F373901

General Info

Members Datasets Scaffolds Average Seq Length
266 147 532 221

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100043980|Ga0070678_1000439804
Length 230
Sequence VAGRYRRGVRLLLALVLTMAVAPPRPAVDSKPIPFGAQRRAETARYAERHYGLDTWRLQHPRVVVEHYTASTSFSSAWNTFANDAPDAELHELPGTCAHFVIDRDGTIYQLVALTTICRHTVGLNWTAIGIEHVGTSDASILQNPRQLSASLRLTLWLMHRYGISLPNVIGHNESLTSRYHRERYAPWRCQTHGDWTHADMQRYRARLAALARGEHVALSRAGGPVASGC

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 2.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.27
Rhizosphere 90.98
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100043980 3300005456 Bacteria 3186
2 Ga0070658_10015969 3300005327 Bacteria 6006
3 Ga0070658_10156707 3300005327 Bacteria 1909
4 Ga0070683_100111510 3300005329 Bacteria 2581
5 Ga0070683_100170673 3300005329 Unclassified 2065
6 Ga0070683_100280630 3300005329 Bacteria 1584
7 Ga0070680_100016141 3300005336 Bacteria 5871
8 Ga0070680_100062725 3300005336 Bacteria 3044
9 Ga0070680_100183529 3300005336 Unclassified 1762
10 Ga0070660_100002325 3300005339 Bacteria 13063
11 Ga0070660_100004204 3300005339 Bacteria 9938
12 Ga0070660_100067701 3300005339 Bacteria 2782
13 Ga0070660_100203083 3300005339 Bacteria 1608
14 Ga0070661_100035483 3300005344 Bacteria 3621
15 Ga0070661_100062866 3300005344 Bacteria 2726
16 Ga0070659_100010681 3300005366 Bacteria 6763
17 Ga0070659_100087115 3300005366 Bacteria 2500
18 Ga0070713_100434295 3300005436 Bacteria 1231
19 Ga0070710_10041458 3300005437 Bacteria 2542
20 Ga0070711_100107331 3300005439 Bacteria 2043
21 Ga0070708_100056088 3300005445 Bacteria 3504
22 Ga0070681_10007309 3300005458 Bacteria 10783
23 Ga0070681_10007551 3300005458 Bacteria 10623
24 Ga0070681_10039233 3300005458 Bacteria 4747
25 Ga0070706_100659703 3300005467 Bacteria 971
26 Ga0070699_100145624 3300005518 Bacteria 2093
27 Ga0070679_100004896 3300005530 Bacteria 12348
28 Ga0070679_100025902 3300005530 Bacteria 5755
29 Ga0070679_100089593 3300005530 Bacteria 3063
30 Ga0070679_100163903 3300005530 Bacteria 2197
31 Ga0070679_100379272 3300005530 Bacteria 1361
32 Ga0070684_100015816 3300005535 Bacteria 6156
33 Ga0070684_100173478 3300005535 Bacteria 1959
34 Ga0070684_100386392 3300005535 Bacteria 1289
35 Ga0070686_100090203 3300005544 Bacteria 2049
36 Ga0070665_100009150 3300005548 Bacteria 10032
37 Ga0068855_100028609 3300005563 Bacteria 6667
38 Ga0068855_100114836 3300005563 Bacteria 3087
39 Ga0068857_100008169 3300005577 Bacteria 9040
40 Ga0068857_100738902 3300005577 Bacteria 937
41 Ga0068856_100146864 3300005614 Unclassified 2366
42 Ga0068856_100277462 3300005614 Bacteria 1692
43 Ga0068856_100607576 3300005614 Bacteria 1114
44 Ga0068852_100332143 3300005616 Bacteria 1479
45 Ga0070712_100340962 3300006175 Bacteria 1224
46 Ga0068871_100193498 3300006358 Bacteria 1753
47 Ga0075435_100027990 3300007076 Bacteria 4416
48 Ga0105240_10042368 3300009093 Bacteria 5801
49 Ga0105240_10060719 3300009093 Bacteria 4712
50 Ga0105245_10284169 3300009098 Bacteria 1618
51 Ga0105241_10226851 3300009174 Bacteria 1573
52 Ga0105241_10560763 3300009174 Bacteria 1027
53 Ga0105242_10043086 3300009176 Bacteria 3649
54 Ga0105248_10314973 3300009177 Bacteria 1762
55 Ga0105237_10005668 3300009545 Bacteria 14053
56 Ga0105237_10048271 3300009545 Bacteria 4279
57 Ga0105238_10046529 3300009551 Bacteria 4378
58 Ga0105238_10259542 3300009551 Bacteria 1717
59 Ga0105239_10376300 3300010375 Unclassified 1605
60 Ga0157373_10198917 3300013100 Bacteria 1413
61 Ga0157371_10068672 3300013102 Bacteria 2509
62 Ga0157370_10003288 3300013104 Bacteria 19063
63 Ga0157370_10013616 3300013104 Bacteria 8370
64 Ga0157370_10085864 3300013104 Bacteria 2957
65 Ga0157370_10245117 3300013104 Bacteria 1658
66 Ga0157369_10011147 3300013105 Bacteria 10221
67 Ga0157369_10040146 3300013105 Bacteria 5111
68 Ga0157369_10043574 3300013105 Bacteria 4891
69 Ga0157369_10136676 3300013105 Bacteria 2595
70 Ga0157369_10190096 3300013105 Bacteria 2158
71 Ga0157369_10496610 3300013105 Bacteria 1262
72 Ga0157369_10609457 3300013105 Bacteria 1127
73 Ga0157374_10083214 3300013296 Bacteria 3040
74 Ga0157372_10044810 3300013307 Bacteria 4903
75 Ga0157372_10066876 3300013307 Bacteria 4038
76 Ga0157372_10197186 3300013307 Bacteria 2332
77 Ga0157375_10068460 3300013308 Bacteria 3552
78 Ga0157376_10512019 3300014969 Bacteria 1181
79 Ga0197907_10759800 3300020069 Bacteria 1717
80 Ga0206356_11600539 3300020070 Bacteria 2272
81 Ga0206356_11735406 3300020070 Bacteria 1151
82 Ga0206354_11480424 3300020081 Bacteria 4621
83 Ga0206353_10536908 3300020082 Bacteria 1736
84 Ga0206353_11803432 3300020082 Bacteria 4383
85 Ga0206353_11907833 3300020082 Bacteria 1256
86 Ga0207692_10259667 3300025898 Bacteria 1044
87 Ga0207705_10016080 3300025909 Bacteria 5370
88 Ga0207705_10090330 3300025909 Bacteria 2242
89 Ga0207654_10248549 3300025911 Bacteria 1191
90 Ga0207707_10036469 3300025912 Bacteria 4298
91 Ga0207707_10037979 3300025912 Bacteria 4207
92 Ga0207707_10076691 3300025912 Bacteria 2917
93 Ga0207707_10425313 3300025912 Bacteria 1138
94 Ga0207695_10139322 3300025913 Bacteria 2376
95 Ga0207695_10406172 3300025913 Bacteria 1246
96 Ga0207671_10086903 3300025914 Bacteria 2351
97 Ga0207693_10031519 3300025915 Bacteria 4189
98 Ga0207693_10213258 3300025915 Bacteria 1517
99 Ga0207660_10048257 3300025917 Unclassified 3012
100 Ga0207660_10459251 3300025917 Bacteria 1030
101 Ga0207657_10000683 3300025919 Bacteria 36161
102 Ga0207657_10002505 3300025919 Bacteria 19866
103 Ga0207657_10108313 3300025919 Bacteria 2297
104 Ga0207657_10127568 3300025919 Bacteria 2088
105 Ga0207657_10311846 3300025919 Bacteria 1245
106 Ga0207649_10033753 3300025920 Bacteria 3061
107 Ga0207649_10065627 3300025920 Bacteria 2298
108 Ga0207649_10477476 3300025920 Bacteria 945
109 Ga0207652_10071907 3300025921 Unclassified 3006
110 Ga0207652_10097588 3300025921 Bacteria 2590
111 Ga0207700_10151280 3300025928 Bacteria 1918
112 Ga0207644_10099267 3300025931 Bacteria 2184
113 Ga0207690_10208992 3300025932 Bacteria 1487
114 Ga0207661_10449577 3300025944 Bacteria 1173
115 Ga0207661_10486852 3300025944 Bacteria 1126
116 Ga0207667_10033383 3300025949 Bacteria 5532
117 Ga0207667_10209673 3300025949 Bacteria 1997
118 Ga0207667_10392958 3300025949 Bacteria 1412
119 Ga0207667_10608575 3300025949 Bacteria 1101
120 Ga0207651_10510824 3300025960 Bacteria 1040
121 Ga0207639_10908361 3300026041 Bacteria 823
122 Ga0207678_10151486 3300026067 Bacteria 1980
123 Ga0207702_10415133 3300026078 Bacteria 1300
124 Ga0207674_10004948 3300026116 Bacteria 15914
125 Ga0207674_10007757 3300026116 Bacteria 12488
126 Ga0207674_10301333 3300026116 Bacteria 1552
127 Ga0207683_10156135 3300026121 Bacteria 2061
128 Ga0207698_10199973 3300026142 Unclassified 1788
129 Ga0207698_10246571 3300026142 Bacteria 1632
130 Ga0268266_10650848 3300028379 Bacteria 1014
131 Ga0265322_10006601 3300028654 Bacteria 3410
132 Ga0265338_10003752 3300028800 Bacteria 21100
133 Ga0265330_10009631 3300031235 Bacteria 4583
134 Ga0265329_10016546 3300031242 Bacteria 2554
135 Ga0265340_10030548 3300031247 Bacteria 2700
136 Ga0265339_10022200 3300031249 Bacteria 3680
137 Ga0265327_10016420 3300031251 Bacteria 4703
138 Ga0265316_10053774 3300031344 Bacteria 3154
139 Ga0265313_10013419 3300031595 Bacteria 4919
140 Ga0265314_10010432 3300031711 Bacteria 7749
141 Ga0265342_10024573 3300031712 Bacteria 3801
142 Ga0373944_0046993 3300035089 Unclassified 1351
143 Ga0373936_0048245 3300035113 Bacteria 1719
144 Ga0373936_0198297 3300035113 Bacteria 885
145 Ga0373943_0014751 3300035170 Bacteria 3543
146 Ga0373943_0027488 3300035170 Bacteria 2673
147 Ga0373946_0009605 3300035171 Bacteria 3567
148 Ga0373946_0097357 3300035171 Bacteria 1313
149 Ga0373935_0009148 3300035692 Bacteria 5929
150 Ga0373927_0100606 3300035695 Bacteria 1880
151 Ga0373947_0000222 3300035725 Bacteria 31904
152 Ga0373937_0691490 3300036401 Bacteria 966
153 Ga0373925_0005057 3300037068 Bacteria 9882
154 Ga0373925_0014425 3300037068 Bacteria 5712
155 Ga0395900_0050411 3300037418 Bacteria 4288
156 Ga0395900_0057670 3300037418 Bacteria 3998
157 Ga0395900_0227891 3300037418 Bacteria 1875
158 Ga0395898_0065503 3300037466 Bacteria 3522
159 Ga0395898_0296594 3300037466 Bacteria 1542
160 Ga0395898_0479917 3300037466 Bacteria 1183
161 Ga0395905_0556866 3300037471 Bacteria 1048
162 Ga0395901_0092371 3300038443 Bacteria 3168
163 Ga0395901_0187296 3300038443 Bacteria 2170
164 Ga0395901_0339272 3300038443 Bacteria 1553
165 Ga0436363_0803858 3300039450 Bacteria 1135
166 Ga0451853_1731673 3300041512 Bacteria 1738
167 Ga0466969_0127566 3300044656 Bacteria 1181
168 Ga0466972_0086414 3300044658 Bacteria 1491
169 Ga0466966_0035459 3300044684 Bacteria 3222
170 Ga0466966_0114332 3300044684 Bacteria 1662
171 Ga0466961_0001506 3300044693 Bacteria 14458
172 Ga0466961_0031042 3300044693 Bacteria 3434
173 Ga0466961_0168187 3300044693 Bacteria 1364
174 Ga0466961_0229343 3300044693 Bacteria 1143
175 Ga0466961_0244238 3300044693 Bacteria 1103
176 Ga0466961_0305726 3300044693 Bacteria 971
177 Ga0466963_0001089 3300044694 Bacteria 14160
178 Ga0466963_0036183 3300044694 Bacteria 3219
179 Ga0466963_0069567 3300044694 Bacteria 2366
180 Ga0466963_0080714 3300044694 Bacteria 2202
181 Ga0466963_0115925 3300044694 Bacteria 1841
182 Ga0466963_0266667 3300044694 Unclassified 1203
183 Ga0466963_0291846 3300044694 Bacteria 1146
184 Ga0466964_0023153 3300044706 Bacteria 2414
185 Ga0466964_0037065 3300044706 Bacteria 1957
186 Ga0466971_0001983 3300044719 Bacteria 8660
187 Ga0466971_0113708 3300044719 Bacteria 1250
188 Ga0466970_0058584 3300044765 Bacteria 2062
189 Ga0466970_0134816 3300044765 Bacteria 1358
190 Ga0466970_0173273 3300044765 Bacteria 1196
191 Ga0466957_0000702 3300044842 Bacteria 17095
192 Ga0466957_0019700 3300044842 Bacteria 3969
193 Ga0466959_0056129 3300045049 Bacteria 2874
194 Ga0466958_0005789 3300045836 Bacteria 6684
195 Ga0466958_0021011 3300045836 Bacteria 3811
196 Ga0466958_0081941 3300045836 Bacteria 1986
197 Ga0466958_0165482 3300045836 Bacteria 1399
198 Ga0466967_0000359 3300045976 Bacteria 21145
199 Ga0466967_0008879 3300045976 Bacteria 7412
200 Ga0466967_0026236 3300045976 Bacteria 4822
201 Ga0466967_0029868 3300045976 Bacteria 4568
202 Ga0466967_0034277 3300045976 Bacteria 4307
203 Ga0466967_0046063 3300045976 Bacteria 3794
204 Ga0466967_0055600 3300045976 Bacteria 3486
205 Ga0466967_0122783 3300045976 Bacteria 2402
206 Ga0466967_0192466 3300045976 Bacteria 1928
207 Ga0466967_0323262 3300045976 Bacteria 1488
208 Ga0495629_0003818 3300046459 Bacteria 11359
209 Ga0495641_0000909 3300046461 Bacteria 25276
210 Ga0495653_0167589 3300046463 Bacteria 1519
211 Ga0495582_0000389 3300046473 Bacteria 23879
212 Ga0495639_0010346 3300046475 Bacteria 4017
213 Ga0495662_0013196 3300046476 Bacteria 4022
214 Ga0495630_0008652 3300046517 Bacteria 7306
215 Ga0495630_0051633 3300046517 Bacteria 3077
216 Ga0495666_0123219 3300046526 Bacteria 1213
217 Ga0495665_0004221 3300046531 Bacteria 7757
218 Ga0495635_0014355 3300046663 Bacteria 5541
219 Ga0495658_0001525 3300046683 Bacteria 12150
220 Ga0495658_0021807 3300046683 Bacteria 3381
221 Ga0495613_0002272 3300046689 Bacteria 14542
222 Ga0495624_0027148 3300046690 Bacteria 3751
223 Ga0495624_0133628 3300046690 Bacteria 1521
224 Ga0495581_0006425 3300047315 Bacteria 6820
225 Ga0495676_0015324 3300047321 Bacteria 6830
226 Ga0495684_0020449 3300047471 Bacteria 5101
227 Ga0495593_0001341 3300047673 Bacteria 14398
228 Ga0495614_0002011 3300048089 Bacteria 8942
229 Ga0496100_0014140 3300048903 Bacteria 4625
230 Ga0496100_0019771 3300048903 Bacteria 4026
231 Ga0496100_0061396 3300048903 Bacteria 2477
232 Ga0496101_0010053 3300048904 Bacteria 6236
233 Ga0496102_0010551 3300048905 Bacteria 7955
234 Ga0496102_0216703 3300048905 Bacteria 1804
235 Ga0496102_0226563 3300048905 Bacteria 1762
236 Ga0496103_0086320 3300048906 Bacteria 1978
237 Ga0496104_0259526 3300048907 Bacteria 1650
238 Ga0496104_0535563 3300048907 Bacteria 1082
239 Ga0496105_0005740 3300048908 Bacteria 9452
240 Ga0496105_0050279 3300048908 Bacteria 3443
241 Ga0496106_0044028 3300048909 Bacteria 3350
242 Ga0496107_0030945 3300048910 Bacteria 3816
243 Ga0496108_0106562 3300048911 Bacteria 2393
244 Ga0496112_0159505 3300048915 Bacteria 2222
245 Ga0496112_0194259 3300048915 Bacteria 1991
246 Ga0496114_0005321 3300048917 Bacteria 10057
247 Ga0496114_0009820 3300048917 Bacteria 7606
248 Ga0496114_0060902 3300048917 Bacteria 3155
249 Ga0496115_0003110 3300048918 Bacteria 11925
250 Ga0496115_0007538 3300048918 Bacteria 8016
251 Ga0501067_0004043 3300049583 Bacteria 8091
252 Ga0501069_0001239 3300049585 Bacteria 12487
253 Ga0501069_0049402 3300049585 Bacteria 2338
254 Ga0501069_0372793 3300049585 Bacteria 843
255 Ga0501070_0000179 3300049586 Bacteria 59086
256 Ga0501070_0017481 3300049586 Bacteria 6020
257 Ga0501070_0185781 3300049586 Bacteria 1710
258 Ga0501074_0009319 3300049590 Bacteria 7131
259 Ga0501080_0031825 3300049742 Bacteria 4915
260 Ga0501080_0246898 3300049742 Bacteria 1628
261 nmdc:mga0n895_35969_c1 3300050512 Bacteria 4778
262 nmdc:mga0rr50_20568_c1 3300050513 Bacteria 4487
263 Ga0495619_0013817 3300053085 Bacteria 5095
264 Ga0466962_0000121 3300061719 Bacteria 31836
265 Ga0466962_0109886 3300061719 Bacteria 1327
266 Ga0530510_0166625 3300061734 Bacteria 1631
267 Ga0070678_100043980
268 Ga0070658_10015969
269 Ga0070658_10156707
270 Ga0070683_100111510
271 Ga0070683_100170673
272 Ga0070683_100280630
273 Ga0070680_100016141
274 Ga0070680_100062725
275 Ga0070680_100183529
276 Ga0070660_100002325
277 Ga0070660_100004204
278 Ga0070660_100067701
279 Ga0070660_100203083
280 Ga0070661_100035483
281 Ga0070661_100062866
282 Ga0070659_100010681
283 Ga0070659_100087115
284 Ga0070713_100434295
285 Ga0070710_10041458
286 Ga0070711_100107331
287 Ga0070708_100056088
288 Ga0070681_10007309
289 Ga0070681_10007551
290 Ga0070681_10039233
291 Ga0070706_100659703
292 Ga0070699_100145624
293 Ga0070679_100004896
294 Ga0070679_100025902
295 Ga0070679_100089593
296 Ga0070679_100163903
297 Ga0070679_100379272
298 Ga0070684_100015816
299 Ga0070684_100173478
300 Ga0070684_100386392
301 Ga0070686_100090203
302 Ga0070665_100009150
303 Ga0068855_100028609
304 Ga0068855_100114836
305 Ga0068857_100008169
306 Ga0068857_100738902
307 Ga0068856_100146864
308 Ga0068856_100277462
309 Ga0068856_100607576
310 Ga0068852_100332143
311 Ga0070712_100340962
312 Ga0068871_100193498
313 Ga0075435_100027990
314 Ga0105240_10042368
315 Ga0105240_10060719
316 Ga0105245_10284169
317 Ga0105241_10226851
318 Ga0105241_10560763
319 Ga0105242_10043086
320 Ga0105248_10314973
321 Ga0105237_10005668
322 Ga0105237_10048271
323 Ga0105238_10046529
324 Ga0105238_10259542
325 Ga0105239_10376300
326 Ga0157373_10198917
327 Ga0157371_10068672
328 Ga0157370_10003288
329 Ga0157370_10013616
330 Ga0157370_10085864
331 Ga0157370_10245117
332 Ga0157369_10011147
333 Ga0157369_10040146
334 Ga0157369_10043574
335 Ga0157369_10136676
336 Ga0157369_10190096
337 Ga0157369_10496610
338 Ga0157369_10609457
339 Ga0157374_10083214
340 Ga0157372_10044810
341 Ga0157372_10066876
342 Ga0157372_10197186
343 Ga0157375_10068460
344 Ga0157376_10512019
345 Ga0197907_10759800
346 Ga0206356_11600539
347 Ga0206356_11735406
348 Ga0206354_11480424
349 Ga0206353_10536908
350 Ga0206353_11803432
351 Ga0206353_11907833
352 Ga0207692_10259667
353 Ga0207705_10016080
354 Ga0207705_10090330
355 Ga0207654_10248549
356 Ga0207707_10036469
357 Ga0207707_10037979
358 Ga0207707_10076691
359 Ga0207707_10425313
360 Ga0207695_10139322
361 Ga0207695_10406172
362 Ga0207671_10086903
363 Ga0207693_10031519
364 Ga0207693_10213258
365 Ga0207660_10048257
366 Ga0207660_10459251
367 Ga0207657_10000683
368 Ga0207657_10002505
369 Ga0207657_10108313
370 Ga0207657_10127568
371 Ga0207657_10311846
372 Ga0207649_10033753
373 Ga0207649_10065627
374 Ga0207649_10477476
375 Ga0207652_10071907
376 Ga0207652_10097588
377 Ga0207700_10151280
378 Ga0207644_10099267
379 Ga0207690_10208992
380 Ga0207661_10449577
381 Ga0207661_10486852
382 Ga0207667_10033383
383 Ga0207667_10209673
384 Ga0207667_10392958
385 Ga0207667_10608575
386 Ga0207651_10510824
387 Ga0207639_10908361
388 Ga0207678_10151486
389 Ga0207702_10415133
390 Ga0207674_10004948
391 Ga0207674_10007757
392 Ga0207674_10301333
393 Ga0207683_10156135
394 Ga0207698_10199973
395 Ga0207698_10246571
396 Ga0268266_10650848
397 Ga0265322_10006601
398 Ga0265338_10003752
399 Ga0265330_10009631
400 Ga0265329_10016546
401 Ga0265340_10030548
402 Ga0265339_10022200
403 Ga0265327_10016420
404 Ga0265316_10053774
405 Ga0265313_10013419
406 Ga0265314_10010432
407 Ga0265342_10024573
408 Ga0373944_0046993
409 Ga0373936_0048245
410 Ga0373936_0198297
411 Ga0373943_0014751
412 Ga0373943_0027488
413 Ga0373946_0009605
414 Ga0373946_0097357
415 Ga0373935_0009148
416 Ga0373927_0100606
417 Ga0373947_0000222
418 Ga0373937_0691490
419 Ga0373925_0005057
420 Ga0373925_0014425
421 Ga0395900_0050411
422 Ga0395900_0057670
423 Ga0395900_0227891
424 Ga0395898_0065503
425 Ga0395898_0296594
426 Ga0395898_0479917
427 Ga0395905_0556866
428 Ga0395901_0092371
429 Ga0395901_0187296
430 Ga0395901_0339272
431 Ga0436363_0803858
432 Ga0451853_1731673
433 Ga0466969_0127566
434 Ga0466972_0086414
435 Ga0466966_0035459
436 Ga0466966_0114332
437 Ga0466961_0001506
438 Ga0466961_0031042
439 Ga0466961_0168187
440 Ga0466961_0229343
441 Ga0466961_0244238
442 Ga0466961_0305726
443 Ga0466963_0001089
444 Ga0466963_0036183
445 Ga0466963_0069567
446 Ga0466963_0080714
447 Ga0466963_0115925
448 Ga0466963_0266667
449 Ga0466963_0291846
450 Ga0466964_0023153
451 Ga0466964_0037065
452 Ga0466971_0001983
453 Ga0466971_0113708
454 Ga0466970_0058584
455 Ga0466970_0134816
456 Ga0466970_0173273
457 Ga0466957_0000702
458 Ga0466957_0019700
459 Ga0466959_0056129
460 Ga0466958_0005789
461 Ga0466958_0021011
462 Ga0466958_0081941
463 Ga0466958_0165482
464 Ga0466967_0000359
465 Ga0466967_0008879
466 Ga0466967_0026236
467 Ga0466967_0029868
468 Ga0466967_0034277
469 Ga0466967_0046063
470 Ga0466967_0055600
471 Ga0466967_0122783
472 Ga0466967_0192466
473 Ga0466967_0323262
474 Ga0495629_0003818
475 Ga0495641_0000909
476 Ga0495653_0167589
477 Ga0495582_0000389
478 Ga0495639_0010346
479 Ga0495662_0013196
480 Ga0495630_0008652
481 Ga0495630_0051633
482 Ga0495666_0123219
483 Ga0495665_0004221
484 Ga0495635_0014355
485 Ga0495658_0001525
486 Ga0495658_0021807
487 Ga0495613_0002272
488 Ga0495624_0027148
489 Ga0495624_0133628
490 Ga0495581_0006425
491 Ga0495676_0015324
492 Ga0495684_0020449
493 Ga0495593_0001341
494 Ga0495614_0002011
495 Ga0496100_0014140
496 Ga0496100_0019771
497 Ga0496100_0061396
498 Ga0496101_0010053
499 Ga0496102_0010551
500 Ga0496102_0216703
501 Ga0496102_0226563
502 Ga0496103_0086320
503 Ga0496104_0259526
504 Ga0496104_0535563
505 Ga0496105_0005740
506 Ga0496105_0050279
507 Ga0496106_0044028
508 Ga0496107_0030945
509 Ga0496108_0106562
510 Ga0496112_0159505
511 Ga0496112_0194259
512 Ga0496114_0005321
513 Ga0496114_0009820
514 Ga0496114_0060902
515 Ga0496115_0003110
516 Ga0496115_0007538
517 Ga0501067_0004043
518 Ga0501069_0001239
519 Ga0501069_0049402
520 Ga0501069_0372793
521 Ga0501070_0000179
522 Ga0501070_0017481
523 Ga0501070_0185781
524 Ga0501074_0009319
525 Ga0501080_0031825
526 Ga0501080_0246898
527 nmdc:mga0n895_35969_c1
528 nmdc:mga0rr50_20568_c1
529 Ga0495619_0013817
530 Ga0466962_0000121
531 Ga0466962_0109886
532 Ga0530510_0166625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

57

187

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6srt-assembly1.cif.gz_A endolysine n-acetylmuramoyl-l-alanine amidase lyscs from clostridium intestinale urnw 0.7917 19 169
6ssc-assembly1.cif.gz_A n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw 0.7331 20 169
7f5i-assembly1.cif.gz_A x-ray structure of clostridium perfringens-specific amidase endolysin 0.7267 20 167
1yck-assembly1.cif.gz_A crystal structure of human peptidoglycan recognition protein (pgrp-s) 0.7195 50 167
3hmb-assembly3.cif.gz_C mutant endolysin from bacillus subtilis 0.7184 20 168
ID Description Score Start End Superfamily
2aphA00 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.7116 52 169 3.40.80.10
af_Q9VS97_19_186_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6942 52 167 3.40.80.10
af_F8W3M1_289_467_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6898 52 169 3.40.80.10
af_I6Y3Z2_28_190_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6869 53 209 3.40.80.10
1lbaA00 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6855 52 169 3.40.80.10
ID Description Score Start End GO Terms
AF-A0A7Y5X2P9-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9438 14 225 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A538KLK8-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.942 15 208 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A2W6BEB8-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9386 14 205 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A538IS27-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9372 19 206 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A538CQQ2-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.9369 17 202 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555

Map