F374076

General Info

Members Datasets Scaffolds Average Seq Length
266 177 222 270

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10022173|Ga0157370_100221733
Length 317
Sequence VKSFSLKYQLKDFLVKCFYFEPIRFGYSLPHFGNSCVCSNPELCPIIFKSRKMKTIFITGASTGLGKATAQLFQNKGWKVIATMRNPEAAADLANLENVTVLPLDVTNPEQIQSTVKQALELGDIDVVYNNAGYGLIGPLEAISDDQIVKQLDTNLLGVIRVTQAFIPYFREQKKGMFISTTSIGGLVAFPLGSTYHATKWALEGWSESLAFELNTLGIDIKTVSPGGIKTDFVSRSLDSASSPAYEDMTNSLFSKMEGMMEAASTPEQIAEVVYEAATDGKKQLRYVAGEDAKAIYAQRLELGDEAFREQFGKQFI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
9 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
10 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
11 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
12 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
13 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
14 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
15 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
16 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
17 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
18 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
21 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
22 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
23 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
24 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
25 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
26 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
27 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
28 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
29 2914759650 Rhizosphaericola mali Isolate Rhizosphere
30 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
31 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
32 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
33 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
34 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
35 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
36 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
37 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
38 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
119 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
167 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.83
Metatranscriptomes 0
Isolates 16.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 0.75
Rhizoplane 2.26
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 16.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1590904 2162886007 Bacteria 5979
2 SwRhRL2b_contig_2390258 2162886007 Bacteria 1215
3 SwRhRL2b_contig_815651 2162886007 Bacteria 1373
4 JGI24741J21665_1002423 3300001915 Bacteria 4844
5 JGI25162J39368_1000145 3300002737 Bacteria 77086
6 rootH1_10184646 3300003316 Bacteria 1710
7 rootH2_10013724 3300003320 Bacteria 9408
8 rootH2_10033173 3300003320 Bacteria 5651
9 rootH2_10079232 3300003320 Bacteria 5667
10 rootH2_10198102 3300003320 Bacteria 2797
11 rootL2_10113050 3300003322 Unclassified 1797
12 rootH1_10324645 3300003323 Bacteria 3303
13 Ga0055529_1005928 3300003763 Bacteria 1738
14 Ga0055534_1006174 3300003784 Bacteria 3067
15 Ga0055531_10000063 3300003794 Bacteria 119938
16 Ga0055531_10000311 3300003794 Bacteria 47873
17 Ga0065714_10030919 3300005288 Bacteria 1311
18 Ga0065714_10091735 3300005288 Bacteria 1900
19 Ga0065704_10071392 3300005289 Bacteria 11347
20 Ga0065704_10078270 3300005289 Bacteria 4477
21 Ga0065704_10185694 3300005289 Bacteria 1214
22 Ga0065707_10111327 3300005295 Bacteria 2398
23 Ga0065707_10277080 3300005295 Bacteria 1050
24 Ga0070682_100000245 3300005337 Bacteria 39270
25 Ga0070660_100044482 3300005339 Bacteria 3397
26 Ga0070687_100002295 3300005343 Bacteria 7103
27 Ga0070668_100128303 3300005347 Bacteria 2033
28 Ga0070668_100311808 3300005347 Bacteria 1322
29 Ga0070705_100022111 3300005440 Bacteria 3393
30 Ga0070694_100160609 3300005444 Bacteria 1648
31 Ga0070708_100485105 3300005445 Unclassified 1166
32 Ga0070706_100131001 3300005467 Unclassified 2340
33 Ga0070706_100165462 3300005467 Bacteria 2065
34 Ga0070706_100532804 3300005467 Bacteria 1092
35 Ga0070707_100002916 3300005468 Bacteria 16239
36 Ga0070707_100019613 3300005468 Bacteria 6373
37 Ga0070707_100038318 3300005468 Bacteria 4578
38 Ga0070707_100755751 3300005468 Bacteria 936
39 Ga0070698_100272007 3300005471 Bacteria 1626
40 Ga0070699_100110269 3300005518 Bacteria 2415
41 Ga0070699_100317504 3300005518 Unclassified 1400
42 Ga0070697_100000735 3300005536 Bacteria 24411
43 Ga0070686_100135736 3300005544 Bacteria 1707
44 Ga0070696_100057352 3300005546 Bacteria 2718
45 Ga0070704_100011434 3300005549 Bacteria 5440
46 Ga0070704_100048897 3300005549 Bacteria 2962
47 Ga0068857_100047917 3300005577 Bacteria 3795
48 Ga0070716_100001938 3300006173 Bacteria 9402
49 Ga0070716_100026970 3300006173 Bacteria 3081
50 Ga0070712_100006270 3300006175 Bacteria 7367
51 Ga0075428_100460466 3300006844 Bacteria 1362
52 Ga0075433_10179528 3300006852 Unclassified 1883
53 Ga0075434_100080062 3300006871 Bacteria 3263
54 Ga0075434_100293176 3300006871 Unclassified 1647
55 Ga0075429_100011631 3300006880 Bacteria 7633
56 Ga0075429_100194368 3300006880 Bacteria 1777
57 Ga0075436_100315826 3300006914 Bacteria 1122
58 Ga0099794_10029215 3300007265 Bacteria 2568
59 Ga0105244_10000244 3300009036 Bacteria 55612
60 Ga0105244_10032351 3300009036 Bacteria 2769
61 Ga0105240_10000098 3300009093 Bacteria 178435
62 Ga0114129_10012303 3300009147 Bacteria 12175
63 Ga0114129_10068332 3300009147 Bacteria 4955
64 Ga0114129_10130842 3300009147 Bacteria 3447
65 Ga0114129_10358010 3300009147 Bacteria 1931
66 Ga0114129_10447672 3300009147 Bacteria 1694
67 Ga0114129_10459901 3300009147 Unclassified 1668
68 Ga0114129_10500841 3300009147 Unclassified 1586
69 Ga0114129_11062648 3300009147 Bacteria 1016
70 Ga0105243_10000127 3300009148 Bacteria 86196
71 Ga0105243_10000408 3300009148 Bacteria 45109
72 Ga0105243_10085427 3300009148 Bacteria 2587
73 Ga0105243_10164679 3300009148 Bacteria 1915
74 Ga0105241_10100933 3300009174 Bacteria 2294
75 Ga0105237_10017970 3300009545 Bacteria 7326
76 Ga0105239_10000038 3300010375 Bacteria 205230
77 Ga0105239_10000193 3300010375 Bacteria 88304
78 Ga0105239_10079922 3300010375 Unclassified 3598
79 Ga0105239_10296018 3300010375 Unclassified 1822
80 Ga0105246_10102034 3300011119 Bacteria 2091
81 Ga0157373_10016509 3300013100 Bacteria 5384
82 Ga0157370_10022173 3300013104 Bacteria 6321
83 Ga0157370_10148151 3300013104 Bacteria 2185
84 Ga0157370_10369100 3300013104 Bacteria 1322
85 Ga0157369_10000046 3300013105 Bacteria 172851
86 Ga0157378_10277937 3300013297 Bacteria 1613
87 Ga0163162_10203754 3300013306 Bacteria 2107
88 Ga0157375_10040571 3300013308 Bacteria 4488
89 Ga0163163_10090004 3300014325 Bacteria 3082
90 Ga0157376_10853290 3300014969 Bacteria 926
91 Ga0182006_1000011 3300015261 Bacteria 408647
92 Ga0182006_1000243 3300015261 Bacteria 50809
93 Ga0182007_10000009 3300015262 Bacteria 316298
94 Ga0163161_10000179 3300017792 Bacteria 57833
95 Ga0163161_10000301 3300017792 Bacteria 42977
96 Ga0163161_10007031 3300017792 Bacteria 7786
97 Ga0209437_100225 3300025233 Bacteria 100605
98 Ga0209129_1006895 3300025258 Unclassified 3530
99 Ga0209455_1006265 3300025272 Bacteria 3541
100 Ga0209675_1000032 3300025291 Bacteria 273013
101 Ga0209257_1000001 3300025304 Bacteria 2274655
102 Ga0209257_1000008 3300025304 Bacteria 1294570
103 Ga0207655_1000702 3300025728 Bacteria 38833
104 Ga0207653_10028116 3300025885 Bacteria 1807
105 Ga0207647_10002872 3300025904 Bacteria 12977
106 Ga0207643_10201270 3300025908 Bacteria 1213
107 Ga0207684_10012650 3300025910 Bacteria 7329
108 Ga0207684_10018550 3300025910 Bacteria 5956
109 Ga0207684_10388597 3300025910 Bacteria 1200
110 Ga0207654_10069067 3300025911 Bacteria 2092
111 Ga0207654_10111183 3300025911 Bacteria 1705
112 Ga0207695_10000041 3300025913 Bacteria 450902
113 Ga0207695_10013161 3300025913 Bacteria 9876
114 Ga0207671_10011162 3300025914 Bacteria 7336
115 Ga0207662_10094395 3300025918 Bacteria 1845
116 Ga0207657_10131850 3300025919 Bacteria 2048
117 Ga0207646_10005421 3300025922 Bacteria 13417
118 Ga0207646_10007087 3300025922 Bacteria 11467
119 Ga0207646_10308783 3300025922 Unclassified 1429
120 Ga0207664_10171567 3300025929 Bacteria 1857
121 Ga0207706_10455014 3300025933 Bacteria 1107
122 Ga0207709_10000176 3300025935 Bacteria 86175
123 Ga0207709_10000458 3300025935 Bacteria 37753
124 Ga0207704_10098698 3300025938 Bacteria 1941
125 Ga0207665_10009157 3300025939 Bacteria 6501
126 Ga0207665_10335300 3300025939 Bacteria 1138
127 Ga0207668_10126999 3300025972 Bacteria 1941
128 Ga0207668_10297708 3300025972 Bacteria 1330
129 Ga0207678_10038399 3300026067 Bacteria 4160
130 Ga0207708_10117937 3300026075 Bacteria 2066
131 Ga0207674_10290190 3300026116 Bacteria 1584
132 Ga0316177_1187600 3300030731 Bacteria 15933
133 Ga0316176_1135095 3300030732 Bacteria 6038
134 Ga0316183_1130548 3300030742 Bacteria 20229
135 Ga0316181_1139466 3300030744 Bacteria 10044
136 Ga0265314_10072977 3300031711 Bacteria 2290
137 Ga0307407_10000001 3300031903 Bacteria 570048
138 Ga0307412_10000012 3300031911 Bacteria 404180
139 Ga0307412_10047875 3300031911 Bacteria 2809
140 Ga0307409_100005777 3300031995 Bacteria 7175
141 Ga0307416_100000008 3300032002 Bacteria 401343
142 Ga0307416_100000010 3300032002 Bacteria 320243
143 Ga0307414_10000503 3300032004 Bacteria 20393
144 Ga0307414_10024147 3300032004 Bacteria 3871
145 Ga0439465_0017203 3300041413 Bacteria 2256
146 Ga0451839_0054704 3300041496 Bacteria 1493
147 Ga0439445_0000039 3300042004 Bacteria 17900
148 Ga0439432_065473 3300042006 Bacteria 1114
149 Ga0466972_0203234 3300044658 Unclassified 928
150 Ga0466957_0071873 3300044842 Unclassified 2141
151 Ga0495627_000003 3300046453 Bacteria 704557
152 Ga0495638_0000015 3300046460 Bacteria 414645
153 Ga0495596_0000771 3300046500 Bacteria 19541
154 Ga0495606_0000002 3300046507 Bacteria 554637
155 Ga0495606_0028165 3300046507 Bacteria 3968
156 Ga0495610_0000001 3300046512 Bacteria 1620061
157 Ga0495610_0001338 3300046512 Bacteria 21856
158 Ga0495610_0036576 3300046512 Unclassified 2507
159 Ga0495632_0008180 3300046519 Bacteria 6459
160 Ga0495637_0003454 3300046520 Bacteria 8397
161 Ga0495654_0000001 3300046530 Bacteria 1513197
162 Ga0495621_0168739 3300046539 Bacteria 869
163 Ga0495633_0000008 3300046558 Bacteria 301830
164 Ga0495633_0001146 3300046558 Bacteria 21264
165 Ga0495633_0001538 3300046558 Bacteria 17716
166 Ga0495633_0002825 3300046558 Bacteria 11971
167 Ga0495625_0001703 3300046660 Bacteria 25608
168 Ga0495661_0005878 3300046665 Bacteria 8672
169 Ga0495661_0009217 3300046665 Bacteria 6782
170 Ga0495613_0079814 3300046689 Bacteria 2379
171 Ga0495687_000739 3300047443 Bacteria 35614
172 Ga0495673_0045941 3300047469 Bacteria 1938
173 Ga0495686_0000040 3300047472 Bacteria 301210
174 Ga0495686_0015778 3300047472 Bacteria 5143
175 Ga0495686_0117234 3300047472 Unclassified 1591
176 Ga0496102_0000534 3300048905 Bacteria 41154
177 Ga0496102_0055747 3300048905 Bacteria 3604
178 Ga0496103_0120449 3300048906 Bacteria 1671
179 Ga0496104_0026788 3300048907 Bacteria 5328
180 Ga0496113_0055286 3300048916 Bacteria 2975
181 Ga0496115_0006636 3300048918 Bacteria 8490
182 Ga0496116_0000012 3300048919 Bacteria 611365
183 Ga0496116_0001564 3300048919 Bacteria 25266
184 Ga0496117_0000050 3300048920 Bacteria 292727
185 Ga0496118_0000044 3300048921 Bacteria 283524
186 Ga0496118_0034838 3300048921 Bacteria 4100
187 Ga0496119_0000002 3300048922 Bacteria 738385
188 Ga0496122_0000090 3300048925 Bacteria 205886
189 Ga0496122_0000465 3300048925 Bacteria 84396
190 Ga0496122_0000658 3300048925 Bacteria 69587
191 Ga0496122_0002721 3300048925 Bacteria 24530
192 Ga0496122_0002758 3300048925 Bacteria 24241
193 Ga0496122_0014407 3300048925 Bacteria 7649
194 Ga0496123_0000856 3300048926 Bacteria 48564
195 Ga0496123_0008334 3300048926 Bacteria 9540
196 Ga0496123_0008808 3300048926 Bacteria 9201
197 Ga0496123_0026427 3300048926 Bacteria 4347
198 Ga0496123_0100792 3300048926 Bacteria 1681
199 Ga0496124_0020102 3300048927 Bacteria 6183
200 Ga0496124_0148002 3300048927 Unclassified 1846
201 Ga0496125_0000349 3300048928 Bacteria 87610
202 Ga0496125_0005317 3300048928 Bacteria 14393
203 Ga0496126_0004122 3300048929 Bacteria 17589
204 Ga0496126_0065412 3300048929 Bacteria 3254
205 Ga0501034_0025469 3300049571 Bacteria 6023
206 Ga0501080_0494079 3300049742 Bacteria 1094
207 Ga0501241_000013 3300049758 Bacteria 104728
208 Ga0501241_000971 3300049758 Bacteria 6058
209 Ga0501269_000241 3300049766 Bacteria 16034
210 nmdc:mga05p37_294771_c1 3300050507 Bacteria 1929
211 nmdc:mga05p37_304356_c2 3300050507 Bacteria 1325
212 nmdc:mga05p37_327868_c1 3300050507 Bacteria 1809
213 nmdc:mga06r32_19895_c1 3300050510 Bacteria 6170
214 nmdc:mga08y16_457362_c1 3300050511 Bacteria 1301
215 nmdc:mga0rr50_146658_c1 3300050513 Bacteria 1903
216 nmdc:mga0a205_134791_c1 3300050515 Unclassified 2370
217 nmdc:mga0a205_608635_c1 3300050515 Bacteria 945
218 Ga0500556_0001275 3300053104 Bacteria 11468
219 Ga0500562_006632 3300053108 Bacteria 2918
220 Ga0500618_021008 3300053125 Bacteria 1596
221 Ga0500616_0035395 3300053153 Bacteria 2715
222 Ga0500645_036857 3300053730 Bacteria 1454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10000038 Ga0105239_1000003892 228
2 3300005343 Ga0070687_100002295 Ga0070687_1000022955 231
3 3300005544 Ga0070686_100135736 Ga0070686_1001357361 231
4 3300025918 Ga0207662_10094395 Ga0207662_100943953 231
5 3300005295 Ga0065707_10111327 Ga0065707_101113272 235
6 3300006871 Ga0075434_100080062 Ga0075434_1000800623 235
7 3300006880 Ga0075429_100194368 Ga0075429_1001943681 235
8 3300006914 Ga0075436_100315826 Ga0075436_1003158262 235
9 3300046539 Ga0495621_0168739 Ga0495621_0168739_70_810 239
10 3300053153 Ga0500616_0035395 Ga0500616_0035395_1692_2540 253
11 iso_pu_bacteria 2929239360 2929242473 258
12 iso_pu_bacteria 2929177148 2929180635 260
13 iso_pu_bacteria 2945977869 2945983034 260
14 iso_pu_bacteria 2946013367 2946017571 260
15 iso_pu_bacteria 2511231000 2511234721 261
16 iso_pu_bacteria 2582581278 2585144695 261
17 iso_pu_bacteria 2582581278 2585144841 261
18 iso_pu_bacteria 2582581281 2585159384 261
19 iso_pu_bacteria 2582581282 2585163659 261
20 iso_pu_bacteria 2585428045 2587679724 261
21 iso_pu_bacteria 2585428060 2587747968 261
22 iso_pu_bacteria 2585428115 2587942981 261
23 iso_pu_bacteria 2585428182 2588208444 261
24 iso_pu_bacteria 2585428183 2588213055 261
25 iso_pu_bacteria 2585428184 2588219646 261
26 iso_pu_bacteria 2585428185 2588224043 261
27 iso_pu_bacteria 2585428187 2588233554 261
28 iso_pu_bacteria 2588253712 2588446340 261
29 iso_pu_bacteria 2588254255 2590601028 261
30 iso_pu_bacteria 2588254257 2590611630 261
31 iso_pu_bacteria 2588254257 2590612784 261
32 iso_pu_bacteria 2643221725 2644686017 261
33 iso_pu_bacteria 2728369107 2729201614 261
34 iso_pu_bacteria 2739367874 2740057526 261
35 iso_pu_bacteria 2765235839 2765572431 261
36 iso_pu_bacteria 2765235839 2765573483 261
37 iso_pu_bacteria 2816332188 2816872716 261
38 iso_pu_bacteria 2842083920 2842084114 261
39 iso_pu_bacteria 2871720351 2871721691 261
40 iso_pu_bacteria 2871720351 2871721758 261
41 iso_pu_bacteria 2889290771 2889291932 261
42 iso_pu_bacteria 2905999023 2906000883 261
43 iso_pu_bacteria 2919399522 2919402812 261
44 iso_pu_bacteria 2945924605 2945927425 261
45 iso_pu_bacteria 2946019816 2946021309 261
46 iso_pu_bacteria 2775506739 2775672984 262
47 iso_pu_bacteria 2919097161 2919099402 262
48 iso_pu_bacteria 2585428187 2588234341 263
49 iso_pu_bacteria 2721755487 2722728885 263
50 iso_pu_bacteria 2842903701 2842904622 263
51 iso_pu_bacteria 2914759650 2914760809 263
52 3300002737 JGI25162J39368_1000145 JGI25162J39368_100014533 264
53 3300003316 rootH1_10184646 rootH1_101846461 264
54 3300003320 rootH2_10013724 rootH2_100137243 264
55 3300003322 rootL2_10113050 rootL2_101130502 264
56 3300003763 Ga0055529_1005928 Ga0055529_10059282 264
57 3300003794 Ga0055531_10000063 Ga0055531_1000006321 264
58 3300005577 Ga0068857_100047917 Ga0068857_1000479174 264
59 3300013308 Ga0157375_10040571 Ga0157375_100405713 264
60 3300014325 Ga0163163_10090004 Ga0163163_100900044 264
61 3300025233 Ga0209437_100225 Ga0209437_10022539 264
62 3300025258 Ga0209129_1006895 Ga0209129_10068953 264
63 3300025272 Ga0209455_1006265 Ga0209455_10062652 264
64 3300025304 Ga0209257_1000008 Ga0209257_1000008813 264
65 3300026116 Ga0207674_10290190 Ga0207674_102901902 264
66 3300046460 Ga0495638_0000015 Ga0495638_0000015_87703_88500 264
67 3300046507 Ga0495606_0028165 Ga0495606_0028165_990_1790 264
68 3300046512 Ga0495610_0036576 Ga0495610_0036576_1478_2284 264
69 3300046558 Ga0495633_0002825 Ga0495633_0002825_290_1096 264
70 3300046665 Ga0495661_0005878 Ga0495661_0005878_4995_5801 264
71 3300046665 Ga0495661_0009217 Ga0495661_0009217_5344_6150 264
72 3300047443 Ga0495687_000739 Ga0495687_000739_24093_24893 264
73 3300047469 Ga0495673_0045941 Ga0495673_0045941_82_888 264
74 3300047472 Ga0495686_0000040 Ga0495686_0000040_15934_16734 264
75 3300047472 Ga0495686_0117234 Ga0495686_0117234_491_1294 264
76 3300053125 Ga0500618_021008 Ga0500618_021008_31_837 264
77 2162886007 SwRhRL2b_contig_815651 SwRhRL2b_0894.00007360 265
78 3300001915 JGI24741J21665_1002423 JGI24741J21665_10024232 265
79 3300003320 rootH2_10033173 rootH2_100331733 265
80 3300003320 rootH2_10198102 rootH2_101981022 265
81 3300003323 rootH1_10324645 rootH1_103246452 265
82 3300003784 Ga0055534_1006174 Ga0055534_10061743 265
83 3300005289 Ga0065704_10071392 Ga0065704_1007139215 265
84 3300005337 Ga0070682_100000245 Ga0070682_10000024524 265
85 3300005339 Ga0070660_100044482 Ga0070660_1000444822 265
86 3300005347 Ga0070668_100311808 Ga0070668_1003118082 265
87 3300009036 Ga0105244_10000244 Ga0105244_1000024421 265
88 3300009148 Ga0105243_10000127 Ga0105243_1000012768 265
89 3300009148 Ga0105243_10085427 Ga0105243_100854272 265
90 3300009148 Ga0105243_10164679 Ga0105243_101646793 265
91 3300011119 Ga0105246_10102034 Ga0105246_101020342 265
92 3300015261 Ga0182006_1000011 Ga0182006_1000011175 265
93 3300025291 Ga0209675_1000032 Ga0209675_1000032202 265
94 3300025728 Ga0207655_1000702 Ga0207655_10007025 265
95 3300025908 Ga0207643_10201270 Ga0207643_102012702 265
96 3300025919 Ga0207657_10131850 Ga0207657_101318502 265
97 3300025935 Ga0207709_10000176 Ga0207709_1000017668 265
98 3300025935 Ga0207709_10000458 Ga0207709_1000045812 265
99 3300025938 Ga0207704_10098698 Ga0207704_100986982 265
100 3300025972 Ga0207668_10297708 Ga0207668_102977081 265
101 3300026067 Ga0207678_10038399 Ga0207678_100383995 265
102 3300031911 Ga0307412_10000012 Ga0307412_10000012279 265
103 3300031911 Ga0307412_10047875 Ga0307412_100478753 265
104 3300032002 Ga0307416_100000010 Ga0307416_100000010262 265
105 3300046453 Ga0495627_000003 Ga0495627_000003_447140_447937 265
106 3300046500 Ga0495596_0000771 Ga0495596_0000771_935_1732 265
107 3300046512 Ga0495610_0000001 Ga0495610_0000001_1380897_1381694 265
108 3300046530 Ga0495654_0000001 Ga0495654_0000001_671486_672283 265
109 3300046558 Ga0495633_0001538 Ga0495633_0001538_6946_7743 265
110 3300047472 Ga0495686_0015778 Ga0495686_0015778_955_1752 265
111 3300048905 Ga0496102_0055747 Ga0496102_0055747_592_1389 265
112 3300048906 Ga0496103_0120449 Ga0496103_0120449_856_1653 265
113 3300048916 Ga0496113_0055286 Ga0496113_0055286_1025_1822 265
114 3300048919 Ga0496116_0000012 Ga0496116_0000012_24202_24999 265
115 3300048920 Ga0496117_0000050 Ga0496117_0000050_95447_96244 265
116 3300048921 Ga0496118_0000044 Ga0496118_0000044_196511_197308 265
117 3300048922 Ga0496119_0000002 Ga0496119_0000002_198689_199486 265
118 3300048925 Ga0496122_0000465 Ga0496122_0000465_22652_23449 265
119 3300048925 Ga0496122_0000658 Ga0496122_0000658_45812_46609 265
120 3300048925 Ga0496122_0002721 Ga0496122_0002721_22702_23499 265
121 3300048925 Ga0496122_0002758 Ga0496122_0002758_15498_16295 265
122 3300048926 Ga0496123_0000856 Ga0496123_0000856_16586_17383 265
123 3300048926 Ga0496123_0100792 Ga0496123_0100792_320_1117 265
124 3300048927 Ga0496124_0020102 Ga0496124_0020102_3930_4727 265
125 3300048927 Ga0496124_0148002 Ga0496124_0148002_258_1106 265
126 3300048928 Ga0496125_0000349 Ga0496125_0000349_23778_24575 265
127 3300048928 Ga0496125_0005317 Ga0496125_0005317_3355_4152 265
128 3300048929 Ga0496126_0004122 Ga0496126_0004122_15679_16476 265
129 3300049571 Ga0501034_0025469 Ga0501034_0025469_4305_5108 265
130 3300053104 Ga0500556_0001275 Ga0500556_0001275_762_1610 265
131 3300053108 Ga0500562_006632 Ga0500562_006632_756_1604 265
132 3300053730 Ga0500645_036857 Ga0500645_036857_59_907 265
133 3300003320 rootH2_10079232 rootH2_100792326 266
134 3300005288 Ga0065714_10030919 Ga0065714_100309192 266
135 3300005347 Ga0070668_100128303 Ga0070668_1001283031 266
136 3300009036 Ga0105244_10032351 Ga0105244_100323515 266
137 3300009093 Ga0105240_10000098 Ga0105240_1000009837 266
138 3300009545 Ga0105237_10017970 Ga0105237_100179702 266
139 3300010375 Ga0105239_10000193 Ga0105239_1000019326 266
140 3300010375 Ga0105239_10296018 Ga0105239_102960182 266
141 3300013104 Ga0157370_10369100 Ga0157370_103691002 266
142 3300013105 Ga0157369_10000046 Ga0157369_10000046123 266
143 3300015261 Ga0182006_1000243 Ga0182006_100024334 266
144 3300015262 Ga0182007_10000009 Ga0182007_1000000985 266
145 3300017792 Ga0163161_10000179 Ga0163161_1000017940 266
146 3300017792 Ga0163161_10000301 Ga0163161_100003016 266
147 3300017792 Ga0163161_10007031 Ga0163161_100070312 266
148 3300025904 Ga0207647_10002872 Ga0207647_100028727 266
149 3300025913 Ga0207695_10000041 Ga0207695_10000041355 266
150 3300025913 Ga0207695_10013161 Ga0207695_100131617 266
151 3300025914 Ga0207671_10011162 Ga0207671_100111625 266
152 3300025972 Ga0207668_10126999 Ga0207668_101269992 266
153 3300031711 Ga0265314_10072977 Ga0265314_100729772 266
154 3300031903 Ga0307407_10000001 Ga0307407_1000000141 266
155 3300031995 Ga0307409_100005777 Ga0307409_1000057779 266
156 3300032002 Ga0307416_100000008 Ga0307416_100000008348 266
157 3300032004 Ga0307414_10000503 Ga0307414_100005038 266
158 3300032004 Ga0307414_10024147 Ga0307414_100241471 266
159 3300041413 Ga0439465_0017203 Ga0439465_0017203_1446_2246 266
160 3300042006 Ga0439432_065473 Ga0439432_065473_244_1044 266
161 3300044658 Ga0466972_0203234 Ga0466972_0203234_80_883 266
162 3300044842 Ga0466957_0071873 Ga0466957_0071873_375_1178 266
163 3300046512 Ga0495610_0001338 Ga0495610_0001338_3704_4507 266
164 3300046520 Ga0495637_0003454 Ga0495637_0003454_1739_2542 266
165 3300049758 Ga0501241_000013 Ga0501241_000013_4911_5711 266
166 3300049766 Ga0501269_000241 Ga0501269_000241_14550_15350 266
167 2162886007 SwRhRL2b_contig_2390258 SwRhRL2b_0091.00004770 267
168 3300003794 Ga0055531_10000311 Ga0055531_1000031112 267
169 3300005288 Ga0065714_10091735 Ga0065714_100917352 267
170 3300005289 Ga0065704_10185694 Ga0065704_101856941 267
171 3300005467 Ga0070706_100532804 Ga0070706_1005328041 267
172 3300005468 Ga0070707_100755751 Ga0070707_1007557511 267
173 3300005518 Ga0070699_100317504 Ga0070699_1003175041 267
174 3300009147 Ga0114129_10447672 Ga0114129_104476721 267
175 3300013100 Ga0157373_10016509 Ga0157373_100165096 267
176 3300013104 Ga0157370_10148151 Ga0157370_101481512 267
177 3300025304 Ga0209257_1000001 Ga0209257_1000001216 267
178 3300025910 Ga0207684_10388597 Ga0207684_103885971 267
179 3300025911 Ga0207654_10111183 Ga0207654_101111832 267
180 3300030731 Ga0316177_1187600 Ga0316177_11876009 267
181 3300030732 Ga0316176_1135095 Ga0316176_11350953 267
182 3300030742 Ga0316183_1130548 Ga0316183_11305487 267
183 3300030744 Ga0316181_1139466 Ga0316181_11394662 267
184 3300046519 Ga0495632_0008180 Ga0495632_0008180_1150_1953 267
185 3300046558 Ga0495633_0001146 Ga0495633_0001146_8926_9729 267
186 3300046660 Ga0495625_0001703 Ga0495625_0001703_15823_16626 267
187 3300049742 Ga0501080_0494079 Ga0501080_0494079_79_921 267
188 3300005445 Ga0070708_100485105 Ga0070708_1004851051 268
189 3300005467 Ga0070706_100131001 Ga0070706_1001310012 268
190 3300005467 Ga0070706_100165462 Ga0070706_1001654622 268
191 3300005468 Ga0070707_100019613 Ga0070707_1000196139 268
192 3300025910 Ga0207684_10012650 Ga0207684_100126502 268
193 3300025922 Ga0207646_10005421 Ga0207646_100054211 268
194 3300005444 Ga0070694_100160609 Ga0070694_1001606092 269
195 3300005468 Ga0070707_100038318 Ga0070707_1000383185 269
196 3300005549 Ga0070704_100048897 Ga0070704_1000488971 269
197 3300009147 Ga0114129_10012303 Ga0114129_100123033 269
198 3300025922 Ga0207646_10308783 Ga0207646_103087832 269
199 3300025933 Ga0207706_10455014 Ga0207706_104550141 269
200 3300050513 nmdc:mga0rr50_146658_c1 nmdc:mga0rr50_146658_c1_91_912 269
201 3300005295 Ga0065707_10277080 Ga0065707_102770801 271
202 3300005471 Ga0070698_100272007 Ga0070698_1002720072 271
203 3300005536 Ga0070697_100000735 Ga0070697_10000073516 271
204 3300005546 Ga0070696_100057352 Ga0070696_1000573522 271
205 3300005549 Ga0070704_100011434 Ga0070704_1000114347 271
206 3300006173 Ga0070716_100001938 Ga0070716_10000193810 271
207 3300006173 Ga0070716_100026970 Ga0070716_1000269705 271
208 3300006175 Ga0070712_100006270 Ga0070712_1000062708 271
209 3300006844 Ga0075428_100460466 Ga0075428_1004604661 271
210 3300006852 Ga0075433_10179528 Ga0075433_101795281 271
211 3300006871 Ga0075434_100293176 Ga0075434_1002931761 271
212 3300006880 Ga0075429_100011631 Ga0075429_1000116313 271
213 3300007265 Ga0099794_10029215 Ga0099794_100292152 271
214 3300009147 Ga0114129_10068332 Ga0114129_100683327 271
215 3300009147 Ga0114129_10130842 Ga0114129_101308424 271
216 3300009147 Ga0114129_10358010 Ga0114129_103580102 271
217 3300009147 Ga0114129_10459901 Ga0114129_104599012 271
218 3300009147 Ga0114129_10500841 Ga0114129_105008412 271
219 3300009147 Ga0114129_11062648 Ga0114129_110626481 271
220 3300009174 Ga0105241_10100933 Ga0105241_101009332 271
221 3300013297 Ga0157378_10277937 Ga0157378_102779372 271
222 3300013306 Ga0163162_10203754 Ga0163162_102037542 271
223 3300014969 Ga0157376_10853290 Ga0157376_108532901 271
224 3300025911 Ga0207654_10069067 Ga0207654_100690672 271
225 3300025929 Ga0207664_10171567 Ga0207664_101715673 271
226 3300025939 Ga0207665_10009157 Ga0207665_100091578 271
227 3300025939 Ga0207665_10335300 Ga0207665_103353002 271
228 3300041496 Ga0451839_0054704 Ga0451839_0054704_554_1375 271
229 3300046689 Ga0495613_0079814 Ga0495613_0079814_77_901 271
230 3300048905 Ga0496102_0000534 Ga0496102_0000534_9729_10568 271
231 3300048907 Ga0496104_0026788 Ga0496104_0026788_4307_5146 271
232 3300048925 Ga0496122_0000090 Ga0496122_0000090_65438_66277 271
233 3300048926 Ga0496123_0008334 Ga0496123_0008334_221_1060 271
234 3300049758 Ga0501241_000971 Ga0501241_000971_1993_2817 271
235 3300050507 nmdc:mga05p37_294771_c1 nmdc:mga05p37_294771_c1_865_1686 271
236 3300050507 nmdc:mga05p37_304356_c2 nmdc:mga05p37_304356_c2_216_1037 271
237 3300050507 nmdc:mga05p37_327868_c1 nmdc:mga05p37_327868_c1_232_1053 271
238 3300050510 nmdc:mga06r32_19895_c1 nmdc:mga06r32_19895_c1_5181_6002 271
239 3300050511 nmdc:mga08y16_457362_c1 nmdc:mga08y16_457362_c1_189_1010 271
240 3300005468 Ga0070707_100002916 Ga0070707_10000291614 272
241 3300010375 Ga0105239_10079922 Ga0105239_100799226 272
242 3300025885 Ga0207653_10028116 Ga0207653_100281162 272
243 3300025910 Ga0207684_10018550 Ga0207684_100185503 272
244 3300025922 Ga0207646_10007087 Ga0207646_1000708713 272
245 3300046507 Ga0495606_0000002 Ga0495606_0000002_337983_338837 272
246 3300048929 Ga0496126_0065412 Ga0496126_0065412_373_1260 273
247 3300050515 nmdc:mga0a205_134791_c1 nmdc:mga0a205_134791_c1_607_1437 273
248 3300005440 Ga0070705_100022111 Ga0070705_1000221113 274
249 3300005518 Ga0070699_100110269 Ga0070699_1001102692 274
250 3300026075 Ga0207708_10117937 Ga0207708_101179372 274
251 iso_pu_bacteria 2585428045 2587679692 275
252 iso_pu_bacteria 2588254255 2590600996 275
253 3300005289 Ga0065704_10078270 Ga0065704_100782704 277
254 3300009148 Ga0105243_10000408 Ga0105243_1000040833 277
255 3300048925 Ga0496122_0000090 Ga0496122_0000090_29449_30354 277
256 3300048926 Ga0496123_0008808 Ga0496123_0008808_7192_8097 277
257 3300050515 nmdc:mga0a205_608635_c1 nmdc:mga0a205_608635_c1_43_906 280
258 3300042004 Ga0439445_0000039 Ga0439445_0000039_7977_8822 281
259 3300048918 Ga0496115_0006636 Ga0496115_0006636_535_1425 281
260 3300048919 Ga0496116_0001564 Ga0496116_0001564_15913_16761 282
261 3300048921 Ga0496118_0034838 Ga0496118_0034838_2925_3773 282
262 3300048925 Ga0496122_0014407 Ga0496122_0014407_3737_4585 282
263 3300048926 Ga0496123_0026427 Ga0496123_0026427_1773_2621 282
264 3300046558 Ga0495633_0000008 Ga0495633_0000008_102925_103830 289
265 3300013104 Ga0157370_10022173 Ga0157370_100221733 296
266 2162886007 SwRhRL2b_contig_1590904 SwRhRL2b_0174.00002380 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

54

241

0.95

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

58

285

0.91

PF08659

KR

KR domain

54

225

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

293

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

60

232

0.8

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

56

213

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fdu-assembly1.cif.gz_A human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with estradiol and nadp+ 0.9148 33 296
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9126 33 271
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9121 34 275
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9084 32 269
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9067 34 268
ID Description Score Start End Superfamily
af_P0CU01_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9512 65 294 3.40.50.720
af_P0CU01_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 65 294 3.40.50.720
af_B4FAP3_11_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 33 275 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9226 28 203 3.40.50.720
af_Q54HS2_3_244_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9218 33 264 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A232LMN1-F1-model_v4 Uncharacterized protein 0.9886 64 163 GO:0016491
AF-A0A1A8VD90-F1-model_v4 Retinol dehydrogenase 8b 0.9795 106 203 GO:0004745
GO:0005829
GO:0016020
GO:0042572
AF-A0A232LMN1-F1-model_v4 Uncharacterized protein 0.9694 64 163 GO:0016491
AF-A0A529HNC3-F1-model_v4 SDR family oxidoreductase 0.9692 85 208 GO:0016491
AF-A0A2N7U5K0-F1-model_v4 Short-chain dehydrogenase/reductase 0.964 32 296 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.83 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map