F374048

General Info

Members Datasets Scaffolds Average Seq Length
266 124 532 165

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10193463|Ga0105241_101934632
Length 178
Sequence MPSPSAFDDRWQGEAMSELKSIELLNKAVADELATVHQYMYFHFHLDDQGFEPLATLFKRTAITEMGHIEKLAERILFLKGDVEMVAGFAVVRLTDPIKILAKAAEMESNSARDYNKWARECAENLDAASKKIFEELVGDEEMHFGAFDKQQEHIRQFGPAYLALQSFGKEAPASVGA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
78 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
79 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
80 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
81 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
91 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
92 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
93 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
94 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
95 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
96 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
97 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
98 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
124 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 3.38
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.01
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10193463 3300009174 Bacteria 1694
2 Ga0070676_10062953 3300005328 Bacteria 2209
3 Ga0070683_100670890 3300005329 Bacteria 993
4 Ga0070670_100810651 3300005331 Unclassified 846
5 Ga0068869_100837801 3300005334 Bacteria 793
6 Ga0070666_10016204 3300005335 Unclassified 4766
7 Ga0068868_100044771 3300005338 Bacteria 3460
8 Ga0070689_100788181 3300005340 Bacteria 835
9 Ga0070668_100084726 3300005347 Bacteria 2490
10 Ga0070675_100100766 3300005354 Bacteria 2432
11 Ga0070673_100054233 3300005364 Unclassified 3153
12 Ga0070673_100157924 3300005364 Bacteria 1926
13 Ga0070667_100106951 3300005367 Bacteria 2421
14 Ga0070678_100040057 3300005456 Bacteria 3313
15 Ga0068867_100220149 3300005459 Bacteria 1529
16 Ga0068853_100463597 3300005539 Bacteria 1193
17 Ga0070672_100073792 3300005543 Bacteria 2720
18 Ga0070686_101286366 3300005544 Bacteria 610
19 Ga0070665_100094741 3300005548 Bacteria 2990
20 Ga0070665_100201246 3300005548 Bacteria 1992
21 Ga0068855_100257624 3300005563 Bacteria 1944
22 Ga0070664_100220043 3300005564 Bacteria 1699
23 Ga0068854_100440920 3300005578 Bacteria 1085
24 Ga0068856_101303365 3300005614 Bacteria 741
25 Ga0070702_100817090 3300005615 Bacteria 722
26 Ga0068859_100636534 3300005617 Bacteria 1159
27 Ga0068859_100691534 3300005617 Bacteria 1111
28 Ga0068864_100129218 3300005618 Bacteria 2267
29 Ga0068863_100313864 3300005841 Bacteria 1522
30 Ga0097621_100123862 3300006237 Bacteria 2194
31 Ga0097621_100587772 3300006237 Bacteria 1017
32 Ga0068865_100061488 3300006881 Bacteria 2633
33 Ga0097620_100636539 3300006931 Bacteria 1159
34 Ga0097620_100691529 3300006931 Bacteria 1111
35 Ga0105242_10173834 3300009176 Bacteria 1895
36 Ga0105248_10116870 3300009177 Bacteria 3008
37 Ga0105248_10839592 3300009177 Bacteria 1037
38 Ga0105248_11874498 3300009177 Unclassified 680
39 Ga0105237_10101946 3300009545 Bacteria 2862
40 Ga0105238_10579544 3300009551 Bacteria 1128
41 Ga0105239_10466126 3300010375 Bacteria 1434
42 Ga0157371_10161925 3300013102 Bacteria 1598
43 Ga0157369_10333999 3300013105 Bacteria 1574
44 Ga0157374_10296420 3300013296 Bacteria 1599
45 Ga0157374_10691292 3300013296 Unclassified 1033
46 Ga0157378_10279818 3300013297 Bacteria 1608
47 Ga0163162_10542986 3300013306 Bacteria 1291
48 Ga0157375_10105217 3300013308 Bacteria 2912
49 Ga0157375_10714941 3300013308 Bacteria 1155
50 Ga0157375_10843394 3300013308 Bacteria 1063
51 Ga0163163_10051929 3300014325 Bacteria 4043
52 Ga0163163_10614296 3300014325 Bacteria 1150
53 Ga0157379_11218789 3300014968 Bacteria 724
54 Ga0157376_10068809 3300014969 Unclassified 2999
55 Ga0207656_10295279 3300025321 Unclassified 801
56 Ga0207688_10144472 3300025901 Bacteria 1402
57 Ga0207645_10075485 3300025907 Bacteria 2158
58 Ga0207654_10081868 3300025911 Bacteria 1945
59 Ga0207671_10148312 3300025914 Bacteria 1811
60 Ga0207650_10464741 3300025925 Bacteria 1054
61 Ga0207706_10002815 3300025933 Bacteria 16887
62 Ga0207704_10589964 3300025938 Bacteria 908
63 Ga0207691_10080813 3300025940 Bacteria 2923
64 Ga0207711_11161608 3300025941 Unclassified 713
65 Ga0207679_10212711 3300025945 Bacteria 1622
66 Ga0207651_10318060 3300025960 Bacteria 1300
67 Ga0207668_10554284 3300025972 Bacteria 996
68 Ga0207640_11011103 3300025981 Unclassified 732
69 Ga0207677_10081974 3300026023 Bacteria 2317
70 Ga0207639_10378089 3300026041 Bacteria 1271
71 Ga0207641_10198413 3300026088 Bacteria 1849
72 Ga0207676_10106045 3300026095 Bacteria 2341
73 Ga0207683_10202773 3300026121 Bacteria 1803
74 Ga0268266_10082516 3300028379 Bacteria 2805
75 Ga0268264_10173199 3300028381 Bacteria 1954
76 Ga0265318_10036318 3300028577 Bacteria 1891
77 Ga0265330_10027306 3300031235 Bacteria 2579
78 Ga0265332_10054063 3300031238 Bacteria 1723
79 Ga0265339_10003921 3300031249 Bacteria 10298
80 Ga0265331_10001029 3300031250 Bacteria 21757
81 Ga0265316_10023062 3300031344 Bacteria 5234
82 Ga0265316_10065104 3300031344 Bacteria 2823
83 Ga0265316_10324027 3300031344 Unclassified 1119
84 Ga0316575_10004206 3300031665 Bacteria 5052
85 Ga0316575_10011084 3300031665 Bacteria 3328
86 Ga0316575_10023157 3300031665 Bacteria 2399
87 Ga0316575_10075036 3300031665 Bacteria 1361
88 Ga0316575_10092708 3300031665 Bacteria 1224
89 Ga0316579_10005724 3300031691 Bacteria 5034
90 Ga0316579_10015731 3300031691 Bacteria 3291
91 Ga0316579_10030964 3300031691 Bacteria 2447
92 Ga0316579_10041300 3300031691 Bacteria 2141
93 Ga0316579_10145091 3300031691 Unclassified 1145
94 Ga0265314_10009265 3300031711 Bacteria 8339
95 Ga0265314_10364118 3300031711 Unclassified 792
96 Ga0265342_10006356 3300031712 Bacteria 8810
97 Ga0316576_10005420 3300031727 Bacteria 7790
98 Ga0316576_10005453 3300031727 Bacteria 7776
99 Ga0316576_10008226 3300031727 Bacteria 6632
100 Ga0316576_10019706 3300031727 Bacteria 4626
101 Ga0316576_10060799 3300031727 Unclassified 2768
102 Ga0316576_10068886 3300031727 Bacteria 2608
103 Ga0316576_10154391 3300031727 Unclassified 1730
104 Ga0316576_10204509 3300031727 Bacteria 1487
105 Ga0316576_10240662 3300031727 Bacteria 1360
106 Ga0316576_10259102 3300031727 Bacteria 1305
107 Ga0316576_10278119 3300031727 Unclassified 1254
108 Ga0316576_10295651 3300031727 Unclassified 1211
109 Ga0316576_10329818 3300031727 Unclassified 1137
110 Ga0316576_10392231 3300031727 Bacteria 1030
111 Ga0316576_10403407 3300031727 Bacteria 1013
112 Ga0316576_10409527 3300031727 Bacteria 1004
113 Ga0316576_10540833 3300031727 Bacteria 854
114 Ga0316576_10705351 3300031727 Bacteria 731
115 Ga0316576_10735825 3300031727 Bacteria 713
116 Ga0316576_10812177 3300031727 Bacteria 673
117 Ga0316578_10001584 3300031728 Bacteria 9381
118 Ga0316578_10003024 3300031728 Bacteria 7575
119 Ga0316578_10015682 3300031728 Bacteria 4081
120 Ga0316578_10023079 3300031728 Bacteria 3479
121 Ga0316578_10030245 3300031728 Bacteria 3077
122 Ga0316578_10038884 3300031728 Bacteria 2746
123 Ga0316578_10060758 3300031728 Bacteria 2225
124 Ga0316578_10071958 3300031728 Bacteria 2047
125 Ga0316578_10077548 3300031728 Bacteria 1973
126 Ga0316578_10130047 3300031728 Bacteria 1515
127 Ga0316578_10168672 3300031728 Unclassified 1319
128 Ga0316578_10171729 3300031728 Unclassified 1307
129 Ga0316578_10333042 3300031728 Unclassified 905
130 Ga0316577_10005968 3300031733 Bacteria 6416
131 Ga0316577_10007960 3300031733 Bacteria 5661
132 Ga0316577_10008041 3300031733 Bacteria 5639
133 Ga0316577_10034222 3300031733 Bacteria 2839
134 Ga0316577_10054073 3300031733 Bacteria 2241
135 Ga0316577_10062125 3300031733 Unclassified 2085
136 Ga0316577_10240356 3300031733 Bacteria 1024
137 Ga0316577_10318781 3300031733 Bacteria 881
138 Ga0316577_10429959 3300031733 Bacteria 750
139 Ga0316577_10479329 3300031733 Bacteria 707
140 Ga0316583_10003602 3300032133 Bacteria 5470
141 Ga0316583_10060138 3300032133 Bacteria 1332
142 Ga0316583_10060796 3300032133 Unclassified 1324
143 Ga0316583_10131767 3300032133 Bacteria 871
144 Ga0316583_10146716 3300032133 Bacteria 822
145 Ga0316583_10187493 3300032133 Bacteria 719
146 Ga0316583_10195598 3300032133 Bacteria 702
147 Ga0316585_10080221 3300032137 Bacteria 1062
148 Ga0316585_10213814 3300032137 Bacteria 638
149 Ga0316580_10016665 3300032139 Bacteria 2256
150 Ga0316593_10030737 3300032168 Bacteria 1746
151 Ga0316593_10044461 3300032168 Bacteria 1487
152 Ga0316592_1013173 3300033524 Bacteria 1702
153 Ga0316586_1071844 3300033527 Bacteria 638
154 Ga0316588_1003944 3300033528 Bacteria 2761
155 Ga0316587_1012774 3300033529 Bacteria 1368
156 Ga0316596_1009927 3300033541 Bacteria 2293
157 Ga0316596_1010125 3300033541 Bacteria 2276
158 Ga0316596_1120597 3300033541 Bacteria 714
159 Ga0316574_0000670 3300035398 Bacteria 14474
160 Ga0316574_0008766 3300035398 Bacteria 5632
161 Ga0316574_0017669 3300035398 Bacteria 4179
162 Ga0316574_0027784 3300035398 Bacteria 3409
163 Ga0316574_0037127 3300035398 Bacteria 2986
164 Ga0316574_0057127 3300035398 Unclassified 2442
165 Ga0316574_0124695 3300035398 Bacteria 1655
166 Ga0316574_0288673 3300035398 Bacteria 1044
167 Ga0316574_0296645 3300035398 Bacteria 1028
168 Ga0316574_0382538 3300035398 Bacteria 888
169 Ga0316574_0729545 3300035398 Bacteria 606
170 Ga0316582_0001086 3300036647 Bacteria 11459
171 Ga0316582_0009959 3300036647 Bacteria 5184
172 Ga0316582_0013236 3300036647 Unclassified 4638
173 Ga0316582_0017445 3300036647 Bacteria 4154
174 Ga0316582_0030374 3300036647 Bacteria 3292
175 Ga0316582_0052578 3300036647 Bacteria 2589
176 Ga0316582_0060973 3300036647 Bacteria 2419
177 Ga0316582_0106828 3300036647 Unclassified 1859
178 Ga0316582_0110738 3300036647 Bacteria 1827
179 Ga0316582_0150384 3300036647 Bacteria 1574
180 Ga0316582_0238749 3300036647 Bacteria 1245
181 Ga0316582_0258245 3300036647 Bacteria 1194
182 Ga0316582_0354880 3300036647 Bacteria 1009
183 Ga0316582_0357147 3300036647 Bacteria 1005
184 Ga0316582_0420484 3300036647 Bacteria 921
185 Ga0316582_0445245 3300036647 Bacteria 893
186 Ga0316582_0530556 3300036647 Bacteria 811
187 Ga0316582_0921735 3300036647 Unclassified 597
188 Ga0316582_0926421 3300036647 Unclassified 596
189 Ga0316584_0000078 3300036712 Bacteria 38231
190 Ga0316584_0001489 3300036712 Bacteria 14081
191 Ga0316584_0004455 3300036712 Bacteria 9268
192 Ga0316584_0006978 3300036712 Bacteria 7684
193 Ga0316584_0016170 3300036712 Bacteria 5346
194 Ga0316584_0039391 3300036712 Bacteria 3518
195 Ga0316584_0048374 3300036712 Bacteria 3177
196 Ga0316584_0055996 3300036712 Bacteria 2952
197 Ga0316584_0099202 3300036712 Bacteria 2181
198 Ga0316584_0159056 3300036712 Bacteria 1679
199 Ga0316584_0170302 3300036712 Bacteria 1616
200 Ga0316584_0179821 3300036712 Bacteria 1566
201 Ga0316584_0245924 3300036712 Bacteria 1308
202 Ga0316584_0386736 3300036712 Bacteria 999
203 Ga0316584_0402844 3300036712 Bacteria 974
204 Ga0316584_0545632 3300036712 Unclassified 810
205 Ga0316584_0620514 3300036712 Bacteria 748
206 Ga0316584_0701622 3300036712 Bacteria 694
207 Ga0316584_0936611 3300036712 Unclassified 581
208 Ga0316581_0005135 3300037588 Bacteria 3389
209 Ga0316581_0014317 3300037588 Bacteria 2257
210 Ga0316581_0025861 3300037588 Unclassified 1748
211 Ga0400484_00413 3300038725 Bacteria 5594
212 Ga0400484_06594 3300038725 Unclassified 2919
213 Ga0400484_28409 3300038725 Bacteria 3947
214 Ga0400484_41436 3300038725 Bacteria 16055
215 Ga0400484_41542 3300038725 Bacteria 8021
216 Ga0400490_15193 3300038726 Unclassified 1513
217 Ga0400490_33886 3300038726 Bacteria 2179
218 Ga0400490_36327 3300038726 Bacteria 27463
219 Ga0400490_49913 3300038726 Bacteria 6890
220 Ga0400485_03056 3300038735 Bacteria 1746
221 Ga0400485_11721 3300038735 Bacteria 4940
222 Ga0400488_12122 3300038741 Bacteria 4401
223 Ga0400488_54534 3300038741 Bacteria 1766
224 Ga0400486_04861 3300038742 Bacteria 1098
225 Ga0400486_24771 3300038742 Bacteria 8648
226 Ga0400483_033705 3300039062 Bacteria 1624
227 Ga0400483_079955 3300039062 Bacteria 2016
228 Ga0400483_082191 3300039062 Unclassified 1031
229 Ga0400483_123122 3300039062 Unclassified 2978
230 Ga0400483_132144 3300039062 Bacteria 7687
231 Ga0400483_246987 3300039062 Bacteria 3755
232 Ga0400483_267483 3300039062 Bacteria 2247
233 Ga0400483_288132 3300039062 Bacteria 1075
234 Ga0400489_03234 3300039093 Unclassified 3194
235 Ga0400487_12173 3300039110 Bacteria 2214
236 Ga0400487_16163 3300039110 Bacteria 5154
237 Ga0439433_0114776 3300041999 Unclassified 676
238 Ga0451577_0256502 3300042876 Bacteria 1583
239 Ga0453684_0011025 3300044712 Bacteria 15269
240 Ga0453684_0018760 3300044712 Bacteria 10589
241 Ga0453684_0228045 3300044712 Unclassified 2152
242 Ga0453684_0314684 3300044712 Bacteria 1775
243 Ga0453684_0590752 3300044712 Bacteria 1218
244 Ga0495639_0233206 3300046475 Bacteria 907
245 Ga0495634_0164185 3300046642 Bacteria 1398
246 Ga0495581_0473518 3300047315 Unclassified 729
247 Ga0495676_0409521 3300047321 Bacteria 899
248 Ga0496100_0047743 3300048903 Bacteria 2761
249 Ga0496101_0036000 3300048904 Bacteria 3504
250 Ga0496102_1820030 3300048905 Bacteria 526
251 Ga0496104_0011935 3300048907 Bacteria 7793
252 Ga0496106_0329029 3300048909 Bacteria 1227
253 Ga0496108_0872964 3300048911 Unclassified 773
254 Ga0496110_0747798 3300048913 Bacteria 881
255 Ga0496115_0116294 3300048918 Bacteria 2199
256 Ga0501034_0701179 3300049571 Bacteria 911
257 Ga0501074_0293117 3300049590 Bacteria 1156
258 Ga0501075_1031317 3300049591 Bacteria 625
259 Ga0501076_0023916 3300049592 Bacteria 4714
260 Ga0501079_0046419 3300049741 Bacteria 3352
261 Ga0501080_0181554 3300049742 Unclassified 1936
262 Ga0501081_0076110 3300049743 Bacteria 2343
263 Ga0495619_0359659 3300053085 Bacteria 1007
264 Ga0501082_0000439 3300060353 Bacteria 36880
265 Ga0530510_0503214 3300061734 Bacteria 918
266 2836160344 2836160341 Unclassified 5867367
267 Ga0105241_10193463
268 Ga0070676_10062953
269 Ga0070683_100670890
270 Ga0070670_100810651
271 Ga0068869_100837801
272 Ga0070666_10016204
273 Ga0068868_100044771
274 Ga0070689_100788181
275 Ga0070668_100084726
276 Ga0070675_100100766
277 Ga0070673_100054233
278 Ga0070673_100157924
279 Ga0070667_100106951
280 Ga0070678_100040057
281 Ga0068867_100220149
282 Ga0068853_100463597
283 Ga0070672_100073792
284 Ga0070686_101286366
285 Ga0070665_100094741
286 Ga0070665_100201246
287 Ga0068855_100257624
288 Ga0070664_100220043
289 Ga0068854_100440920
290 Ga0068856_101303365
291 Ga0070702_100817090
292 Ga0068859_100636534
293 Ga0068859_100691534
294 Ga0068864_100129218
295 Ga0068863_100313864
296 Ga0097621_100123862
297 Ga0097621_100587772
298 Ga0068865_100061488
299 Ga0097620_100636539
300 Ga0097620_100691529
301 Ga0105242_10173834
302 Ga0105248_10116870
303 Ga0105248_10839592
304 Ga0105248_11874498
305 Ga0105237_10101946
306 Ga0105238_10579544
307 Ga0105239_10466126
308 Ga0157371_10161925
309 Ga0157369_10333999
310 Ga0157374_10296420
311 Ga0157374_10691292
312 Ga0157378_10279818
313 Ga0163162_10542986
314 Ga0157375_10105217
315 Ga0157375_10714941
316 Ga0157375_10843394
317 Ga0163163_10051929
318 Ga0163163_10614296
319 Ga0157379_11218789
320 Ga0157376_10068809
321 Ga0207656_10295279
322 Ga0207688_10144472
323 Ga0207645_10075485
324 Ga0207654_10081868
325 Ga0207671_10148312
326 Ga0207650_10464741
327 Ga0207706_10002815
328 Ga0207704_10589964
329 Ga0207691_10080813
330 Ga0207711_11161608
331 Ga0207679_10212711
332 Ga0207651_10318060
333 Ga0207668_10554284
334 Ga0207640_11011103
335 Ga0207677_10081974
336 Ga0207639_10378089
337 Ga0207641_10198413
338 Ga0207676_10106045
339 Ga0207683_10202773
340 Ga0268266_10082516
341 Ga0268264_10173199
342 Ga0265318_10036318
343 Ga0265330_10027306
344 Ga0265332_10054063
345 Ga0265339_10003921
346 Ga0265331_10001029
347 Ga0265316_10023062
348 Ga0265316_10065104
349 Ga0265316_10324027
350 Ga0316575_10004206
351 Ga0316575_10011084
352 Ga0316575_10023157
353 Ga0316575_10075036
354 Ga0316575_10092708
355 Ga0316579_10005724
356 Ga0316579_10015731
357 Ga0316579_10030964
358 Ga0316579_10041300
359 Ga0316579_10145091
360 Ga0265314_10009265
361 Ga0265314_10364118
362 Ga0265342_10006356
363 Ga0316576_10005420
364 Ga0316576_10005453
365 Ga0316576_10008226
366 Ga0316576_10019706
367 Ga0316576_10060799
368 Ga0316576_10068886
369 Ga0316576_10154391
370 Ga0316576_10204509
371 Ga0316576_10240662
372 Ga0316576_10259102
373 Ga0316576_10278119
374 Ga0316576_10295651
375 Ga0316576_10329818
376 Ga0316576_10392231
377 Ga0316576_10403407
378 Ga0316576_10409527
379 Ga0316576_10540833
380 Ga0316576_10705351
381 Ga0316576_10735825
382 Ga0316576_10812177
383 Ga0316578_10001584
384 Ga0316578_10003024
385 Ga0316578_10015682
386 Ga0316578_10023079
387 Ga0316578_10030245
388 Ga0316578_10038884
389 Ga0316578_10060758
390 Ga0316578_10071958
391 Ga0316578_10077548
392 Ga0316578_10130047
393 Ga0316578_10168672
394 Ga0316578_10171729
395 Ga0316578_10333042
396 Ga0316577_10005968
397 Ga0316577_10007960
398 Ga0316577_10008041
399 Ga0316577_10034222
400 Ga0316577_10054073
401 Ga0316577_10062125
402 Ga0316577_10240356
403 Ga0316577_10318781
404 Ga0316577_10429959
405 Ga0316577_10479329
406 Ga0316583_10003602
407 Ga0316583_10060138
408 Ga0316583_10060796
409 Ga0316583_10131767
410 Ga0316583_10146716
411 Ga0316583_10187493
412 Ga0316583_10195598
413 Ga0316585_10080221
414 Ga0316585_10213814
415 Ga0316580_10016665
416 Ga0316593_10030737
417 Ga0316593_10044461
418 Ga0316592_1013173
419 Ga0316586_1071844
420 Ga0316588_1003944
421 Ga0316587_1012774
422 Ga0316596_1009927
423 Ga0316596_1010125
424 Ga0316596_1120597
425 Ga0316574_0000670
426 Ga0316574_0008766
427 Ga0316574_0017669
428 Ga0316574_0027784
429 Ga0316574_0037127
430 Ga0316574_0057127
431 Ga0316574_0124695
432 Ga0316574_0288673
433 Ga0316574_0296645
434 Ga0316574_0382538
435 Ga0316574_0729545
436 Ga0316582_0001086
437 Ga0316582_0009959
438 Ga0316582_0013236
439 Ga0316582_0017445
440 Ga0316582_0030374
441 Ga0316582_0052578
442 Ga0316582_0060973
443 Ga0316582_0106828
444 Ga0316582_0110738
445 Ga0316582_0150384
446 Ga0316582_0238749
447 Ga0316582_0258245
448 Ga0316582_0354880
449 Ga0316582_0357147
450 Ga0316582_0420484
451 Ga0316582_0445245
452 Ga0316582_0530556
453 Ga0316582_0921735
454 Ga0316582_0926421
455 Ga0316584_0000078
456 Ga0316584_0001489
457 Ga0316584_0004455
458 Ga0316584_0006978
459 Ga0316584_0016170
460 Ga0316584_0039391
461 Ga0316584_0048374
462 Ga0316584_0055996
463 Ga0316584_0099202
464 Ga0316584_0159056
465 Ga0316584_0170302
466 Ga0316584_0179821
467 Ga0316584_0245924
468 Ga0316584_0386736
469 Ga0316584_0402844
470 Ga0316584_0545632
471 Ga0316584_0620514
472 Ga0316584_0701622
473 Ga0316584_0936611
474 Ga0316581_0005135
475 Ga0316581_0014317
476 Ga0316581_0025861
477 Ga0400484_00413
478 Ga0400484_06594
479 Ga0400484_28409
480 Ga0400484_41436
481 Ga0400484_41542
482 Ga0400490_15193
483 Ga0400490_33886
484 Ga0400490_36327
485 Ga0400490_49913
486 Ga0400485_03056
487 Ga0400485_11721
488 Ga0400488_12122
489 Ga0400488_54534
490 Ga0400486_04861
491 Ga0400486_24771
492 Ga0400483_033705
493 Ga0400483_079955
494 Ga0400483_082191
495 Ga0400483_123122
496 Ga0400483_132144
497 Ga0400483_246987
498 Ga0400483_267483
499 Ga0400483_288132
500 Ga0400489_03234
501 Ga0400487_12173
502 Ga0400487_16163
503 Ga0439433_0114776
504 Ga0451577_0256502
505 Ga0453684_0011025
506 Ga0453684_0018760
507 Ga0453684_0228045
508 Ga0453684_0314684
509 Ga0453684_0590752
510 Ga0495639_0233206
511 Ga0495634_0164185
512 Ga0495581_0473518
513 Ga0495676_0409521
514 Ga0496100_0047743
515 Ga0496101_0036000
516 Ga0496102_1820030
517 Ga0496104_0011935
518 Ga0496106_0329029
519 Ga0496108_0872964
520 Ga0496110_0747798
521 Ga0496115_0116294
522 Ga0501034_0701179
523 Ga0501074_0293117
524 Ga0501075_1031317
525 Ga0501076_0023916
526 Ga0501079_0046419
527 Ga0501080_0181554
528 Ga0501081_0076110
529 Ga0495619_0359659
530 Ga0501082_0000439
531 Ga0530510_0503214
532 2836160344

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

22

158

0.95

PF02915

Rubrerythrin

Rubrerythrin

23

151

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nf6-assembly2.cif.gz_F "x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states (""cycled"" structure: reduced in solution and allowed to reoxidise before crystallisation)" 0.9781 2 150
8sqr-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (iron bound, f16l mutant) 0.9646 5 152
1jgc-assembly1.cif.gz_A the 2.6 a structure resolution of rhodobacter capsulatus bacterioferritin with metal-free dinuclear site and heme iron in a crystallographic special position 0.9599 4 152
4toh-assembly1.cif.gz_B 1.80a resolution structure of iron bound bfrb (c89s, k96c) from pseudomonas aeruginosa 0.9585 5 152
8sqp-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (apo, f16l mutant) 0.9582 5 152
ID Description Score Start End Superfamily
1nf6F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9781 2 150 1.20.1260.10
5xx9B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9603 5 152 1.20.1260.10
1jgcA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9599 4 152 1.20.1260.10
3gvyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9587 5 152 1.20.1260.10
4tohB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9585 5 152 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1G0VCY7-F1-model_v4 Bacterioferritin 1.004 5 135 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-X0V3E7-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9927 5 152 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A2N9MN13-F1-model_v4 Bacterioferritin (EC 1.16.3.1) 0.9875 1 115 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-D4IPY3-F1-model_v4 Bacterioferritin (Cytochrome b1) 0.9832 2 154 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A7J0AXM8-F1-model_v4 deleted 0.981 2 154

Map