F374048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 124 | 532 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10193463|Ga0105241_101934632 |
| Length | 178 |
| Sequence | MPSPSAFDDRWQGEAMSELKSIELLNKAVADELATVHQYMYFHFHLDDQGFEPLATLFKRTAITEMGHIEKLAERILFLKGDVEMVAGFAVVRLTDPIKILAKAAEMESNSARDYNKWARECAENLDAASKKIFEELVGDEEMHFGAFDKQQEHIRQFGPAYLALQSFGKEAPASVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 66 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 67 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 70 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 71 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 72 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 73 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 75 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 76 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 77 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 78 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 79 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 80 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 81 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 88 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 89 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 90 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 91 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 92 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 93 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 94 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 95 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 96 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 97 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 98 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 99 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 100 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 101 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 102 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 109 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 110 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 111 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 113 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 114 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 124 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.24 |
| Metatranscriptomes | 3.38 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.01 |
| Rhizosphere | 86.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10193463 | 3300009174 | Bacteria | 1694 |
| 2 | Ga0070676_10062953 | 3300005328 | Bacteria | 2209 |
| 3 | Ga0070683_100670890 | 3300005329 | Bacteria | 993 |
| 4 | Ga0070670_100810651 | 3300005331 | Unclassified | 846 |
| 5 | Ga0068869_100837801 | 3300005334 | Bacteria | 793 |
| 6 | Ga0070666_10016204 | 3300005335 | Unclassified | 4766 |
| 7 | Ga0068868_100044771 | 3300005338 | Bacteria | 3460 |
| 8 | Ga0070689_100788181 | 3300005340 | Bacteria | 835 |
| 9 | Ga0070668_100084726 | 3300005347 | Bacteria | 2490 |
| 10 | Ga0070675_100100766 | 3300005354 | Bacteria | 2432 |
| 11 | Ga0070673_100054233 | 3300005364 | Unclassified | 3153 |
| 12 | Ga0070673_100157924 | 3300005364 | Bacteria | 1926 |
| 13 | Ga0070667_100106951 | 3300005367 | Bacteria | 2421 |
| 14 | Ga0070678_100040057 | 3300005456 | Bacteria | 3313 |
| 15 | Ga0068867_100220149 | 3300005459 | Bacteria | 1529 |
| 16 | Ga0068853_100463597 | 3300005539 | Bacteria | 1193 |
| 17 | Ga0070672_100073792 | 3300005543 | Bacteria | 2720 |
| 18 | Ga0070686_101286366 | 3300005544 | Bacteria | 610 |
| 19 | Ga0070665_100094741 | 3300005548 | Bacteria | 2990 |
| 20 | Ga0070665_100201246 | 3300005548 | Bacteria | 1992 |
| 21 | Ga0068855_100257624 | 3300005563 | Bacteria | 1944 |
| 22 | Ga0070664_100220043 | 3300005564 | Bacteria | 1699 |
| 23 | Ga0068854_100440920 | 3300005578 | Bacteria | 1085 |
| 24 | Ga0068856_101303365 | 3300005614 | Bacteria | 741 |
| 25 | Ga0070702_100817090 | 3300005615 | Bacteria | 722 |
| 26 | Ga0068859_100636534 | 3300005617 | Bacteria | 1159 |
| 27 | Ga0068859_100691534 | 3300005617 | Bacteria | 1111 |
| 28 | Ga0068864_100129218 | 3300005618 | Bacteria | 2267 |
| 29 | Ga0068863_100313864 | 3300005841 | Bacteria | 1522 |
| 30 | Ga0097621_100123862 | 3300006237 | Bacteria | 2194 |
| 31 | Ga0097621_100587772 | 3300006237 | Bacteria | 1017 |
| 32 | Ga0068865_100061488 | 3300006881 | Bacteria | 2633 |
| 33 | Ga0097620_100636539 | 3300006931 | Bacteria | 1159 |
| 34 | Ga0097620_100691529 | 3300006931 | Bacteria | 1111 |
| 35 | Ga0105242_10173834 | 3300009176 | Bacteria | 1895 |
| 36 | Ga0105248_10116870 | 3300009177 | Bacteria | 3008 |
| 37 | Ga0105248_10839592 | 3300009177 | Bacteria | 1037 |
| 38 | Ga0105248_11874498 | 3300009177 | Unclassified | 680 |
| 39 | Ga0105237_10101946 | 3300009545 | Bacteria | 2862 |
| 40 | Ga0105238_10579544 | 3300009551 | Bacteria | 1128 |
| 41 | Ga0105239_10466126 | 3300010375 | Bacteria | 1434 |
| 42 | Ga0157371_10161925 | 3300013102 | Bacteria | 1598 |
| 43 | Ga0157369_10333999 | 3300013105 | Bacteria | 1574 |
| 44 | Ga0157374_10296420 | 3300013296 | Bacteria | 1599 |
| 45 | Ga0157374_10691292 | 3300013296 | Unclassified | 1033 |
| 46 | Ga0157378_10279818 | 3300013297 | Bacteria | 1608 |
| 47 | Ga0163162_10542986 | 3300013306 | Bacteria | 1291 |
| 48 | Ga0157375_10105217 | 3300013308 | Bacteria | 2912 |
| 49 | Ga0157375_10714941 | 3300013308 | Bacteria | 1155 |
| 50 | Ga0157375_10843394 | 3300013308 | Bacteria | 1063 |
| 51 | Ga0163163_10051929 | 3300014325 | Bacteria | 4043 |
| 52 | Ga0163163_10614296 | 3300014325 | Bacteria | 1150 |
| 53 | Ga0157379_11218789 | 3300014968 | Bacteria | 724 |
| 54 | Ga0157376_10068809 | 3300014969 | Unclassified | 2999 |
| 55 | Ga0207656_10295279 | 3300025321 | Unclassified | 801 |
| 56 | Ga0207688_10144472 | 3300025901 | Bacteria | 1402 |
| 57 | Ga0207645_10075485 | 3300025907 | Bacteria | 2158 |
| 58 | Ga0207654_10081868 | 3300025911 | Bacteria | 1945 |
| 59 | Ga0207671_10148312 | 3300025914 | Bacteria | 1811 |
| 60 | Ga0207650_10464741 | 3300025925 | Bacteria | 1054 |
| 61 | Ga0207706_10002815 | 3300025933 | Bacteria | 16887 |
| 62 | Ga0207704_10589964 | 3300025938 | Bacteria | 908 |
| 63 | Ga0207691_10080813 | 3300025940 | Bacteria | 2923 |
| 64 | Ga0207711_11161608 | 3300025941 | Unclassified | 713 |
| 65 | Ga0207679_10212711 | 3300025945 | Bacteria | 1622 |
| 66 | Ga0207651_10318060 | 3300025960 | Bacteria | 1300 |
| 67 | Ga0207668_10554284 | 3300025972 | Bacteria | 996 |
| 68 | Ga0207640_11011103 | 3300025981 | Unclassified | 732 |
| 69 | Ga0207677_10081974 | 3300026023 | Bacteria | 2317 |
| 70 | Ga0207639_10378089 | 3300026041 | Bacteria | 1271 |
| 71 | Ga0207641_10198413 | 3300026088 | Bacteria | 1849 |
| 72 | Ga0207676_10106045 | 3300026095 | Bacteria | 2341 |
| 73 | Ga0207683_10202773 | 3300026121 | Bacteria | 1803 |
| 74 | Ga0268266_10082516 | 3300028379 | Bacteria | 2805 |
| 75 | Ga0268264_10173199 | 3300028381 | Bacteria | 1954 |
| 76 | Ga0265318_10036318 | 3300028577 | Bacteria | 1891 |
| 77 | Ga0265330_10027306 | 3300031235 | Bacteria | 2579 |
| 78 | Ga0265332_10054063 | 3300031238 | Bacteria | 1723 |
| 79 | Ga0265339_10003921 | 3300031249 | Bacteria | 10298 |
| 80 | Ga0265331_10001029 | 3300031250 | Bacteria | 21757 |
| 81 | Ga0265316_10023062 | 3300031344 | Bacteria | 5234 |
| 82 | Ga0265316_10065104 | 3300031344 | Bacteria | 2823 |
| 83 | Ga0265316_10324027 | 3300031344 | Unclassified | 1119 |
| 84 | Ga0316575_10004206 | 3300031665 | Bacteria | 5052 |
| 85 | Ga0316575_10011084 | 3300031665 | Bacteria | 3328 |
| 86 | Ga0316575_10023157 | 3300031665 | Bacteria | 2399 |
| 87 | Ga0316575_10075036 | 3300031665 | Bacteria | 1361 |
| 88 | Ga0316575_10092708 | 3300031665 | Bacteria | 1224 |
| 89 | Ga0316579_10005724 | 3300031691 | Bacteria | 5034 |
| 90 | Ga0316579_10015731 | 3300031691 | Bacteria | 3291 |
| 91 | Ga0316579_10030964 | 3300031691 | Bacteria | 2447 |
| 92 | Ga0316579_10041300 | 3300031691 | Bacteria | 2141 |
| 93 | Ga0316579_10145091 | 3300031691 | Unclassified | 1145 |
| 94 | Ga0265314_10009265 | 3300031711 | Bacteria | 8339 |
| 95 | Ga0265314_10364118 | 3300031711 | Unclassified | 792 |
| 96 | Ga0265342_10006356 | 3300031712 | Bacteria | 8810 |
| 97 | Ga0316576_10005420 | 3300031727 | Bacteria | 7790 |
| 98 | Ga0316576_10005453 | 3300031727 | Bacteria | 7776 |
| 99 | Ga0316576_10008226 | 3300031727 | Bacteria | 6632 |
| 100 | Ga0316576_10019706 | 3300031727 | Bacteria | 4626 |
| 101 | Ga0316576_10060799 | 3300031727 | Unclassified | 2768 |
| 102 | Ga0316576_10068886 | 3300031727 | Bacteria | 2608 |
| 103 | Ga0316576_10154391 | 3300031727 | Unclassified | 1730 |
| 104 | Ga0316576_10204509 | 3300031727 | Bacteria | 1487 |
| 105 | Ga0316576_10240662 | 3300031727 | Bacteria | 1360 |
| 106 | Ga0316576_10259102 | 3300031727 | Bacteria | 1305 |
| 107 | Ga0316576_10278119 | 3300031727 | Unclassified | 1254 |
| 108 | Ga0316576_10295651 | 3300031727 | Unclassified | 1211 |
| 109 | Ga0316576_10329818 | 3300031727 | Unclassified | 1137 |
| 110 | Ga0316576_10392231 | 3300031727 | Bacteria | 1030 |
| 111 | Ga0316576_10403407 | 3300031727 | Bacteria | 1013 |
| 112 | Ga0316576_10409527 | 3300031727 | Bacteria | 1004 |
| 113 | Ga0316576_10540833 | 3300031727 | Bacteria | 854 |
| 114 | Ga0316576_10705351 | 3300031727 | Bacteria | 731 |
| 115 | Ga0316576_10735825 | 3300031727 | Bacteria | 713 |
| 116 | Ga0316576_10812177 | 3300031727 | Bacteria | 673 |
| 117 | Ga0316578_10001584 | 3300031728 | Bacteria | 9381 |
| 118 | Ga0316578_10003024 | 3300031728 | Bacteria | 7575 |
| 119 | Ga0316578_10015682 | 3300031728 | Bacteria | 4081 |
| 120 | Ga0316578_10023079 | 3300031728 | Bacteria | 3479 |
| 121 | Ga0316578_10030245 | 3300031728 | Bacteria | 3077 |
| 122 | Ga0316578_10038884 | 3300031728 | Bacteria | 2746 |
| 123 | Ga0316578_10060758 | 3300031728 | Bacteria | 2225 |
| 124 | Ga0316578_10071958 | 3300031728 | Bacteria | 2047 |
| 125 | Ga0316578_10077548 | 3300031728 | Bacteria | 1973 |
| 126 | Ga0316578_10130047 | 3300031728 | Bacteria | 1515 |
| 127 | Ga0316578_10168672 | 3300031728 | Unclassified | 1319 |
| 128 | Ga0316578_10171729 | 3300031728 | Unclassified | 1307 |
| 129 | Ga0316578_10333042 | 3300031728 | Unclassified | 905 |
| 130 | Ga0316577_10005968 | 3300031733 | Bacteria | 6416 |
| 131 | Ga0316577_10007960 | 3300031733 | Bacteria | 5661 |
| 132 | Ga0316577_10008041 | 3300031733 | Bacteria | 5639 |
| 133 | Ga0316577_10034222 | 3300031733 | Bacteria | 2839 |
| 134 | Ga0316577_10054073 | 3300031733 | Bacteria | 2241 |
| 135 | Ga0316577_10062125 | 3300031733 | Unclassified | 2085 |
| 136 | Ga0316577_10240356 | 3300031733 | Bacteria | 1024 |
| 137 | Ga0316577_10318781 | 3300031733 | Bacteria | 881 |
| 138 | Ga0316577_10429959 | 3300031733 | Bacteria | 750 |
| 139 | Ga0316577_10479329 | 3300031733 | Bacteria | 707 |
| 140 | Ga0316583_10003602 | 3300032133 | Bacteria | 5470 |
| 141 | Ga0316583_10060138 | 3300032133 | Bacteria | 1332 |
| 142 | Ga0316583_10060796 | 3300032133 | Unclassified | 1324 |
| 143 | Ga0316583_10131767 | 3300032133 | Bacteria | 871 |
| 144 | Ga0316583_10146716 | 3300032133 | Bacteria | 822 |
| 145 | Ga0316583_10187493 | 3300032133 | Bacteria | 719 |
| 146 | Ga0316583_10195598 | 3300032133 | Bacteria | 702 |
| 147 | Ga0316585_10080221 | 3300032137 | Bacteria | 1062 |
| 148 | Ga0316585_10213814 | 3300032137 | Bacteria | 638 |
| 149 | Ga0316580_10016665 | 3300032139 | Bacteria | 2256 |
| 150 | Ga0316593_10030737 | 3300032168 | Bacteria | 1746 |
| 151 | Ga0316593_10044461 | 3300032168 | Bacteria | 1487 |
| 152 | Ga0316592_1013173 | 3300033524 | Bacteria | 1702 |
| 153 | Ga0316586_1071844 | 3300033527 | Bacteria | 638 |
| 154 | Ga0316588_1003944 | 3300033528 | Bacteria | 2761 |
| 155 | Ga0316587_1012774 | 3300033529 | Bacteria | 1368 |
| 156 | Ga0316596_1009927 | 3300033541 | Bacteria | 2293 |
| 157 | Ga0316596_1010125 | 3300033541 | Bacteria | 2276 |
| 158 | Ga0316596_1120597 | 3300033541 | Bacteria | 714 |
| 159 | Ga0316574_0000670 | 3300035398 | Bacteria | 14474 |
| 160 | Ga0316574_0008766 | 3300035398 | Bacteria | 5632 |
| 161 | Ga0316574_0017669 | 3300035398 | Bacteria | 4179 |
| 162 | Ga0316574_0027784 | 3300035398 | Bacteria | 3409 |
| 163 | Ga0316574_0037127 | 3300035398 | Bacteria | 2986 |
| 164 | Ga0316574_0057127 | 3300035398 | Unclassified | 2442 |
| 165 | Ga0316574_0124695 | 3300035398 | Bacteria | 1655 |
| 166 | Ga0316574_0288673 | 3300035398 | Bacteria | 1044 |
| 167 | Ga0316574_0296645 | 3300035398 | Bacteria | 1028 |
| 168 | Ga0316574_0382538 | 3300035398 | Bacteria | 888 |
| 169 | Ga0316574_0729545 | 3300035398 | Bacteria | 606 |
| 170 | Ga0316582_0001086 | 3300036647 | Bacteria | 11459 |
| 171 | Ga0316582_0009959 | 3300036647 | Bacteria | 5184 |
| 172 | Ga0316582_0013236 | 3300036647 | Unclassified | 4638 |
| 173 | Ga0316582_0017445 | 3300036647 | Bacteria | 4154 |
| 174 | Ga0316582_0030374 | 3300036647 | Bacteria | 3292 |
| 175 | Ga0316582_0052578 | 3300036647 | Bacteria | 2589 |
| 176 | Ga0316582_0060973 | 3300036647 | Bacteria | 2419 |
| 177 | Ga0316582_0106828 | 3300036647 | Unclassified | 1859 |
| 178 | Ga0316582_0110738 | 3300036647 | Bacteria | 1827 |
| 179 | Ga0316582_0150384 | 3300036647 | Bacteria | 1574 |
| 180 | Ga0316582_0238749 | 3300036647 | Bacteria | 1245 |
| 181 | Ga0316582_0258245 | 3300036647 | Bacteria | 1194 |
| 182 | Ga0316582_0354880 | 3300036647 | Bacteria | 1009 |
| 183 | Ga0316582_0357147 | 3300036647 | Bacteria | 1005 |
| 184 | Ga0316582_0420484 | 3300036647 | Bacteria | 921 |
| 185 | Ga0316582_0445245 | 3300036647 | Bacteria | 893 |
| 186 | Ga0316582_0530556 | 3300036647 | Bacteria | 811 |
| 187 | Ga0316582_0921735 | 3300036647 | Unclassified | 597 |
| 188 | Ga0316582_0926421 | 3300036647 | Unclassified | 596 |
| 189 | Ga0316584_0000078 | 3300036712 | Bacteria | 38231 |
| 190 | Ga0316584_0001489 | 3300036712 | Bacteria | 14081 |
| 191 | Ga0316584_0004455 | 3300036712 | Bacteria | 9268 |
| 192 | Ga0316584_0006978 | 3300036712 | Bacteria | 7684 |
| 193 | Ga0316584_0016170 | 3300036712 | Bacteria | 5346 |
| 194 | Ga0316584_0039391 | 3300036712 | Bacteria | 3518 |
| 195 | Ga0316584_0048374 | 3300036712 | Bacteria | 3177 |
| 196 | Ga0316584_0055996 | 3300036712 | Bacteria | 2952 |
| 197 | Ga0316584_0099202 | 3300036712 | Bacteria | 2181 |
| 198 | Ga0316584_0159056 | 3300036712 | Bacteria | 1679 |
| 199 | Ga0316584_0170302 | 3300036712 | Bacteria | 1616 |
| 200 | Ga0316584_0179821 | 3300036712 | Bacteria | 1566 |
| 201 | Ga0316584_0245924 | 3300036712 | Bacteria | 1308 |
| 202 | Ga0316584_0386736 | 3300036712 | Bacteria | 999 |
| 203 | Ga0316584_0402844 | 3300036712 | Bacteria | 974 |
| 204 | Ga0316584_0545632 | 3300036712 | Unclassified | 810 |
| 205 | Ga0316584_0620514 | 3300036712 | Bacteria | 748 |
| 206 | Ga0316584_0701622 | 3300036712 | Bacteria | 694 |
| 207 | Ga0316584_0936611 | 3300036712 | Unclassified | 581 |
| 208 | Ga0316581_0005135 | 3300037588 | Bacteria | 3389 |
| 209 | Ga0316581_0014317 | 3300037588 | Bacteria | 2257 |
| 210 | Ga0316581_0025861 | 3300037588 | Unclassified | 1748 |
| 211 | Ga0400484_00413 | 3300038725 | Bacteria | 5594 |
| 212 | Ga0400484_06594 | 3300038725 | Unclassified | 2919 |
| 213 | Ga0400484_28409 | 3300038725 | Bacteria | 3947 |
| 214 | Ga0400484_41436 | 3300038725 | Bacteria | 16055 |
| 215 | Ga0400484_41542 | 3300038725 | Bacteria | 8021 |
| 216 | Ga0400490_15193 | 3300038726 | Unclassified | 1513 |
| 217 | Ga0400490_33886 | 3300038726 | Bacteria | 2179 |
| 218 | Ga0400490_36327 | 3300038726 | Bacteria | 27463 |
| 219 | Ga0400490_49913 | 3300038726 | Bacteria | 6890 |
| 220 | Ga0400485_03056 | 3300038735 | Bacteria | 1746 |
| 221 | Ga0400485_11721 | 3300038735 | Bacteria | 4940 |
| 222 | Ga0400488_12122 | 3300038741 | Bacteria | 4401 |
| 223 | Ga0400488_54534 | 3300038741 | Bacteria | 1766 |
| 224 | Ga0400486_04861 | 3300038742 | Bacteria | 1098 |
| 225 | Ga0400486_24771 | 3300038742 | Bacteria | 8648 |
| 226 | Ga0400483_033705 | 3300039062 | Bacteria | 1624 |
| 227 | Ga0400483_079955 | 3300039062 | Bacteria | 2016 |
| 228 | Ga0400483_082191 | 3300039062 | Unclassified | 1031 |
| 229 | Ga0400483_123122 | 3300039062 | Unclassified | 2978 |
| 230 | Ga0400483_132144 | 3300039062 | Bacteria | 7687 |
| 231 | Ga0400483_246987 | 3300039062 | Bacteria | 3755 |
| 232 | Ga0400483_267483 | 3300039062 | Bacteria | 2247 |
| 233 | Ga0400483_288132 | 3300039062 | Bacteria | 1075 |
| 234 | Ga0400489_03234 | 3300039093 | Unclassified | 3194 |
| 235 | Ga0400487_12173 | 3300039110 | Bacteria | 2214 |
| 236 | Ga0400487_16163 | 3300039110 | Bacteria | 5154 |
| 237 | Ga0439433_0114776 | 3300041999 | Unclassified | 676 |
| 238 | Ga0451577_0256502 | 3300042876 | Bacteria | 1583 |
| 239 | Ga0453684_0011025 | 3300044712 | Bacteria | 15269 |
| 240 | Ga0453684_0018760 | 3300044712 | Bacteria | 10589 |
| 241 | Ga0453684_0228045 | 3300044712 | Unclassified | 2152 |
| 242 | Ga0453684_0314684 | 3300044712 | Bacteria | 1775 |
| 243 | Ga0453684_0590752 | 3300044712 | Bacteria | 1218 |
| 244 | Ga0495639_0233206 | 3300046475 | Bacteria | 907 |
| 245 | Ga0495634_0164185 | 3300046642 | Bacteria | 1398 |
| 246 | Ga0495581_0473518 | 3300047315 | Unclassified | 729 |
| 247 | Ga0495676_0409521 | 3300047321 | Bacteria | 899 |
| 248 | Ga0496100_0047743 | 3300048903 | Bacteria | 2761 |
| 249 | Ga0496101_0036000 | 3300048904 | Bacteria | 3504 |
| 250 | Ga0496102_1820030 | 3300048905 | Bacteria | 526 |
| 251 | Ga0496104_0011935 | 3300048907 | Bacteria | 7793 |
| 252 | Ga0496106_0329029 | 3300048909 | Bacteria | 1227 |
| 253 | Ga0496108_0872964 | 3300048911 | Unclassified | 773 |
| 254 | Ga0496110_0747798 | 3300048913 | Bacteria | 881 |
| 255 | Ga0496115_0116294 | 3300048918 | Bacteria | 2199 |
| 256 | Ga0501034_0701179 | 3300049571 | Bacteria | 911 |
| 257 | Ga0501074_0293117 | 3300049590 | Bacteria | 1156 |
| 258 | Ga0501075_1031317 | 3300049591 | Bacteria | 625 |
| 259 | Ga0501076_0023916 | 3300049592 | Bacteria | 4714 |
| 260 | Ga0501079_0046419 | 3300049741 | Bacteria | 3352 |
| 261 | Ga0501080_0181554 | 3300049742 | Unclassified | 1936 |
| 262 | Ga0501081_0076110 | 3300049743 | Bacteria | 2343 |
| 263 | Ga0495619_0359659 | 3300053085 | Bacteria | 1007 |
| 264 | Ga0501082_0000439 | 3300060353 | Bacteria | 36880 |
| 265 | Ga0530510_0503214 | 3300061734 | Bacteria | 918 |
| 266 | 2836160344 | 2836160341 | Unclassified | 5867367 |
| 267 | Ga0105241_10193463 | |||
| 268 | Ga0070676_10062953 | |||
| 269 | Ga0070683_100670890 | |||
| 270 | Ga0070670_100810651 | |||
| 271 | Ga0068869_100837801 | |||
| 272 | Ga0070666_10016204 | |||
| 273 | Ga0068868_100044771 | |||
| 274 | Ga0070689_100788181 | |||
| 275 | Ga0070668_100084726 | |||
| 276 | Ga0070675_100100766 | |||
| 277 | Ga0070673_100054233 | |||
| 278 | Ga0070673_100157924 | |||
| 279 | Ga0070667_100106951 | |||
| 280 | Ga0070678_100040057 | |||
| 281 | Ga0068867_100220149 | |||
| 282 | Ga0068853_100463597 | |||
| 283 | Ga0070672_100073792 | |||
| 284 | Ga0070686_101286366 | |||
| 285 | Ga0070665_100094741 | |||
| 286 | Ga0070665_100201246 | |||
| 287 | Ga0068855_100257624 | |||
| 288 | Ga0070664_100220043 | |||
| 289 | Ga0068854_100440920 | |||
| 290 | Ga0068856_101303365 | |||
| 291 | Ga0070702_100817090 | |||
| 292 | Ga0068859_100636534 | |||
| 293 | Ga0068859_100691534 | |||
| 294 | Ga0068864_100129218 | |||
| 295 | Ga0068863_100313864 | |||
| 296 | Ga0097621_100123862 | |||
| 297 | Ga0097621_100587772 | |||
| 298 | Ga0068865_100061488 | |||
| 299 | Ga0097620_100636539 | |||
| 300 | Ga0097620_100691529 | |||
| 301 | Ga0105242_10173834 | |||
| 302 | Ga0105248_10116870 | |||
| 303 | Ga0105248_10839592 | |||
| 304 | Ga0105248_11874498 | |||
| 305 | Ga0105237_10101946 | |||
| 306 | Ga0105238_10579544 | |||
| 307 | Ga0105239_10466126 | |||
| 308 | Ga0157371_10161925 | |||
| 309 | Ga0157369_10333999 | |||
| 310 | Ga0157374_10296420 | |||
| 311 | Ga0157374_10691292 | |||
| 312 | Ga0157378_10279818 | |||
| 313 | Ga0163162_10542986 | |||
| 314 | Ga0157375_10105217 | |||
| 315 | Ga0157375_10714941 | |||
| 316 | Ga0157375_10843394 | |||
| 317 | Ga0163163_10051929 | |||
| 318 | Ga0163163_10614296 | |||
| 319 | Ga0157379_11218789 | |||
| 320 | Ga0157376_10068809 | |||
| 321 | Ga0207656_10295279 | |||
| 322 | Ga0207688_10144472 | |||
| 323 | Ga0207645_10075485 | |||
| 324 | Ga0207654_10081868 | |||
| 325 | Ga0207671_10148312 | |||
| 326 | Ga0207650_10464741 | |||
| 327 | Ga0207706_10002815 | |||
| 328 | Ga0207704_10589964 | |||
| 329 | Ga0207691_10080813 | |||
| 330 | Ga0207711_11161608 | |||
| 331 | Ga0207679_10212711 | |||
| 332 | Ga0207651_10318060 | |||
| 333 | Ga0207668_10554284 | |||
| 334 | Ga0207640_11011103 | |||
| 335 | Ga0207677_10081974 | |||
| 336 | Ga0207639_10378089 | |||
| 337 | Ga0207641_10198413 | |||
| 338 | Ga0207676_10106045 | |||
| 339 | Ga0207683_10202773 | |||
| 340 | Ga0268266_10082516 | |||
| 341 | Ga0268264_10173199 | |||
| 342 | Ga0265318_10036318 | |||
| 343 | Ga0265330_10027306 | |||
| 344 | Ga0265332_10054063 | |||
| 345 | Ga0265339_10003921 | |||
| 346 | Ga0265331_10001029 | |||
| 347 | Ga0265316_10023062 | |||
| 348 | Ga0265316_10065104 | |||
| 349 | Ga0265316_10324027 | |||
| 350 | Ga0316575_10004206 | |||
| 351 | Ga0316575_10011084 | |||
| 352 | Ga0316575_10023157 | |||
| 353 | Ga0316575_10075036 | |||
| 354 | Ga0316575_10092708 | |||
| 355 | Ga0316579_10005724 | |||
| 356 | Ga0316579_10015731 | |||
| 357 | Ga0316579_10030964 | |||
| 358 | Ga0316579_10041300 | |||
| 359 | Ga0316579_10145091 | |||
| 360 | Ga0265314_10009265 | |||
| 361 | Ga0265314_10364118 | |||
| 362 | Ga0265342_10006356 | |||
| 363 | Ga0316576_10005420 | |||
| 364 | Ga0316576_10005453 | |||
| 365 | Ga0316576_10008226 | |||
| 366 | Ga0316576_10019706 | |||
| 367 | Ga0316576_10060799 | |||
| 368 | Ga0316576_10068886 | |||
| 369 | Ga0316576_10154391 | |||
| 370 | Ga0316576_10204509 | |||
| 371 | Ga0316576_10240662 | |||
| 372 | Ga0316576_10259102 | |||
| 373 | Ga0316576_10278119 | |||
| 374 | Ga0316576_10295651 | |||
| 375 | Ga0316576_10329818 | |||
| 376 | Ga0316576_10392231 | |||
| 377 | Ga0316576_10403407 | |||
| 378 | Ga0316576_10409527 | |||
| 379 | Ga0316576_10540833 | |||
| 380 | Ga0316576_10705351 | |||
| 381 | Ga0316576_10735825 | |||
| 382 | Ga0316576_10812177 | |||
| 383 | Ga0316578_10001584 | |||
| 384 | Ga0316578_10003024 | |||
| 385 | Ga0316578_10015682 | |||
| 386 | Ga0316578_10023079 | |||
| 387 | Ga0316578_10030245 | |||
| 388 | Ga0316578_10038884 | |||
| 389 | Ga0316578_10060758 | |||
| 390 | Ga0316578_10071958 | |||
| 391 | Ga0316578_10077548 | |||
| 392 | Ga0316578_10130047 | |||
| 393 | Ga0316578_10168672 | |||
| 394 | Ga0316578_10171729 | |||
| 395 | Ga0316578_10333042 | |||
| 396 | Ga0316577_10005968 | |||
| 397 | Ga0316577_10007960 | |||
| 398 | Ga0316577_10008041 | |||
| 399 | Ga0316577_10034222 | |||
| 400 | Ga0316577_10054073 | |||
| 401 | Ga0316577_10062125 | |||
| 402 | Ga0316577_10240356 | |||
| 403 | Ga0316577_10318781 | |||
| 404 | Ga0316577_10429959 | |||
| 405 | Ga0316577_10479329 | |||
| 406 | Ga0316583_10003602 | |||
| 407 | Ga0316583_10060138 | |||
| 408 | Ga0316583_10060796 | |||
| 409 | Ga0316583_10131767 | |||
| 410 | Ga0316583_10146716 | |||
| 411 | Ga0316583_10187493 | |||
| 412 | Ga0316583_10195598 | |||
| 413 | Ga0316585_10080221 | |||
| 414 | Ga0316585_10213814 | |||
| 415 | Ga0316580_10016665 | |||
| 416 | Ga0316593_10030737 | |||
| 417 | Ga0316593_10044461 | |||
| 418 | Ga0316592_1013173 | |||
| 419 | Ga0316586_1071844 | |||
| 420 | Ga0316588_1003944 | |||
| 421 | Ga0316587_1012774 | |||
| 422 | Ga0316596_1009927 | |||
| 423 | Ga0316596_1010125 | |||
| 424 | Ga0316596_1120597 | |||
| 425 | Ga0316574_0000670 | |||
| 426 | Ga0316574_0008766 | |||
| 427 | Ga0316574_0017669 | |||
| 428 | Ga0316574_0027784 | |||
| 429 | Ga0316574_0037127 | |||
| 430 | Ga0316574_0057127 | |||
| 431 | Ga0316574_0124695 | |||
| 432 | Ga0316574_0288673 | |||
| 433 | Ga0316574_0296645 | |||
| 434 | Ga0316574_0382538 | |||
| 435 | Ga0316574_0729545 | |||
| 436 | Ga0316582_0001086 | |||
| 437 | Ga0316582_0009959 | |||
| 438 | Ga0316582_0013236 | |||
| 439 | Ga0316582_0017445 | |||
| 440 | Ga0316582_0030374 | |||
| 441 | Ga0316582_0052578 | |||
| 442 | Ga0316582_0060973 | |||
| 443 | Ga0316582_0106828 | |||
| 444 | Ga0316582_0110738 | |||
| 445 | Ga0316582_0150384 | |||
| 446 | Ga0316582_0238749 | |||
| 447 | Ga0316582_0258245 | |||
| 448 | Ga0316582_0354880 | |||
| 449 | Ga0316582_0357147 | |||
| 450 | Ga0316582_0420484 | |||
| 451 | Ga0316582_0445245 | |||
| 452 | Ga0316582_0530556 | |||
| 453 | Ga0316582_0921735 | |||
| 454 | Ga0316582_0926421 | |||
| 455 | Ga0316584_0000078 | |||
| 456 | Ga0316584_0001489 | |||
| 457 | Ga0316584_0004455 | |||
| 458 | Ga0316584_0006978 | |||
| 459 | Ga0316584_0016170 | |||
| 460 | Ga0316584_0039391 | |||
| 461 | Ga0316584_0048374 | |||
| 462 | Ga0316584_0055996 | |||
| 463 | Ga0316584_0099202 | |||
| 464 | Ga0316584_0159056 | |||
| 465 | Ga0316584_0170302 | |||
| 466 | Ga0316584_0179821 | |||
| 467 | Ga0316584_0245924 | |||
| 468 | Ga0316584_0386736 | |||
| 469 | Ga0316584_0402844 | |||
| 470 | Ga0316584_0545632 | |||
| 471 | Ga0316584_0620514 | |||
| 472 | Ga0316584_0701622 | |||
| 473 | Ga0316584_0936611 | |||
| 474 | Ga0316581_0005135 | |||
| 475 | Ga0316581_0014317 | |||
| 476 | Ga0316581_0025861 | |||
| 477 | Ga0400484_00413 | |||
| 478 | Ga0400484_06594 | |||
| 479 | Ga0400484_28409 | |||
| 480 | Ga0400484_41436 | |||
| 481 | Ga0400484_41542 | |||
| 482 | Ga0400490_15193 | |||
| 483 | Ga0400490_33886 | |||
| 484 | Ga0400490_36327 | |||
| 485 | Ga0400490_49913 | |||
| 486 | Ga0400485_03056 | |||
| 487 | Ga0400485_11721 | |||
| 488 | Ga0400488_12122 | |||
| 489 | Ga0400488_54534 | |||
| 490 | Ga0400486_04861 | |||
| 491 | Ga0400486_24771 | |||
| 492 | Ga0400483_033705 | |||
| 493 | Ga0400483_079955 | |||
| 494 | Ga0400483_082191 | |||
| 495 | Ga0400483_123122 | |||
| 496 | Ga0400483_132144 | |||
| 497 | Ga0400483_246987 | |||
| 498 | Ga0400483_267483 | |||
| 499 | Ga0400483_288132 | |||
| 500 | Ga0400489_03234 | |||
| 501 | Ga0400487_12173 | |||
| 502 | Ga0400487_16163 | |||
| 503 | Ga0439433_0114776 | |||
| 504 | Ga0451577_0256502 | |||
| 505 | Ga0453684_0011025 | |||
| 506 | Ga0453684_0018760 | |||
| 507 | Ga0453684_0228045 | |||
| 508 | Ga0453684_0314684 | |||
| 509 | Ga0453684_0590752 | |||
| 510 | Ga0495639_0233206 | |||
| 511 | Ga0495634_0164185 | |||
| 512 | Ga0495581_0473518 | |||
| 513 | Ga0495676_0409521 | |||
| 514 | Ga0496100_0047743 | |||
| 515 | Ga0496101_0036000 | |||
| 516 | Ga0496102_1820030 | |||
| 517 | Ga0496104_0011935 | |||
| 518 | Ga0496106_0329029 | |||
| 519 | Ga0496108_0872964 | |||
| 520 | Ga0496110_0747798 | |||
| 521 | Ga0496115_0116294 | |||
| 522 | Ga0501034_0701179 | |||
| 523 | Ga0501074_0293117 | |||
| 524 | Ga0501075_1031317 | |||
| 525 | Ga0501076_0023916 | |||
| 526 | Ga0501079_0046419 | |||
| 527 | Ga0501080_0181554 | |||
| 528 | Ga0501081_0076110 | |||
| 529 | Ga0495619_0359659 | |||
| 530 | Ga0501082_0000439 | |||
| 531 | Ga0530510_0503214 | |||
| 532 | 2836160344 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nf6-assembly2.cif.gz_F | "x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states (""cycled"" structure: reduced in solution and allowed to reoxidise before crystallisation)" | 0.9781 | 2 | 150 |
| 8sqr-assembly1.cif.gz_A | crystal structure of bacterioferritin (bfr) from brucella abortus (iron bound, f16l mutant) | 0.9646 | 5 | 152 |
| 1jgc-assembly1.cif.gz_A | the 2.6 a structure resolution of rhodobacter capsulatus bacterioferritin with metal-free dinuclear site and heme iron in a crystallographic special position | 0.9599 | 4 | 152 |
| 4toh-assembly1.cif.gz_B | 1.80a resolution structure of iron bound bfrb (c89s, k96c) from pseudomonas aeruginosa | 0.9585 | 5 | 152 |
| 8sqp-assembly1.cif.gz_A | crystal structure of bacterioferritin (bfr) from brucella abortus (apo, f16l mutant) | 0.9582 | 5 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nf6F00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9781 | 2 | 150 | 1.20.1260.10 |
| 5xx9B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9603 | 5 | 152 | 1.20.1260.10 |
| 1jgcA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9599 | 4 | 152 | 1.20.1260.10 |
| 3gvyA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9587 | 5 | 152 | 1.20.1260.10 |
| 4tohB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9585 | 5 | 152 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0VCY7-F1-model_v4 | Bacterioferritin | 1.004 | 5 | 135 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-X0V3E7-F1-model_v4 | Ferritin-like diiron domain-containing protein | 0.9927 | 5 | 152 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A2N9MN13-F1-model_v4 | Bacterioferritin (EC 1.16.3.1) | 0.9875 | 1 | 115 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-D4IPY3-F1-model_v4 | Bacterioferritin (Cytochrome b1) | 0.9832 | 2 | 154 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A7J0AXM8-F1-model_v4 | deleted | 0.981 | 2 | 154 |
|