F374039

General Info

Members Datasets Scaffolds Average Seq Length
266 195 532 210

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10004075|Ga0114129_100040752
Length 225
Sequence MAKRRKVGNILALALLALLMPGQPMHPYQMASVLRRTGKEQDMKIKWGSLYTVIQNLEKHGLIAALSSHREGKRPERTLYGITDAGRIELRDWMRELVAEPEPEFPRFEAALSVLGALPPDEVVELLHIRLDALDRQIVNDRATLRSLVENLPRVFLIEAEYALAIKEAEAAWVSKLVQEIQDGTLTGAADWREYHRTGETPPQWQRLLEETGSGAPTPEPGMTS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
67 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
184 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
185 2508501039 Frankia saprophytica CN3 Isolate Nodule
186 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
187 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
188 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
189 2687453737 Frankia sp. BMG5.36 Isolate Nodule
190 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
191 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
192 2862574272 Streptomyces sp. AcE210 Isolate Nodule
193 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
194 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
195 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 2.26
Rhizoplane 5.64
Rhizosphere 76.32
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10004075 3300009147 Bacteria 20643
2 rootH2_10073474 3300003320 Bacteria 2816
3 Ga0070658_10593077 3300005327 Bacteria 960
4 Ga0070683_100986345 3300005329 Bacteria 809
5 Ga0070660_100030376 3300005339 Bacteria 4054
6 Ga0070668_100001170 3300005347 Bacteria 18552
7 Ga0070668_100087922 3300005347 Bacteria 2445
8 Ga0070709_10086824 3300005434 Bacteria 2054
9 Ga0070714_100053643 3300005435 Bacteria 3442
10 Ga0070714_100385092 3300005435 Bacteria 1323
11 Ga0070713_100849691 3300005436 Bacteria 876
12 Ga0070710_10069204 3300005437 Bacteria 2030
13 Ga0070711_100002609 3300005439 Bacteria 10320
14 Ga0070707_100231311 3300005468 Bacteria 1799
15 Ga0070698_100247396 3300005471 Bacteria 1716
16 Ga0070697_100082658 3300005536 Bacteria 2648
17 Ga0068853_100312164 3300005539 Bacteria 1456
18 Ga0070672_100979498 3300005543 Bacteria 749
19 Ga0070664_100296698 3300005564 Bacteria 1460
20 Ga0068854_100798069 3300005578 Bacteria 823
21 Ga0070702_100011114 3300005615 Bacteria 4467
22 Ga0068864_100272498 3300005618 Bacteria 1577
23 Ga0068861_100025809 3300005719 Bacteria 4266
24 Ga0068860_100108247 3300005843 Bacteria 2656
25 Ga0081539_10007285 3300005985 Bacteria 10154
26 Ga0070717_10309942 3300006028 Bacteria 1404
27 Ga0070717_10326089 3300006028 Bacteria 1369
28 Ga0075368_10276642 3300006042 Bacteria 721
29 Ga0070715_10101400 3300006163 Bacteria 1343
30 Ga0070716_100005398 3300006173 Bacteria 6187
31 Ga0070712_100016439 3300006175 Bacteria 4780
32 Ga0070712_100021031 3300006175 Bacteria 4278
33 Ga0070712_100077648 3300006175 Bacteria 2394
34 Ga0111539_10597205 3300009094 Bacteria 1285
35 Ga0105245_10077508 3300009098 Bacteria 3030
36 Ga0114129_10029611 3300009147 Bacteria 7753
37 Ga0105243_10035282 3300009148 Bacteria 3877
38 Ga0105242_10297237 3300009176 Bacteria 1472
39 Ga0105237_11013891 3300009545 Bacteria 837
40 Ga0105249_10021357 3300009553 Bacteria 5796
41 Ga0157369_10982814 3300013105 Bacteria 864
42 Ga0157374_10389799 3300013296 Bacteria 1388
43 Ga0163162_10493814 3300013306 Bacteria 1355
44 Ga0157375_11773394 3300013308 Bacteria 731
45 Ga0163163_10042392 3300014325 Bacteria 4457
46 Ga0157377_10107498 3300014745 Bacteria 1672
47 Ga0157379_10603995 3300014968 Bacteria 1024
48 Ga0183367_1010 3300015688 Bacteria 416164
49 Ga0213875_10033213 3300021388 Bacteria 2436
50 Ga0209758_1004480 3300025297 Bacteria 11602
51 Ga0207692_10013554 3300025898 Bacteria 3539
52 Ga0207688_10020934 3300025901 Bacteria 3570
53 Ga0207699_10038961 3300025906 Bacteria 2727
54 Ga0207699_10087967 3300025906 Bacteria 1943
55 Ga0207643_10313481 3300025908 Unclassified 978
56 Ga0207693_10023972 3300025915 Bacteria 4845
57 Ga0207693_10028537 3300025915 Bacteria 4409
58 Ga0207693_10074675 3300025915 Bacteria 2655
59 Ga0207693_10343011 3300025915 Bacteria 1169
60 Ga0207663_10005202 3300025916 Bacteria 6548
61 Ga0207657_10053111 3300025919 Bacteria 3512
62 Ga0207700_10004027 3300025928 Bacteria 8603
63 Ga0207700_10005777 3300025928 Bacteria 7433
64 Ga0207664_10004975 3300025929 Bacteria 9034
65 Ga0207664_10012396 3300025929 Bacteria 6092
66 Ga0207664_10157051 3300025929 Bacteria 1937
67 Ga0207690_10160215 3300025932 Bacteria 1677
68 Ga0207665_10002754 3300025939 Bacteria 11791
69 Ga0207691_10895918 3300025940 Bacteria 743
70 Ga0207712_10021179 3300025961 Bacteria 4265
71 Ga0207668_10110053 3300025972 Bacteria 2065
72 Ga0207658_10089964 3300025986 Bacteria 2378
73 Ga0207639_10498070 3300026041 Bacteria 1113
74 Ga0207708_10102665 3300026075 Bacteria 2214
75 Ga0207676_10719368 3300026095 Bacteria 969
76 Ga0207674_10313616 3300026116 Bacteria 1517
77 Ga0207675_100012375 3300026118 Bacteria 7969
78 Ga0307515_10001737 3300028794 Bacteria 48507
79 Ga0307515_10048457 3300028794 Bacteria 6423
80 Ga0307511_10156439 3300030521 Bacteria 1292
81 Ga0307512_10013903 3300030522 Bacteria 7519
82 Ga0307513_10016170 3300031456 Bacteria 9012
83 Ga0307509_10095255 3300031507 Bacteria 3033
84 Ga0307408_100176524 3300031548 Bacteria 1710
85 Ga0307508_10007960 3300031616 Bacteria 9831
86 Ga0307508_10127380 3300031616 Bacteria 2149
87 Ga0307516_10076285 3300031730 Bacteria 3205
88 Ga0307405_10006057 3300031731 Bacteria 5914
89 Ga0307405_10403035 3300031731 Bacteria 1071
90 Ga0307518_10036921 3300031838 Bacteria 3551
91 Ga0307407_10035102 3300031903 Bacteria 2752
92 Ga0307409_100049618 3300031995 Bacteria 3201
93 Ga0307416_100753189 3300032002 Bacteria 1067
94 Ga0307414_10044537 3300032004 Bacteria 3032
95 Ga0307414_10135262 3300032004 Bacteria 1921
96 Ga0307411_10198750 3300032005 Bacteria 1538
97 Ga0307415_100062971 3300032126 Bacteria 2575
98 Ga0307415_100176987 3300032126 Bacteria 1670
99 Ga0307415_101179885 3300032126 Bacteria 720
100 Ga0307507_10011161 3300033179 Bacteria 11399
101 Ga0307507_10023543 3300033179 Bacteria 6754
102 Ga0307507_10033031 3300033179 Bacteria 5383
103 Ga0307510_10052993 3300033180 Bacteria 4269
104 Ga0307510_10162687 3300033180 Bacteria 1825
105 Ga0307510_10188117 3300033180 Bacteria 1616
106 Ga0373934_0107077 3300035086 Bacteria 1132
107 Ga0373936_0020097 3300035113 Bacteria 2591
108 Ga0373945_0305831 3300035116 Bacteria 682
109 Ga0373954_0053792 3300035118 Bacteria 1893
110 Ga0373956_0008391 3300035119 Bacteria 4181
111 Ga0373943_0354524 3300035170 Bacteria 841
112 Ga0373933_0016271 3300035724 Bacteria 4156
113 Ga0373947_0524861 3300035725 Bacteria 805
114 Ga0373937_0077550 3300036401 Bacteria 3070
115 Ga0373925_0132680 3300037068 Bacteria 1943
116 Ga0373925_0171590 3300037068 Bacteria 1713
117 Ga0395898_0005400 3300037466 Bacteria 13812
118 Ga0436364_1441982 3300037853 Bacteria 7285
119 Ga0451841_0187623 3300041498 Bacteria 1596
120 Ga0451849_1411127 3300041505 Bacteria 1469
121 Ga0466972_0105220 3300044658 Bacteria 1334
122 Ga0466963_0471077 3300044694 Bacteria 886
123 Ga0495592_0007897 3300046454 Bacteria 7979
124 Ga0495603_0008407 3300046455 Bacteria 6234
125 Ga0495590_0088600 3300046457 Bacteria 1094
126 Ga0495629_0008027 3300046459 Bacteria 7768
127 Ga0495629_0024239 3300046459 Bacteria 4320
128 Ga0495629_0099368 3300046459 Bacteria 2030
129 Ga0495629_0232551 3300046459 Bacteria 1270
130 Ga0495641_0210362 3300046461 Bacteria 872
131 Ga0495651_0000338 3300046462 Bacteria 36222
132 Ga0495651_0067582 3300046462 Bacteria 2726
133 Ga0495651_0078155 3300046462 Bacteria 2503
134 Ga0495653_0019060 3300046463 Bacteria 5567
135 Ga0495605_0020276 3300046474 Bacteria 3535
136 Ga0495639_0008526 3300046475 Bacteria 4397
137 Ga0495662_0006092 3300046476 Bacteria 6027
138 Ga0495662_0019959 3300046476 Bacteria 3242
139 Ga0495662_0083220 3300046476 Bacteria 1557
140 Ga0495664_0000172 3300046477 Bacteria 31804
141 Ga0495664_0013850 3300046477 Bacteria 4573
142 Ga0495583_0004253 3300046506 Bacteria 10385
143 Ga0495606_0001669 3300046507 Bacteria 28804
144 Ga0495608_0022715 3300046511 Bacteria 4302
145 Ga0495618_0562326 3300046514 Bacteria 682
146 Ga0495620_0001043 3300046515 Bacteria 17012
147 Ga0495628_0132613 3300046516 Bacteria 1905
148 Ga0495630_0266730 3300046517 Bacteria 1308
149 Ga0495643_0001233 3300046522 Bacteria 24635
150 Ga0495648_0026701 3300046524 Bacteria 3882
151 Ga0495652_0080548 3300046529 Bacteria 2689
152 Ga0495652_0165623 3300046529 Bacteria 1711
153 Ga0495640_0019582 3300046533 Bacteria 4991
154 Ga0495640_0047084 3300046533 Bacteria 2985
155 Ga0495640_0276899 3300046533 Bacteria 1045
156 Ga0495587_0001308 3300046536 Bacteria 16539
157 Ga0495587_0081310 3300046536 Bacteria 1877
158 Ga0495609_0212593 3300046538 Bacteria 805
159 Ga0495645_0002940 3300046543 Bacteria 11546
160 Ga0495645_0476096 3300046543 Bacteria 784
161 Ga0495668_0000775 3300046616 Bacteria 37253
162 Ga0495668_0026887 3300046616 Bacteria 3262
163 Ga0495634_0050059 3300046642 Bacteria 2807
164 Ga0495625_0000890 3300046660 Bacteria 40346
165 Ga0495625_0008705 3300046660 Bacteria 8606
166 Ga0495635_0009216 3300046663 Bacteria 6894
167 Ga0495635_0030867 3300046663 Bacteria 3722
168 Ga0495588_0015216 3300046674 Bacteria 3697
169 Ga0495588_0020952 3300046674 Bacteria 3217
170 Ga0495657_0003853 3300046675 Bacteria 12099
171 Ga0495657_0026748 3300046675 Bacteria 4082
172 Ga0495657_0059800 3300046675 Bacteria 2526
173 Ga0495657_0067080 3300046675 Bacteria 2356
174 Ga0495613_0008627 3300046689 Bacteria 7561
175 Ga0495613_0022044 3300046689 Bacteria 4748
176 Ga0495613_0151330 3300046689 Bacteria 1654
177 Ga0495670_0033234 3300046691 Bacteria 2567
178 Ga0495671_0003999 3300046692 Bacteria 8906
179 Ga0495649_0023823 3300046694 Bacteria 3418
180 Ga0495589_0003267 3300046794 Bacteria 8835
181 Ga0495600_0010072 3300046809 Bacteria 5858
182 Ga0495600_0409692 3300046809 Bacteria 842
183 Ga0495660_0045180 3300046810 Bacteria 2419
184 Ga0495581_0008752 3300047315 Bacteria 5860
185 Ga0495581_0058866 3300047315 Bacteria 2219
186 Ga0495581_0165770 3300047315 Bacteria 1292
187 Ga0495581_0236870 3300047315 Bacteria 1067
188 Ga0495604_0001356 3300047317 Bacteria 20036
189 Ga0495604_0024386 3300047317 Bacteria 4826
190 Ga0495604_0089595 3300047317 Bacteria 2286
191 Ga0495636_0026188 3300047318 Bacteria 2371
192 Ga0495636_0110413 3300047318 Bacteria 1210
193 Ga0495636_0178694 3300047318 Bacteria 962
194 Ga0495674_0009531 3300047319 Bacteria 9223
195 Ga0495676_0064782 3300047321 Bacteria 2839
196 Ga0495676_0408860 3300047321 Bacteria 899
197 Ga0495680_0066980 3300047322 Bacteria 2746
198 Ga0495680_0071961 3300047322 Bacteria 2630
199 Ga0495683_0109501 3300047323 Bacteria 1320
200 Ga0495687_003357 3300047443 Bacteria 11686
201 Ga0495687_004062 3300047443 Bacteria 10138
202 Ga0495687_127057 3300047443 Bacteria 909
203 Ga0495675_0072069 3300047444 Bacteria 2180
204 Ga0495675_0162614 3300047444 Bacteria 1374
205 Ga0495685_001520 3300047447 Bacteria 7110
206 Ga0495685_004332 3300047447 Bacteria 4577
207 Ga0495685_022420 3300047447 Bacteria 2173
208 Ga0495685_053451 3300047447 Bacteria 1367
209 Ga0495681_0004246 3300047470 Bacteria 9828
210 Ga0495684_0060984 3300047471 Bacteria 2870
211 Ga0495684_0188036 3300047471 Bacteria 1528
212 Ga0495593_0002981 3300047673 Bacteria 10191
213 Ga0495614_0005882 3300048089 Bacteria 5526
214 Ga0495614_0029807 3300048089 Bacteria 2347
215 Ga0495626_0000766 3300048091 Bacteria 29498
216 Ga0495626_0023881 3300048091 Bacteria 3004
217 Ga0496100_0531572 3300048903 Bacteria 908
218 Ga0496102_0083344 3300048905 Bacteria 2950
219 Ga0496103_0146041 3300048906 Bacteria 1514
220 Ga0496104_0076271 3300048907 Bacteria 3193
221 Ga0496105_0080939 3300048908 Bacteria 2683
222 Ga0496106_0069928 3300048909 Bacteria 2680
223 Ga0496107_0035360 3300048910 Bacteria 3582
224 Ga0496107_0507461 3300048910 Bacteria 894
225 Ga0496108_0000154 3300048911 Bacteria 66020
226 Ga0496108_0014131 3300048911 Bacteria 6513
227 Ga0496109_0037565 3300048912 Bacteria 4376
228 Ga0496112_0499113 3300048915 Bacteria 1152
229 Ga0496112_0800641 3300048915 Bacteria 867
230 Ga0496113_0017682 3300048916 Bacteria 4955
231 Ga0496114_0249803 3300048917 Bacteria 1561
232 Ga0496116_0000474 3300048919 Bacteria 55522
233 Ga0496117_0010859 3300048920 Bacteria 8215
234 Ga0496118_0000781 3300048921 Bacteria 51011
235 Ga0496119_0008674 3300048922 Bacteria 8890
236 Ga0501047_0050782 3300049581 Bacteria 4005
237 nmdc:mga03n38_180689_c1 3300050490 Bacteria 1081
238 nmdc:mga07m45_122188_c1 3300050496 Bacteria 1504
239 nmdc:mga07m45_226012_c1 3300050496 Bacteria 1089
240 nmdc:mga05p37_1278368_c1 3300050507 Bacteria 750
241 nmdc:mga05p37_4072_c1 3300050507 Bacteria 17081
242 nmdc:mga06r32_515115_c1 3300050510 Bacteria 1172
243 nmdc:mga08y16_591171_c1 3300050511 Bacteria 1119
244 Ga0495619_0168039 3300053085 Bacteria 1516
245 Ga0500646_0001113 3300053090 Bacteria 7306
246 Ga0500583_0033329 3300053092 Bacteria 2279
247 Ga0500583_0083319 3300053092 Bacteria 1548
248 Ga0500640_002068 3300053095 Bacteria 6471
249 Ga0500641_0021633 3300053096 Bacteria 2455
250 Ga0500560_001777 3300053107 Bacteria 3882
251 Ga0500572_003502 3300053111 Bacteria 3581
252 Ga0500559_0008262 3300053136 Bacteria 4578
253 Ga0500573_0088499 3300053140 Bacteria 1752
254 Ga0500588_0004175 3300053146 Bacteria 3109
255 Ga0500624_007127 3300053157 Bacteria 1530
256 2508674256 2508501039 Bacteria 9978592
257 2585315603 2582581314 Bacteria 11452267
258 2616695777 2616644814 Bacteria 11555299
259 2676203072 2675902999 Bacteria 9438463
260 2689959891 2687453737 Bacteria 11203906
261 2774847648 2773857921 Bacteria 9435764
262 2862186132 2862178590 Bacteria 8583590
263 2862583594 2862574272 Bacteria 10567477
264 2917744963 2917736166 Bacteria 9690793
265 8001788135 8001781756 Bacteria 9586736
266 8002788864 8002784119 Bacteria 9788632
267 Ga0114129_10004075
268 rootH2_10073474
269 Ga0070658_10593077
270 Ga0070683_100986345
271 Ga0070660_100030376
272 Ga0070668_100001170
273 Ga0070668_100087922
274 Ga0070709_10086824
275 Ga0070714_100053643
276 Ga0070714_100385092
277 Ga0070713_100849691
278 Ga0070710_10069204
279 Ga0070711_100002609
280 Ga0070707_100231311
281 Ga0070698_100247396
282 Ga0070697_100082658
283 Ga0068853_100312164
284 Ga0070672_100979498
285 Ga0070664_100296698
286 Ga0068854_100798069
287 Ga0070702_100011114
288 Ga0068864_100272498
289 Ga0068861_100025809
290 Ga0068860_100108247
291 Ga0081539_10007285
292 Ga0070717_10309942
293 Ga0070717_10326089
294 Ga0075368_10276642
295 Ga0070715_10101400
296 Ga0070716_100005398
297 Ga0070712_100016439
298 Ga0070712_100021031
299 Ga0070712_100077648
300 Ga0111539_10597205
301 Ga0105245_10077508
302 Ga0114129_10029611
303 Ga0105243_10035282
304 Ga0105242_10297237
305 Ga0105237_11013891
306 Ga0105249_10021357
307 Ga0157369_10982814
308 Ga0157374_10389799
309 Ga0163162_10493814
310 Ga0157375_11773394
311 Ga0163163_10042392
312 Ga0157377_10107498
313 Ga0157379_10603995
314 Ga0183367_1010
315 Ga0213875_10033213
316 Ga0209758_1004480
317 Ga0207692_10013554
318 Ga0207688_10020934
319 Ga0207699_10038961
320 Ga0207699_10087967
321 Ga0207643_10313481
322 Ga0207693_10023972
323 Ga0207693_10028537
324 Ga0207693_10074675
325 Ga0207693_10343011
326 Ga0207663_10005202
327 Ga0207657_10053111
328 Ga0207700_10004027
329 Ga0207700_10005777
330 Ga0207664_10004975
331 Ga0207664_10012396
332 Ga0207664_10157051
333 Ga0207690_10160215
334 Ga0207665_10002754
335 Ga0207691_10895918
336 Ga0207712_10021179
337 Ga0207668_10110053
338 Ga0207658_10089964
339 Ga0207639_10498070
340 Ga0207708_10102665
341 Ga0207676_10719368
342 Ga0207674_10313616
343 Ga0207675_100012375
344 Ga0307515_10001737
345 Ga0307515_10048457
346 Ga0307511_10156439
347 Ga0307512_10013903
348 Ga0307513_10016170
349 Ga0307509_10095255
350 Ga0307408_100176524
351 Ga0307508_10007960
352 Ga0307508_10127380
353 Ga0307516_10076285
354 Ga0307405_10006057
355 Ga0307405_10403035
356 Ga0307518_10036921
357 Ga0307407_10035102
358 Ga0307409_100049618
359 Ga0307416_100753189
360 Ga0307414_10044537
361 Ga0307414_10135262
362 Ga0307411_10198750
363 Ga0307415_100062971
364 Ga0307415_100176987
365 Ga0307415_101179885
366 Ga0307507_10011161
367 Ga0307507_10023543
368 Ga0307507_10033031
369 Ga0307510_10052993
370 Ga0307510_10162687
371 Ga0307510_10188117
372 Ga0373934_0107077
373 Ga0373936_0020097
374 Ga0373945_0305831
375 Ga0373954_0053792
376 Ga0373956_0008391
377 Ga0373943_0354524
378 Ga0373933_0016271
379 Ga0373947_0524861
380 Ga0373937_0077550
381 Ga0373925_0132680
382 Ga0373925_0171590
383 Ga0395898_0005400
384 Ga0436364_1441982
385 Ga0451841_0187623
386 Ga0451849_1411127
387 Ga0466972_0105220
388 Ga0466963_0471077
389 Ga0495592_0007897
390 Ga0495603_0008407
391 Ga0495590_0088600
392 Ga0495629_0008027
393 Ga0495629_0024239
394 Ga0495629_0099368
395 Ga0495629_0232551
396 Ga0495641_0210362
397 Ga0495651_0000338
398 Ga0495651_0067582
399 Ga0495651_0078155
400 Ga0495653_0019060
401 Ga0495605_0020276
402 Ga0495639_0008526
403 Ga0495662_0006092
404 Ga0495662_0019959
405 Ga0495662_0083220
406 Ga0495664_0000172
407 Ga0495664_0013850
408 Ga0495583_0004253
409 Ga0495606_0001669
410 Ga0495608_0022715
411 Ga0495618_0562326
412 Ga0495620_0001043
413 Ga0495628_0132613
414 Ga0495630_0266730
415 Ga0495643_0001233
416 Ga0495648_0026701
417 Ga0495652_0080548
418 Ga0495652_0165623
419 Ga0495640_0019582
420 Ga0495640_0047084
421 Ga0495640_0276899
422 Ga0495587_0001308
423 Ga0495587_0081310
424 Ga0495609_0212593
425 Ga0495645_0002940
426 Ga0495645_0476096
427 Ga0495668_0000775
428 Ga0495668_0026887
429 Ga0495634_0050059
430 Ga0495625_0000890
431 Ga0495625_0008705
432 Ga0495635_0009216
433 Ga0495635_0030867
434 Ga0495588_0015216
435 Ga0495588_0020952
436 Ga0495657_0003853
437 Ga0495657_0026748
438 Ga0495657_0059800
439 Ga0495657_0067080
440 Ga0495613_0008627
441 Ga0495613_0022044
442 Ga0495613_0151330
443 Ga0495670_0033234
444 Ga0495671_0003999
445 Ga0495649_0023823
446 Ga0495589_0003267
447 Ga0495600_0010072
448 Ga0495600_0409692
449 Ga0495660_0045180
450 Ga0495581_0008752
451 Ga0495581_0058866
452 Ga0495581_0165770
453 Ga0495581_0236870
454 Ga0495604_0001356
455 Ga0495604_0024386
456 Ga0495604_0089595
457 Ga0495636_0026188
458 Ga0495636_0110413
459 Ga0495636_0178694
460 Ga0495674_0009531
461 Ga0495676_0064782
462 Ga0495676_0408860
463 Ga0495680_0066980
464 Ga0495680_0071961
465 Ga0495683_0109501
466 Ga0495687_003357
467 Ga0495687_004062
468 Ga0495687_127057
469 Ga0495675_0072069
470 Ga0495675_0162614
471 Ga0495685_001520
472 Ga0495685_004332
473 Ga0495685_022420
474 Ga0495685_053451
475 Ga0495681_0004246
476 Ga0495684_0060984
477 Ga0495684_0188036
478 Ga0495593_0002981
479 Ga0495614_0005882
480 Ga0495614_0029807
481 Ga0495626_0000766
482 Ga0495626_0023881
483 Ga0496100_0531572
484 Ga0496102_0083344
485 Ga0496103_0146041
486 Ga0496104_0076271
487 Ga0496105_0080939
488 Ga0496106_0069928
489 Ga0496107_0035360
490 Ga0496107_0507461
491 Ga0496108_0000154
492 Ga0496108_0014131
493 Ga0496109_0037565
494 Ga0496112_0499113
495 Ga0496112_0800641
496 Ga0496113_0017682
497 Ga0496114_0249803
498 Ga0496116_0000474
499 Ga0496117_0010859
500 Ga0496118_0000781
501 Ga0496119_0008674
502 Ga0501047_0050782
503 nmdc:mga03n38_180689_c1
504 nmdc:mga07m45_122188_c1
505 nmdc:mga07m45_226012_c1
506 nmdc:mga05p37_1278368_c1
507 nmdc:mga05p37_4072_c1
508 nmdc:mga06r32_515115_c1
509 nmdc:mga08y16_591171_c1
510 Ga0495619_0168039
511 Ga0500646_0001113
512 Ga0500583_0033329
513 Ga0500583_0083319
514 Ga0500640_002068
515 Ga0500641_0021633
516 Ga0500560_001777
517 Ga0500572_003502
518 Ga0500559_0008262
519 Ga0500573_0088499
520 Ga0500588_0004175
521 Ga0500624_007127
522 2508674256
523 2585315603
524 2616695777
525 2676203072
526 2689959891
527 2774847648
528 2862186132
529 2862583594
530 2917744963
531 8001788135
532 8002788864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

15

92

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8421 6 93
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.8356 8 94
5zqh-assembly1.cif.gz_A-2 crystal structure of streptococcus transcriptional regulator 0.8292 10 93
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8257 6 93
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.8251 9 94
ID Description Score Start End Superfamily
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8799 10 90 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8791 10 90 1.10.10.10
3l9fD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8464 10 90 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8292 10 93 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8239 5 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A191WHV3-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9428 8 183
AF-A0A7W7RAX7-F1-model_v4 DNA-binding PadR family transcriptional regulator 0.9372 5 185 GO:0003677
AF-A0A857KG33-F1-model_v4 PadR family transcriptional regulator 0.9346 1 184
AF-A0A561SWB6-F1-model_v4 DNA-binding PadR family transcriptional regulator 0.9308 1 184 GO:0003677
AF-A0A1D8GFD2-F1-model_v4 PadR family transcriptional regulator 0.9228 10 180

Map