteria 1369
51 Ga0068852_100003997 3300005616 Bacteria 10368
52 Ga0068852_100015070 3300005616 Bacteria 5980
53 Ga0068852_100136214 3300005616 Bacteria 2267
54 Ga0068852_100239922 3300005616 Bacteria 1732
55 Ga0068851_10004462 3300005834 Bacteria 6314
56 Ga0068851_10053981 3300005834 Bacteria 2046
57 Ga0081455_10024174 3300005937 Bacteria 5635
58 Ga0075365_10037642 3300006038 Bacteria 3141
59 Ga0075362_10006745 3300006177 Bacteria 4291
60 Ga0075367_10063303 3300006178 Bacteria 2211
61 Ga0075370_10033198 3300006353 Bacteria 2888
62 Ga0075428_100241356 3300006844 Bacteria 1949
63 Ga0075428_100788265 3300006844 Bacteria 1010
64 Ga0075431_100208081 3300006847 Bacteria 1999
65 Ga0075434_100268009 3300006871 Bacteria 1727
66 Ga0075434_100601349 3300006871 Bacteria 1119
67 Ga0075429_100077534 3300006880 Bacteria 2895
68 Ga0079104_1000209 3300006946 Bacteria 81844
69 Ga0105240_10032467 3300009093 Bacteria 6759
70 Ga0114129_10000549 3300009147 Bacteria 45986
71 Ga0114129_10036520 3300009147 Bacteria 6937
72 Ga0114129_10128017 3300009147 Bacteria 3490
73 Ga0114129_10316924 3300009147 Bacteria 2074
74 Ga0105241_10235582 3300009174 Bacteria 1545
75 Ga0105241_10320095 3300009174 Bacteria 1337
76 Ga0105241_10417043 3300009174 Bacteria 1181
77 Ga0105237_10000301 3300009545 Bacteria 68372
78 Ga0105238_10137529 3300009551 Bacteria 2420
79 Ga0105239_10001991 3300010375 Bacteria 26554
80 Ga0105239_10006926 3300010375 Bacteria 13076
81 Ga0105239_10050725 3300010375 Bacteria 4550
82 Ga0105239_10074143 3300010375 Bacteria 3742
83 Ga0105246_10357383 3300011119 Bacteria 1199
84 Ga0157373_10013660 3300013100 Bacteria 5954
85 Ga0157373_10102268 3300013100 Bacteria 2016
86 Ga0157371_10228976 3300013102 Bacteria 1336
87 Ga0157370_10182314 3300013104 Bacteria 1951
88 Ga0157369_10084592 3300013105 Bacteria 3391
89 Ga0157374_10297908 3300013296 Bacteria 1595
90 Ga0157372_10451132 3300013307 Bacteria 1499
91 Ga0163163_10129639 3300014325 Bacteria 2562
92 Ga0163163_10178898 3300014325 Bacteria 2168
93 Ga0157380_10136232 3300014326 Bacteria 2102
94 Ga0206356_11812984 3300020070 Bacteria 1881
95 Ga0207427_107497 3300025231 Bacteria 1276
96 Ga0209233_1000639 3300025261 Bacteria 17464
97 Ga0209758_1041629 3300025297 Bacteria 1715
98 Ga0207656_10023639 3300025321 Bacteria 2477
99 Ga0207656_10051077 3300025321 Bacteria 1787
100 Ga0207647_10105001 3300025904 Bacteria 1674
101 Ga0207643_10130695 3300025908 Bacteria 1494
102 Ga0207705_10030745 3300025909 Bacteria 3832
103 Ga0207705_10054246 3300025909 Bacteria 2889
104 Ga0207654_10095828 3300025911 Bacteria 1818
105 Ga0207654_10100749 3300025911 Bacteria 1779
106 Ga0207654_10156085 3300025911 Bacteria 1470
107 Ga0207707_10200390 3300025912 Bacteria 1740
108 Ga0207695_10053895 3300025913 Bacteria 4204
109 Ga0207671_10000227 3300025914 Bacteria 84794
110 Ga0207660_10122018 3300025917 Bacteria 1974
111 Ga0207657_10000991 3300025919 Bacteria 30156
112 Ga0207657_10006142 3300025919 Bacteria 12485
113 Ga0207657_10059028 3300025919 Bacteria 3299
114 Ga0207657_10092444 3300025919 Bacteria 2521
115 Ga0207649_10004184 3300025920 Bacteria 7858
116 Ga0207649_10019344 3300025920 Bacteria 3890
117 Ga0207652_10113829 3300025921 Bacteria 2401
118 Ga0207694_10241536 3300025924 Bacteria 1476
119 Ga0207690_10061409 3300025932 Bacteria 2555
120 Ga0207669_10123612 3300025937 Bacteria 1762
121 Ga0207691_10018213 3300025940 Bacteria 6652
122 Ga0207689_10044638 3300025942 Bacteria 3665
123 Ga0207667_10002734 3300025949 Bacteria 21808
124 Ga0207667_10018876 3300025949 Bacteria 7716
125 Ga0207667_10193027 3300025949 Bacteria 2089
126 Ga0207667_10205122 3300025949 Bacteria 2022
127 Ga0207668_10259260 3300025972 Bacteria 1416
128 Ga0207640_10017718 3300025981 Bacteria 4173
129 Ga0207640_10157085 3300025981 Bacteria 1678
130 Ga0207640_10208567 3300025981 Bacteria 1487
131 Ga0207639_10000957 3300026041 Bacteria 19589
132 Ga0207639_10015119 3300026041 Bacteria 5438
133 Ga0207639_10137375 3300026041 Bacteria 2032
134 Ga0207639_10534240 3300026041 Bacteria 1075
135 Ga0207678_10000100 3300026067 Bacteria 70537
136 Ga0207678_10423439 3300026067 Bacteria 1155
137 Ga0207702_10016053 3300026078 Bacteria 6201
138 Ga0207702_10056102 3300026078 Bacteria 3343
139 Ga0207702_10143068 3300026078 Bacteria 2167
140 Ga0207702_10363753 3300026078 Bacteria 1387
141 Ga0207648_10017394 3300026089 Bacteria 6541
142 Ga0207676_10151313 3300026095 Bacteria 1999
143 Ga0207674_10027209 3300026116 Bacteria 6055
144 Ga0207674_10038100 3300026116 Bacteria 4995
145 Ga0207683_10085077 3300026121 Bacteria 2811
146 Ga0207698_10024853 3300026142 Bacteria 4210
147 Ga0207698_10460936 3300026142 Bacteria 1229
148 Ga0209281_1000374 3300027111 Bacteria 71684
149 Ga0209974_10079997 3300027876 Bacteria 1123
150 Ga0268266_10001992 3300028379 Bacteria 22881
151 Ga0268266_10077196 3300028379 Bacteria 2896
152 Ga0268266_10224779 3300028379 Bacteria 1727
153 Ga0265334_10105275 3300028573 Bacteria 1018
154 Ga0265338_10016042 3300028800 Bacteria 8183
155 Ga0265332_10087543 3300031238 Bacteria 1319
156 Ga0265325_10007193 3300031241 Bacteria 6695
157 Ga0265325_10015955 3300031241 Bacteria 4208
158 Ga0265340_10101413 3300031247 Bacteria 1337
159 Ga0265340_10135632 3300031247 Bacteria 1127
160 Ga0265339_10005568 3300031249 Bacteria 8373
161 Ga0265339_10006469 3300031249 Bacteria 7681
162 Ga0265331_10102455 3300031250 Bacteria 1316
163 Ga0265313_10000121 3300031595 Bacteria 78280
164 Ga0265314_10077124 3300031711 Bacteria 2212
165 Ga0265314_10104281 3300031711 Bacteria 1816
166 Ga0316578_10092039 3300031728 Bacteria 1812
167 Ga0307414_10109037 3300032004 Bacteria 2102
168 Ga0373931_0034148 3300035691 Bacteria 2639
169 Ga0373931_0147184 3300035691 Unclassified 1370
170 Ga0395899_0036205 3300037312 Bacteria 3702
171 Ga0395899_0060604 3300037312 Bacteria 2788
172 Ga0395900_0031520 3300037418 Bacteria 5448
173 Ga0395900_0169476 3300037418 Bacteria 2223
174 Ga0395898_0173556 3300037466 Bacteria 2060
175 Ga0395898_0331542 3300037466 Bacteria 1451
176 Ga0395898_0427156 3300037466 Bacteria 1262
177 Ga0395905_0195034 3300037471 Bacteria 1899
178 Ga0395901_0105911 3300038443 Bacteria 2951
179 Ga0436363_0818450 3300039450 Bacteria 2850
180 Ga0439465_0092665 3300041413 Bacteria 1035
181 Ga0439432_084479 3300042006 Bacteria 959
182 Ga0451577_0732439 3300042876 Bacteria 895
183 Ga0495654_0004235 3300046530 Bacteria 8574
184 Ga0495686_0175270 3300047472 Bacteria 1245
185 Ga0496100_0050719 3300048903 Bacteria 2690
186 Ga0496102_0046856 3300048905 Bacteria 3927
187 Ga0496103_0002057 3300048906 Bacteria 12872
188 Ga0496104_0182285 3300048907 Bacteria 2010
189 Ga0496105_0035176 3300048908 Bacteria 4122
190 Ga0496106_0016953 3300048909 Bacteria 5391
191 Ga0496107_0015395 3300048910 Bacteria 5359
192 Ga0496108_0260347 3300048911 Bacteria 1510
193 Ga0496114_0023607 3300048917 Bacteria 5020
194 Ga0496115_0061807 3300048918 Bacteria 3021
195 Ga0496121_0121812 3300048924 Bacteria 1969
196 Ga0496121_0169900 3300048924 Bacteria 1585
197 Ga0496124_0045346 3300048927 Bacteria 3769
198 Ga0496125_0051478 3300048928 Bacteria 3396
199 Ga0496126_0067318 3300048929 Bacteria 3200
200 Ga0501032_0002955 3300049569 Bacteria 13201
201 Ga0501033_0051092 3300049570 Bacteria 3064
202 Ga0501034_0000077 3300049571 Bacteria 173873
203 Ga0501034_0003327 3300049571 Bacteria 18346
204 Ga0501034_0137530 3300049571 Bacteria 2423
205 Ga0501034_0167645 3300049571 Bacteria 2164
206 Ga0501034_0492749 3300049571 Bacteria 1140
207 Ga0501034_0854349 3300049571 Bacteria 800
208 Ga0501036_0013442 3300049572 Bacteria 6803
209 Ga0501036_0030097 3300049572 Bacteria 4586
210 Ga0501037_0001058 3300049573 Bacteria 20382
211 Ga0501037_0027557 3300049573 Bacteria 4198
212 Ga0501038_0015626 3300049574 Bacteria 6899
213 Ga0501038_0190227 3300049574 Bacteria 1652
214 Ga0501039_0000131 3300049575 Bacteria 52205
215 Ga0501039_0246651 3300049575 Bacteria 1404
216 Ga0501046_0001156 3300049580 Bacteria 25669
217 Ga0501046_0053418 3300049580 Bacteria 3182
218 Ga0501047_0000129 3300049581 Bacteria 91572
219 Ga0501047_0021343 3300049581 Bacteria 6216
220 Ga0501047_0034059 3300049581 Bacteria 4917
221 Ga0501047_0275688 3300049581 Bacteria 1527
222 Ga0501067_0000213 3300049583 Bacteria 32191
223 Ga0501067_0093565 3300049583 Bacteria 1669
224 Ga0501070_0007025 3300049586 Bacteria 9577
225 Ga0501070_0210855 3300049586 Bacteria 1594
226 Ga0501070_0377336 3300049586 Bacteria 1149
227 Ga0501070_0626009 3300049586 Bacteria 856
228 Ga0501073_0020183 3300049589 Bacteria 4806
229 Ga0501073_0115794 3300049589 Bacteria 1858
230 Ga0501073_0380409 3300049589 Bacteria 975
231 Ga0501074_0030372 3300049590 Bacteria 3916
232 Ga0501080_0000053 3300049742 Bacteria 74409
233 Ga0501080_0110497 3300049742 Bacteria 2548
234 Ga0501080_0371029 3300049742 Bacteria 1290
235 Ga0501280_000153 3300049776 Bacteria 17816
236 Ga0501035_0000010 3300049822 Bacteria 309349
237 Ga0501044_0000006 3300049823 Bacteria 291413
238 Ga0501044_0077312 3300049823 Bacteria 3376
239 Ga0501044_0228654 3300049823 Bacteria 1808
240 Ga0501045_0009226 3300049824 Bacteria 6897
241 nmdc:mga03683_82988_c1 3300050489 Bacteria 1387
242 nmdc:mga05p37_2727_c1 3300050507 Bacteria 20518
243 nmdc:mga06r32_372598_c1 3300050510 Bacteria 1411
244 nmdc:mga0n895_46771_c1 3300050512 Bacteria 4229
245 nmdc:mga0n895_54130_c1 3300050512 Bacteria 3945
246 nmdc:mga0n895_66663_c1 3300050512 Bacteria 3564
247 nmdc:mga0a205_5929_c1 3300050515 Bacteria 11013
248 Ga0500572_077346 3300053111 Bacteria 1038
249 Ga0500618_000917 3300053125 Bacteria 15292
250 Ga0500604_0000091 3300053151 Bacteria 29061
251 Ga0500616_0042844 3300053153 Bacteria 2422
252 Ga0500624_005320 3300053157 Bacteria 1710
253 Ga0500634_0000058 3300053161 Bacteria 47751
254 Ga0501082_0022263 3300060353 Bacteria 5461

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0626009 Ga0501070_0626009_146_832 224
2 3300042876 Ga0451577_0732439 Ga0451577_0732439_193_879 228
3 3300009147 Ga0114129_10000549 Ga0114129_1000054938 230
4 3300050507 nmdc:mga05p37_2727_c1 nmdc:mga05p37_2727_c1_1975_2766 230
5 3300050512 nmdc:mga0n895_46771_c1 nmdc:mga0n895_46771_c1_1853_2644 230
6 3300050515 nmdc:mga0a205_5929_c1 nmdc:mga0a205_5929_c1_3278_4069 230
7 3300006844 Ga0075428_100788265 Ga0075428_1007882652 238
8 3300049571 Ga0501034_0854349 Ga0501034_0854349_34_756 240
9 3300031241 Ga0265325_10007193 Ga0265325_100071935 242
10 3300031247 Ga0265340_10101413 Ga0265340_101014132 242
11 3300031249 Ga0265339_10006469 Ga0265339_100064693 242
12 3300006038 Ga0075365_10037642 Ga0075365_100376423 248
13 3300006844 Ga0075428_100241356 Ga0075428_1002413562 250
14 3300014325 Ga0163163_10178898 Ga0163163_101788983 257
15 3300006847 Ga0075431_100208081 Ga0075431_1002080813 258
16 3300006871 Ga0075434_100268009 Ga0075434_1002680091 258
17 3300006871 Ga0075434_100601349 Ga0075434_1006013491 258
18 3300006880 Ga0075429_100077534 Ga0075429_1000775344 258
19 3300009147 Ga0114129_10036520 Ga0114129_100365206 258
20 3300009147 Ga0114129_10128017 Ga0114129_101280174 258
21 3300009147 Ga0114129_10316924 Ga0114129_103169242 258
22 3300014325 Ga0163163_10129639 Ga0163163_101296392 258
23 3300035691 Ga0373931_0147184 Ga0373931_0147184_231_1022 258
24 3300050510 nmdc:mga06r32_372598_c1 nmdc:mga06r32_372598_c1_451_1242 258
25 3300050512 nmdc:mga0n895_66663_c1 nmdc:mga0n895_66663_c1_2615_3406 258
26 3300031728 Ga0316578_10092039 Ga0316578_100920392 259
27 iso_pu_bacteria 2643221629 2644167440 259
28 iso_pu_bacteria 2643221662 2644347203 259
29 iso_pu_bacteria 3000017691 3000018005 259
30 3300049571 Ga0501034_0137530 Ga0501034_0137530_249_1040 263
31 iso_pu_bacteria 2889790730 2889792197 263
32 iso_pu_bacteria 2889914905 2889917057 263
33 3300005366 Ga0070659_100276970 Ga0070659_1002769702 264
34 3300049569 Ga0501032_0002955 Ga0501032_0002955_1546_2340 264
35 3300049571 Ga0501034_0000077 Ga0501034_0000077_56069_56863 264
36 3300049571 Ga0501034_0492749 Ga0501034_0492749_224_1018 264
37 3300049572 Ga0501036_0013442 Ga0501036_0013442_5053_5847 264
38 3300049573 Ga0501037_0001058 Ga0501037_0001058_8039_8833 264
39 3300049574 Ga0501038_0015626 Ga0501038_0015626_1869_2663 264
40 3300049575 Ga0501039_0000131 Ga0501039_0000131_15984_16778 264
41 3300049580 Ga0501046_0001156 Ga0501046_0001156_18633_19427 264
42 3300049581 Ga0501047_0000129 Ga0501047_0000129_65591_66385 264
43 3300049583 Ga0501067_0000213 Ga0501067_0000213_11161_11955 264
44 3300049586 Ga0501070_0007025 Ga0501070_0007025_6875_7669 264
45 3300049742 Ga0501080_0000053 Ga0501080_0000053_19111_19905 264
46 3300049776 Ga0501280_000153 Ga0501280_000153_5980_6816 264
47 3300049822 Ga0501035_0000010 Ga0501035_0000010_192389_193183 264
48 3300049823 Ga0501044_0000006 Ga0501044_0000006_20051_20845 264
49 3300049824 Ga0501045_0009226 Ga0501045_0009226_4739_5533 264
50 3300053153 Ga0500616_0042844 Ga0500616_0042844_250_1044 264
51 3300060353 Ga0501082_0022263 Ga0501082_0022263_1312_2106 264
52 iso_pu_bacteria 2671180139 2671694095 264
53 iso_pu_bacteria 2821123053 2821127805 264
54 iso_pu_bacteria 2857531043 2857534454 264
55 3300025297 Ga0209758_1041629 Ga0209758_10416292 265
56 iso_pu_bacteria 2643221580 2643910647 265
57 iso_pu_bacteria 2643221591 2643963525 265
58 iso_pu_bacteria 2643221674 2644410467 265
59 iso_pu_bacteria 2932401849 2932403175 265
60 3300005339 Ga0070660_100002968 Ga0070660_1000029687 266
61 3300005366 Ga0070659_100382216 Ga0070659_1003822162 266
62 3300005563 Ga0068855_100267926 Ga0068855_1002679262 266
63 3300005937 Ga0081455_10024174 Ga0081455_100241746 266
64 3300025909 Ga0207705_10030745 Ga0207705_100307453 266
65 3300025919 Ga0207657_10000991 Ga0207657_100009916 266
66 3300025949 Ga0207667_10018876 Ga0207667_100188764 266
67 3300026067 Ga0207678_10423439 Ga0207678_104234392 266
68 3300005334 Ga0068869_100057534 Ga0068869_1000575342 267
69 3300005336 Ga0070680_100068517 Ga0070680_1000685172 267
70 3300005337 Ga0070682_100004622 Ga0070682_1000046228 267
71 3300005339 Ga0070660_100052066 Ga0070660_1000520663 267
72 3300005345 Ga0070692_10189095 Ga0070692_101890951 267
73 3300005366 Ga0070659_100055487 Ga0070659_1000554873 267
74 3300005367 Ga0070667_100114131 Ga0070667_1001141313 267
75 3300005440 Ga0070705_100012284 Ga0070705_1000122843 267
76 3300005455 Ga0070663_100010838 Ga0070663_1000108384 267
77 3300005456 Ga0070678_100121018 Ga0070678_1001210182 267
78 3300005458 Ga0070681_10246537 Ga0070681_102465371 267
79 3300005539 Ga0068853_100056516 Ga0068853_1000565163 267
80 3300005545 Ga0070695_100008996 Ga0070695_1000089965 267
81 3300005546 Ga0070696_100022622 Ga0070696_1000226226 267
82 3300005547 Ga0070693_100034509 Ga0070693_1000345092 267
83 3300005549 Ga0070704_100103592 Ga0070704_1001035923 267
84 3300005563 Ga0068855_100139516 Ga0068855_1001395163 267
85 3300005564 Ga0070664_100073809 Ga0070664_1000738093 267
86 3300005578 Ga0068854_100088365 Ga0068854_1000883653 267
87 3300009174 Ga0105241_10417043 Ga0105241_104170432 267
88 3300011119 Ga0105246_10357383 Ga0105246_103573832 267
89 3300013296 Ga0157374_10297908 Ga0157374_102979082 267
90 3300025908 Ga0207643_10130695 Ga0207643_101306952 267
91 3300025911 Ga0207654_10156085 Ga0207654_101560852 267
92 3300025912 Ga0207707_10200390 Ga0207707_102003901 267
93 3300025917 Ga0207660_10122018 Ga0207660_101220183 267
94 3300025919 Ga0207657_10059028 Ga0207657_100590283 267
95 3300025921 Ga0207652_10113829 Ga0207652_101138292 267
96 3300025932 Ga0207690_10061409 Ga0207690_100614092 267
97 3300025942 Ga0207689_10044638 Ga0207689_100446384 267
98 3300025949 Ga0207667_10193027 Ga0207667_101930273 267
99 3300025981 Ga0207640_10157085 Ga0207640_101570851 267
100 3300026041 Ga0207639_10534240 Ga0207639_105342402 267
101 3300026067 Ga0207678_10000100 Ga0207678_1000010025 267
102 3300026095 Ga0207676_10151313 Ga0207676_101513132 267
103 3300026116 Ga0207674_10038100 Ga0207674_100381003 267
104 3300026121 Ga0207683_10085077 Ga0207683_100850773 267
105 3300028379 Ga0268266_10224779 Ga0268266_102247792 267
106 3300037466 Ga0395898_0331542 Ga0395898_0331542_223_1026 267
107 3300048903 Ga0496100_0050719 Ga0496100_0050719_402_1205 267
108 3300048905 Ga0496102_0046856 Ga0496102_0046856_2635_3438 267
109 3300048906 Ga0496103_0002057 Ga0496103_0002057_10828_11631 267
110 3300048907 Ga0496104_0182285 Ga0496104_0182285_1047_1850 267
111 3300048908 Ga0496105_0035176 Ga0496105_0035176_2495_3298 267
112 3300048909 Ga0496106_0016953 Ga0496106_0016953_4478_5281 267
113 3300048910 Ga0496107_0015395 Ga0496107_0015395_3321_4124 267
114 3300048917 Ga0496114_0023607 Ga0496114_0023607_674_1477 267
115 3300048918 Ga0496115_0061807 Ga0496115_0061807_667_1470 267
116 3300005539 Ga0068853_100021007 Ga0068853_1000210078 268
117 3300005548 Ga0070665_100074548 Ga0070665_1000745482 268
118 3300006946 Ga0079104_1000209 Ga0079104_100020931 268
119 3300009545 Ga0105237_10000301 Ga0105237_1000030128 268
120 3300010375 Ga0105239_10001991 Ga0105239_1000199110 268
121 3300010375 Ga0105239_10006926 Ga0105239_100069268 268
122 3300013100 Ga0157373_10013660 Ga0157373_100136605 268
123 3300025231 Ga0207427_107497 Ga0207427_1074971 268
124 3300025261 Ga0209233_1000639 Ga0209233_10006394 268
125 3300025904 Ga0207647_10105001 Ga0207647_101050013 268
126 3300025914 Ga0207671_10000227 Ga0207671_1000022726 268
127 3300026041 Ga0207639_10000957 Ga0207639_1000095710 268
128 3300027111 Ga0209281_1000374 Ga0209281_10003745 268
129 3300028379 Ga0268266_10001992 Ga0268266_1000199216 268
130 3300037312 Ga0395899_0060604 Ga0395899_0060604_902_1708 268
131 3300037418 Ga0395900_0031520 Ga0395900_0031520_1701_2507 268
132 3300037466 Ga0395898_0427156 Ga0395898_0427156_388_1194 268
133 3300038443 Ga0395901_0105911 Ga0395901_0105911_1040_1846 268
134 3300039450 Ga0436363_0818450 Ga0436363_0818450_936_1757 268
135 3300041413 Ga0439465_0092665 Ga0439465_0092665_151_957 268
136 3300042006 Ga0439432_084479 Ga0439432_084479_80_886 268
137 3300046530 Ga0495654_0004235 Ga0495654_0004235_2725_3555 268
138 3300047472 Ga0495686_0175270 Ga0495686_0175270_276_1106 268
139 3300048911 Ga0496108_0260347 Ga0496108_0260347_361_1179 268
140 3300048924 Ga0496121_0169900 Ga0496121_0169900_367_1185 268
141 3300048927 Ga0496124_0045346 Ga0496124_0045346_251_1069 268
142 3300048929 Ga0496126_0067318 Ga0496126_0067318_1358_2164 268
143 3300049574 Ga0501038_0190227 Ga0501038_0190227_602_1435 268
144 3300049580 Ga0501046_0053418 Ga0501046_0053418_100_906 268
145 3300049581 Ga0501047_0021343 Ga0501047_0021343_4909_5715 268
146 3300049581 Ga0501047_0275688 Ga0501047_0275688_281_1114 268
147 3300049583 Ga0501067_0093565 Ga0501067_0093565_555_1361 268
148 3300049586 Ga0501070_0377336 Ga0501070_0377336_168_1001 268
149 3300049589 Ga0501073_0115794 Ga0501073_0115794_509_1342 268
150 3300049823 Ga0501044_0077312 Ga0501044_0077312_2189_2995 268
151 3300049823 Ga0501044_0228654 Ga0501044_0228654_221_1051 268
152 3300050512 nmdc:mga0n895_54130_c1 nmdc:mga0n895_54130_c1_2798_3616 268
153 3300053125 Ga0500618_000917 Ga0500618_000917_11062_11892 268
154 3300003320 rootH2_10022614 rootH2_100226142 269
155 3300003323 rootH1_10052655 rootH1_100526552 269
156 3300005327 Ga0070658_10082588 Ga0070658_100825883 269
157 3300005327 Ga0070658_10103713 Ga0070658_101037132 269
158 3300005331 Ga0070670_100441093 Ga0070670_1004410932 269
159 3300005339 Ga0070660_100053205 Ga0070660_1000532052 269
160 3300005344 Ga0070661_100012312 Ga0070661_1000123122 269
161 3300005344 Ga0070661_100031635 Ga0070661_1000316354 269
162 3300005344 Ga0070661_100054787 Ga0070661_1000547871 269
163 3300005344 Ga0070661_100068284 Ga0070661_1000682843 269
164 3300005356 Ga0070674_100004416 Ga0070674_1000044168 269
165 3300005364 Ga0070673_100211124 Ga0070673_1002111242 269
166 3300005366 Ga0070659_100449780 Ga0070659_1004497801 269
167 3300005367 Ga0070667_100721766 Ga0070667_1007217661 269
168 3300005539 Ga0068853_100020831 Ga0068853_1000208313 269
169 3300005539 Ga0068853_100113097 Ga0068853_1001130972 269
170 3300005539 Ga0068853_100207522 Ga0068853_1002075222 269
171 3300005547 Ga0070693_100197264 Ga0070693_1001972642 269
172 3300005563 Ga0068855_100127544 Ga0068855_1001275442 269
173 3300005563 Ga0068855_100213599 Ga0068855_1002135992 269
174 3300005578 Ga0068854_100011271 Ga0068854_1000112712 269
175 3300005578 Ga0068854_100021101 Ga0068854_1000211016 269
176 3300005614 Ga0068856_100082111 Ga0068856_1000821112 269
177 3300005614 Ga0068856_100084801 Ga0068856_1000848014 269
178 3300005614 Ga0068856_100413408 Ga0068856_1004134082 269
179 3300005616 Ga0068852_100003997 Ga0068852_1000039976 269
180 3300005616 Ga0068852_100015070 Ga0068852_1000150702 269
181 3300005616 Ga0068852_100136214 Ga0068852_1001362142 269
182 3300005616 Ga0068852_100239922 Ga0068852_1002399222 269
183 3300005834 Ga0068851_10004462 Ga0068851_100044626 269
184 3300005834 Ga0068851_10053981 Ga0068851_100539812 269
185 3300006177 Ga0075362_10006745 Ga0075362_100067455 269
186 3300006178 Ga0075367_10063303 Ga0075367_100633032 269
187 3300006353 Ga0075370_10033198 Ga0075370_100331983 269
188 3300009093 Ga0105240_10032467 Ga0105240_100324679 269
189 3300009174 Ga0105241_10235582 Ga0105241_102355822 269
190 3300009174 Ga0105241_10320095 Ga0105241_103200952 269
191 3300009551 Ga0105238_10137529 Ga0105238_101375293 269
192 3300010375 Ga0105239_10050725 Ga0105239_100507256 269
193 3300010375 Ga0105239_10074143 Ga0105239_100741435 269
194 3300013100 Ga0157373_10102268 Ga0157373_101022682 269
195 3300013102 Ga0157371_10228976 Ga0157371_102289762 269
196 3300013104 Ga0157370_10182314 Ga0157370_101823143 269
197 3300013105 Ga0157369_10084592 Ga0157369_100845922 269
198 3300013307 Ga0157372_10451132 Ga0157372_104511322 269
199 3300014326 Ga0157380_10136232 Ga0157380_101362323 269
200 3300020070 Ga0206356_11812984 Ga0206356_118129842 269
201 3300025321 Ga0207656_10023639 Ga0207656_100236393 269
202 3300025321 Ga0207656_10051077 Ga0207656_100510773 269
203 3300025909 Ga0207705_10054246 Ga0207705_100542463 269
204 3300025911 Ga0207654_10095828 Ga0207654_100958281 269
205 3300025911 Ga0207654_10100749 Ga0207654_101007492 269
206 3300025913 Ga0207695_10053895 Ga0207695_100538954 269
207 3300025919 Ga0207657_10006142 Ga0207657_100061429 269
208 3300025919 Ga0207657_10092444 Ga0207657_100924442 269
209 3300025920 Ga0207649_10004184 Ga0207649_100041847 269
210 3300025920 Ga0207649_10019344 Ga0207649_100193443 269
211 3300025924 Ga0207694_10241536 Ga0207694_102415362 269
212 3300025937 Ga0207669_10123612 Ga0207669_101236122 269
213 3300025940 Ga0207691_10018213 Ga0207691_100182135 269
214 3300025949 Ga0207667_10002734 Ga0207667_1000273422 269
215 3300025949 Ga0207667_10205122 Ga0207667_102051223 269
216 3300025972 Ga0207668_10259260 Ga0207668_102592602 269
217 3300025981 Ga0207640_10017718 Ga0207640_100177183 269
218 3300025981 Ga0207640_10208567 Ga0207640_102085672 269
219 3300026041 Ga0207639_10015119 Ga0207639_100151193 269
220 3300026041 Ga0207639_10137375 Ga0207639_101373752 269
221 3300026078 Ga0207702_10016053 Ga0207702_100160532 269
222 3300026078 Ga0207702_10056102 Ga0207702_100561023 269
223 3300026078 Ga0207702_10143068 Ga0207702_101430682 269
224 3300026078 Ga0207702_10363753 Ga0207702_103637532 269
225 3300026089 Ga0207648_10017394 Ga0207648_100173945 269
226 3300026116 Ga0207674_10027209 Ga0207674_100272092 269
227 3300026142 Ga0207698_10024853 Ga0207698_100248532 269
228 3300026142 Ga0207698_10460936 Ga0207698_104609362 269
229 3300027876 Ga0209974_10079997 Ga0209974_100799971 269
230 3300028379 Ga0268266_10077196 Ga0268266_100771962 269
231 3300028573 Ga0265334_10105275 Ga0265334_101052752 269
232 3300028800 Ga0265338_10016042 Ga0265338_100160426 269
233 3300031238 Ga0265332_10087543 Ga0265332_100875432 269
234 3300031241 Ga0265325_10015955 Ga0265325_100159554 269
235 3300031247 Ga0265340_10135632 Ga0265340_101356321 269
236 3300031249 Ga0265339_10005568 Ga0265339_100055684 269
237 3300031250 Ga0265331_10102455 Ga0265331_101024552 269
238 3300031595 Ga0265313_10000121 Ga0265313_1000012111 269
239 3300031711 Ga0265314_10077124 Ga0265314_100771243 269
240 3300031711 Ga0265314_10104281 Ga0265314_101042813 269
241 3300032004 Ga0307414_10109037 Ga0307414_101090372 269
242 3300035691 Ga0373931_0034148 Ga0373931_0034148_73_882 269
243 3300037312 Ga0395899_0036205 Ga0395899_0036205_1183_1992 269
244 3300037418 Ga0395900_0169476 Ga0395900_0169476_277_1086 269
245 3300037466 Ga0395898_0173556 Ga0395898_0173556_363_1172 269
246 3300037471 Ga0395905_0195034 Ga0395905_0195034_918_1727 269
247 3300048924 Ga0496121_0121812 Ga0496121_0121812_120_929 269
248 3300048928 Ga0496125_0051478 Ga0496125_0051478_305_1117 269
249 3300049570 Ga0501033_0051092 Ga0501033_0051092_1487_2296 269
250 3300049571 Ga0501034_0003327 Ga0501034_0003327_6281_7093 269
251 3300049571 Ga0501034_0167645 Ga0501034_0167645_805_1614 269
252 3300049572 Ga0501036_0030097 Ga0501036_0030097_1904_2713 269
253 3300049573 Ga0501037_0027557 Ga0501037_0027557_2219_3028 269
254 3300049575 Ga0501039_0246651 Ga0501039_0246651_234_1043 269
255 3300049581 Ga0501047_0034059 Ga0501047_0034059_366_1175 269
256 3300049586 Ga0501070_0210855 Ga0501070_0210855_337_1146 269
257 3300049589 Ga0501073_0020183 Ga0501073_0020183_2733_3542 269
258 3300049589 Ga0501073_0380409 Ga0501073_0380409_131_940 269
259 3300049590 Ga0501074_0030372 Ga0501074_0030372_926_1735 269
260 3300049742 Ga0501080_0110497 Ga0501080_0110497_1114_1923 269
261 3300049742 Ga0501080_0371029 Ga0501080_0371029_428_1237 269
262 3300050489 nmdc:mga03683_82988_c1 nmdc:mga03683_82988_c1_55_864 269
263 3300053111 Ga0500572_077346 Ga0500572_077346_214_1023 269
264 3300053151 Ga0500604_0000091 Ga0500604_0000091_18927_19739 269
265 3300053157 Ga0500624_005320 Ga0500624_005320_29_841 269
266 3300053161 Ga0500634_0000058 Ga0500634_0000058_29681_30493 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

16

272

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9799 3 263
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.9662 4 264
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9652 3 263
3t78-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate 0.9609 4 266
1lbf-assembly1.cif.gz_A crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9591 36 263
ID Description Score Start End Superfamily
af_Q0JCI6_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9653 35 261 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9588 4 266 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9565 4 264 3.20.20.70
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9563 4 263 3.20.20.70
2c3zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9497 37 263 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A436E409-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9939 68 264 GO:0000162
GO:0004425
GO:0004640
AF-A0A023XAN1-F1-model_v4 deleted 0.9928 3 262
AF-A0A3M5WGY6-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9928 28 264 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A529ZQ95-F1-model_v4 deleted 0.9921 67 264
AF-A0A528BEV0-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9916 45 263 GO:0000162
GO:0004425
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
93.97 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map