F373863

General Info

Members Datasets Scaffolds Average Seq Length
266 164 247 494

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100000394|Ga0070659_10000039426
Length 529
Sequence LYKAKENKQHSFFLQFPQTFLYLASIWAKLIPLFIMKKILVANRGEIALRVMRSAREMGIKTVAVYSEADRNALHVRYADEAVNIGPAPSNESYLVIDKIIAACQKTGAEAIHPGYGFLSENAGFARKVRAAGLILIGPSPEAMEVMGNKLSAKAAALKYNIPMVPGTEEAISDIAEAKKRAVEVGFPILIKAAAGXXGKGMRIVETANDFEEQMGLAVSEATSAFGDGSVFIERYVSSPRHIEIQVLGDTHGNIVHLFERDCSVQRRHQKVIEEAPSSVLTPELRTQMGKCAVDVARSVNYTGAGTVEFIMDTDLNFYFLEMNTRLQVEHPVTELITGIDLVKEQIRVARGEAISFKQEDLTITGHAMELRVYAEDPANEFLPDIGTLQTYKTPKGPGVRVDDGFEQGMEIPIYYDPMIAKLITYGKDRTEAIERMVRAIDEYQITGITTTLGFGKFVMQHEAFTSGKFDTHFVKKYFTPDMLKTADDTESGIAAMILSKLLEMKKNVPVQANADSRSSDWVKNRKLI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
10 2818991437 Pedobacter terrae 518 Isolate Unclassified
11 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
12 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
13 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
14 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
15 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
16 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
17 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
18 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
19 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
20 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.48
Metatranscriptomes 0.38
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.78
Nodule 0
Rhizoplane 0.75
Rhizosphere 76.69
Stem 0
Stem Tuber 0
Unclassified 9.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3406360 2162886007 Bacteria 10524
2 JGI24740J21852_10032923 3300001979 Bacteria 1652
3 JGI24737J22298_10008214 3300001990 Bacteria 3502
4 JGI24737J22298_10009247 3300001990 Unclassified 3285
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI25162J39368_1000427 3300002737 Bacteria 33903
7 JGI25152J39213_1000034 3300002773 Bacteria 94987
8 JGI25150J39212_1000001 3300002774 Bacteria 1318726
9 JGI25151J46595_10000001 3300003187 Bacteria 887211
10 JGI25165J46597_1000548 3300003214 Bacteria 34311
11 JGI25153J46596_10000001 3300003215 Bacteria 748985
12 rootH1_10016152 3300003316 Bacteria 32703
13 rootH2_10006566 3300003320 Bacteria 99379
14 rootH1_10016448 3300003323 Bacteria 4600
15 rootH1_10175387 3300003323 Bacteria 4680
16 Ga0055536_1000001 3300003781 Bacteria 630663
17 Ga0055536_1006417 3300003781 Bacteria 5500
18 Ga0058863_10033782 3300004799 Bacteria 3064
19 Ga0065165_1000226 3300005262 Bacteria 99005
20 Ga0065714_10002322 3300005288 Bacteria 24622
21 Ga0065714_10005038 3300005288 Bacteria 12582
22 Ga0065714_10007298 3300005288 Bacteria 5654
23 Ga0065704_10000210 3300005289 Bacteria 93612
24 Ga0070658_10000079 3300005327 Bacteria 90829
25 Ga0070658_10069024 3300005327 Bacteria 2891
26 Ga0070676_10000294 3300005328 Bacteria 22235
27 Ga0070670_100073920 3300005331 Bacteria 2928
28 Ga0070680_100012362 3300005336 Bacteria 6630
29 Ga0068868_100024791 3300005338 Bacteria 4554
30 Ga0070659_100000394 3300005366 Bacteria 33172
31 Ga0070678_100009572 3300005456 Bacteria 5879
32 Ga0070662_100000030 3300005457 Bacteria 81418
33 Ga0070681_10021111 3300005458 Bacteria 6524
34 Ga0068867_100010298 3300005459 Bacteria 6596
35 Ga0070679_100020816 3300005530 Bacteria 6398
36 Ga0068853_100038937 3300005539 Bacteria 4053
37 Ga0070665_100000083 3300005548 Bacteria 181044
38 Ga0070665_100061582 3300005548 Bacteria 3762
39 Ga0068855_100000070 3300005563 Bacteria 123584
40 Ga0068855_100000621 3300005563 Bacteria 43643
41 Ga0068855_100014938 3300005563 Bacteria 9356
42 Ga0068855_100027968 3300005563 Bacteria 6745
43 Ga0068856_100021574 3300005614 Bacteria 6259
44 Ga0068852_100020767 3300005616 Bacteria 5225
45 Ga0068859_100013874 3300005617 Bacteria 8081
46 Ga0068864_100022447 3300005618 Bacteria 5292
47 Ga0068858_100138977 3300005842 Bacteria 2280
48 Ga0075366_10002387 3300006195 Bacteria 9631
49 Ga0075366_10005842 3300006195 Bacteria 6686
50 Ga0097621_100000440 3300006237 Bacteria 29027
51 Ga0068871_100000181 3300006358 Bacteria 42792
52 Ga0068865_100004009 3300006881 Bacteria 8844
53 Ga0097620_100013874 3300006931 Bacteria 8081
54 Ga0105240_10000039 3300009093 Bacteria 270117
55 Ga0105240_10005447 3300009093 Bacteria 18965
56 Ga0105240_10018503 3300009093 Bacteria 9352
57 Ga0105240_10053096 3300009093 Bacteria 5090
58 Ga0105240_10280480 3300009093 Bacteria 1914
59 Ga0114129_10005489 3300009147 Bacteria 17924
60 Ga0105241_10000904 3300009174 Bacteria 22429
61 Ga0105241_10001051 3300009174 Bacteria 21057
62 Ga0105242_10039982 3300009176 Bacteria 3778
63 Ga0105237_10001449 3300009545 Bacteria 31348
64 Ga0105237_10001717 3300009545 Bacteria 28335
65 Ga0105237_10002523 3300009545 Bacteria 22682
66 Ga0105237_10004250 3300009545 Bacteria 16669
67 Ga0105237_10007444 3300009545 Bacteria 11979
68 Ga0105237_10007588 3300009545 Bacteria 11857
69 Ga0105237_10020365 3300009545 Bacteria 6841
70 Ga0105238_10005256 3300009551 Bacteria 12801
71 Ga0105238_10043074 3300009551 Bacteria 4568
72 Ga0105239_10000002 3300010375 Bacteria 610298
73 Ga0105239_10000006 3300010375 Bacteria 442319
74 Ga0105239_10001188 3300010375 Bacteria 35645
75 Ga0105239_10003513 3300010375 Bacteria 19193
76 Ga0105239_10004552 3300010375 Bacteria 16523
77 Ga0157373_10000050 3300013100 Bacteria 106011
78 Ga0157373_10000276 3300013100 Bacteria 41315
79 Ga0157373_10003550 3300013100 Bacteria 11780
80 Ga0157371_10000141 3300013102 Bacteria 104396
81 Ga0157371_10000180 3300013102 Bacteria 92616
82 Ga0157371_10000803 3300013102 Bacteria 36021
83 Ga0157371_10002864 3300013102 Bacteria 16122
84 Ga0157371_10009325 3300013102 Bacteria 7736
85 Ga0157371_10010644 3300013102 Bacteria 7147
86 Ga0157371_10013511 3300013102 Bacteria 6198
87 Ga0157371_10133370 3300013102 Bacteria 1767
88 Ga0157370_10000562 3300013104 Bacteria 46367
89 Ga0157370_10002039 3300013104 Bacteria 24827
90 Ga0157370_10004266 3300013104 Bacteria 16466
91 Ga0157370_10009780 3300013104 Bacteria 10172
92 Ga0157370_10065664 3300013104 Bacteria 3433
93 Ga0157370_10071192 3300013104 Bacteria 3281
94 Ga0157369_10000940 3300013105 Bacteria 36995
95 Ga0157369_10200452 3300013105 Bacteria 2095
96 Ga0157374_10001891 3300013296 Bacteria 17554
97 Ga0157374_10004070 3300013296 Bacteria 12276
98 Ga0157374_10010379 3300013296 Bacteria 8011
99 Ga0157374_10174858 3300013296 Bacteria 2096
100 Ga0157378_10057814 3300013297 Bacteria 3457
101 Ga0163162_10000068 3300013306 Bacteria 97068
102 Ga0163162_10000141 3300013306 Bacteria 65597
103 Ga0163162_10003298 3300013306 Bacteria 15443
104 Ga0157372_10000061 3300013307 Bacteria 119814
105 Ga0157372_10005116 3300013307 Bacteria 13933
106 Ga0157372_10061196 3300013307 Bacteria 4215
107 Ga0157372_10077266 3300013307 Bacteria 3760
108 Ga0157375_10003378 3300013308 Bacteria 13841
109 Ga0157380_10000133 3300014326 Bacteria 41543
110 Ga0182008_10000006 3300014497 Bacteria 378521
111 Ga0182008_10000272 3300014497 Bacteria 40515
112 Ga0182008_10000815 3300014497 Bacteria 21742
113 Ga0182008_10003116 3300014497 Bacteria 10148
114 Ga0182006_1000903 3300015261 Bacteria 19885
115 Ga0182006_1002748 3300015261 Bacteria 9428
116 Ga0182007_10001756 3300015262 Bacteria 11388
117 Ga0182007_10005603 3300015262 Bacteria 5488
118 Ga0182007_10007664 3300015262 Bacteria 4498
119 Ga0183373_1001 3300015682 Bacteria 1410374
120 Ga0163161_10000085 3300017792 Bacteria 93534
121 Ga0163161_10000249 3300017792 Bacteria 47891
122 Ga0163161_10000425 3300017792 Bacteria 35535
123 Ga0207427_100090 3300025231 Bacteria 133759
124 Ga0209437_100034 3300025233 Bacteria 494007
125 Ga0207425_1000002 3300025245 Bacteria 1362590
126 Ga0209026_1000383 3300025250 Bacteria 40563
127 Ga0209026_1001588 3300025250 Bacteria 9762
128 Ga0209129_1000002 3300025258 Bacteria 1359086
129 Ga0209233_1000038 3300025261 Bacteria 548972
130 Ga0209233_1001253 3300025261 Bacteria 10200
131 Ga0209455_1010745 3300025272 Bacteria 2306
132 Ga0209676_1000008 3300025292 Bacteria 991778
133 Ga0209676_1002773 3300025292 Bacteria 11699
134 Ga0209025_1000004 3300025294 Bacteria 1361782
135 Ga0209758_1000006 3300025297 Bacteria 1359562
136 Ga0209050_1000055 3300025298 Bacteria 339254
137 Ga0207647_10000263 3300025904 Bacteria 43120
138 Ga0207647_10000448 3300025904 Bacteria 33476
139 Ga0207645_10000224 3300025907 Bacteria 46998
140 Ga0207705_10000112 3300025909 Bacteria 90821
141 Ga0207705_10051283 3300025909 Bacteria 2970
142 Ga0207654_10010504 3300025911 Bacteria 4714
143 Ga0207695_10000058 3300025913 Bacteria 366582
144 Ga0207695_10003717 3300025913 Bacteria 21241
145 Ga0207695_10026002 3300025913 Bacteria 6540
146 Ga0207695_10104074 3300025913 Bacteria 2829
147 Ga0207695_10146133 3300025913 Bacteria 2308
148 Ga0207671_10002787 3300025914 Bacteria 18240
149 Ga0207671_10003920 3300025914 Bacteria 14510
150 Ga0207671_10004830 3300025914 Bacteria 12687
151 Ga0207671_10006902 3300025914 Bacteria 10014
152 Ga0207671_10016123 3300025914 Bacteria 5821
153 Ga0207660_10007183 3300025917 Bacteria 7209
154 Ga0207694_10013977 3300025924 Bacteria 6053
155 Ga0207690_10004764 3300025932 Bacteria 8004
156 Ga0207706_10000129 3300025933 Bacteria 81280
157 Ga0207704_10000037 3300025938 Bacteria 93990
158 Ga0207704_10137128 3300025938 Bacteria 1705
159 Ga0207689_10037315 3300025942 Bacteria 4031
160 Ga0207667_10000009 3300025949 Bacteria 603135
161 Ga0207667_10001434 3300025949 Bacteria 29877
162 Ga0207667_10133134 3300025949 Bacteria 2561
163 Ga0207677_10005616 3300026023 Bacteria 6815
164 Ga0207677_10035698 3300026023 Bacteria 3231
165 Ga0207639_10051821 3300026041 Bacteria 3124
166 Ga0207702_10000273 3300026078 Bacteria 59343
167 Ga0207648_10000241 3300026089 Bacteria 58974
168 Ga0207683_10004019 3300026121 Bacteria 12724
169 Ga0207698_10001086 3300026142 Bacteria 15810
170 Ga0268266_10000095 3300028379 Bacteria 186169
171 Ga0307517_10000719 3300028786 Bacteria 56987
172 Ga0307515_10000144 3300028794 Bacteria 170910
173 Ga0307515_10003557 3300028794 Bacteria 32734
174 Ga0265338_10026169 3300028800 Bacteria 5895
175 Ga0265328_10011315 3300031239 Bacteria 3569
176 Ga0265331_10010285 3300031250 Bacteria 5186
177 Ga0265327_10003266 3300031251 Bacteria 15713
178 Ga0307509_10038677 3300031507 Bacteria 5203
179 Ga0307408_100000375 3300031548 Bacteria 40830
180 Ga0307405_10032632 3300031731 Bacteria 3079
181 Ga0307405_10082132 3300031731 Bacteria 2108
182 Ga0307412_10000055 3300031911 Bacteria 147100
183 Ga0307412_10033898 3300031911 Bacteria 3249
184 Ga0307414_10002170 3300032004 Bacteria 10236
185 Ga0307414_10002283 3300032004 Bacteria 10019
186 Ga0307414_10010958 3300032004 Bacteria 5295
187 Ga0307414_10091074 3300032004 Bacteria 2265
188 Ga0307414_10154533 3300032004 Bacteria 1814
189 Ga0307507_10001815 3300033179 Bacteria 46860
190 Ga0307510_10003007 3300033180 Bacteria 19408
191 Ga0373941_0016411 3300035115 Bacteria 2012
192 Ga0395899_0000001 3300037312 Bacteria 1750322
193 Ga0395899_0000382 3300037312 Bacteria 52888
194 Ga0395899_0008447 3300037312 Bacteria 7933
195 Ga0395900_0000362 3300037418 Bacteria 65661
196 Ga0395900_0014591 3300037418 Bacteria 8016
197 Ga0395905_0001575 3300037471 Bacteria 27234
198 Ga0466961_0019589 3300044693 Bacteria 4354
199 Ga0453684_0001969 3300044712 Bacteria 52743
200 Ga0466959_0009786 3300045049 Bacteria 6831
201 Ga0451576_0023876 3300045051 Bacteria 6613
202 Ga0466958_0018363 3300045836 Bacteria 4059
203 Ga0495650_0000003 3300046471 Bacteria 900730
204 Ga0495585_0000393 3300046492 Bacteria 42348
205 Ga0495583_0023465 3300046506 Bacteria 3121
206 Ga0495606_0000116 3300046507 Bacteria 134901
207 Ga0495606_0008672 3300046507 Bacteria 8764
208 Ga0495606_0015341 3300046507 Bacteria 5910
209 Ga0495606_0032448 3300046507 Bacteria 3617
210 Ga0495610_0000152 3300046512 Bacteria 76668
211 Ga0495610_0005913 3300046512 Bacteria 8571
212 Ga0495616_0001938 3300046513 Bacteria 13915
213 Ga0495616_0009184 3300046513 Bacteria 5801
214 Ga0495609_0004189 3300046538 Bacteria 7999
215 Ga0495633_0000027 3300046558 Bacteria 204613
216 Ga0495633_0005012 3300046558 Bacteria 8257
217 Ga0495668_0000010 3300046616 Bacteria 487308
218 Ga0495625_0000219 3300046660 Bacteria 90690
219 Ga0495625_0000381 3300046660 Bacteria 67732
220 Ga0495625_0000939 3300046660 Bacteria 39095
221 Ga0495625_0040248 3300046660 Bacteria 3410
222 Ga0495661_0000997 3300046665 Bacteria 25537
223 Ga0495661_0001592 3300046665 Bacteria 18700
224 Ga0495661_0044006 3300046665 Bacteria 2740
225 Ga0495669_0010720 3300046684 Bacteria 3879
226 Ga0495649_0000037 3300046694 Bacteria 133848
227 Ga0495687_002275 3300047443 Bacteria 15733
228 Ga0495686_0002885 3300047472 Bacteria 15434
229 Ga0495686_0005143 3300047472 Bacteria 10435
230 Ga0495686_0022632 3300047472 Bacteria 4157
231 Ga0496115_0070275 3300048918 Bacteria 2838
232 Ga0496122_0000404 3300048925 Bacteria 91618
233 Ga0496125_0137112 3300048928 Bacteria 1709
234 Ga0501223_000806 3300049663 Bacteria 7419
235 nmdc:mga0k408_1566_c1 3300050493 Bacteria 10893
236 nmdc:mga0k408_2175_c1 3300050493 Bacteria 10518
237 nmdc:mga0k408_2754_c1 3300050493 Bacteria 9344
238 nmdc:mga05p37_97879_c1 3300050507 Bacteria 3614
239 Ga0500635_0002508 3300053080 Bacteria 4560
240 Ga0500651_0003271 3300053093 Bacteria 8822
241 Ga0500608_001259 3300053122 Bacteria 9029
242 Ga0500618_000013 3300053125 Bacteria 183026
243 Ga0500618_006621 3300053125 Bacteria 3383
244 Ga0500618_013135 3300053125 Bacteria 2150
245 Ga0500622_0003288 3300053156 Bacteria 10948
246 Ga0500624_000397 3300053157 Bacteria 13683
247 Ga0501082_0174167 3300060353 Bacteria 1871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026023 Ga0207677_10035698 Ga0207677_100356982 421
2 3300031251 Ga0265327_10003266 Ga0265327_100032669 449
3 3300005618 Ga0068864_100022447 Ga0068864_1000224472 453
4 3300037312 Ga0395899_0008447 Ga0395899_0008447_3774_5258 461
5 3300046684 Ga0495669_0010720 Ga0495669_0010720_2375_3835 461
6 3300046665 Ga0495661_0000997 Ga0495661_0000997_24060_25469 463
7 3300004799 Ga0058863_10033782 Ga0058863_100337823 469
8 3300005336 Ga0070680_100012362 Ga0070680_1000123623 469
9 3300005458 Ga0070681_10021111 Ga0070681_100211113 469
10 3300005530 Ga0070679_100020816 Ga0070679_1000208165 469
11 3300025917 Ga0207660_10007183 Ga0207660_100071834 469
12 3300017792 Ga0163161_10000085 Ga0163161_1000008529 471
13 3300009545 Ga0105237_10007588 Ga0105237_100075889 474
14 3300010375 Ga0105239_10003513 Ga0105239_1000351311 474
15 3300031239 Ga0265328_10011315 Ga0265328_100113152 475
16 3300031250 Ga0265331_10010285 Ga0265331_100102854 475
17 3300009147 Ga0114129_10005489 Ga0114129_1000548911 478
18 3300050507 nmdc:mga05p37_97879_c1 nmdc:mga05p37_97879_c1_1922_3427 478
19 iso_pu_bacteria 2738541283 2738756991 481
20 iso_pu_bacteria 2852623160 2852624078 481
21 iso_pu_bacteria 2884933994 2884937000 481
22 3300013102 Ga0157371_10010644 Ga0157371_100106442 482
23 3300031548 Ga0307408_100000375 Ga0307408_10000037532 482
24 3300005548 Ga0070665_100061582 Ga0070665_1000615822 483
25 3300060353 Ga0501082_0174167 Ga0501082_0174167_245_1777 483
26 3300005331 Ga0070670_100073920 Ga0070670_1000739202 484
27 3300005617 Ga0068859_100013874 Ga0068859_1000138743 484
28 3300006931 Ga0097620_100013874 Ga0097620_1000138743 484
29 3300009176 Ga0105242_10039982 Ga0105242_100399823 484
30 3300025938 Ga0207704_10137128 Ga0207704_101371282 484
31 3300025942 Ga0207689_10037315 Ga0207689_100373152 484
32 iso_pu_bacteria 2599185184 2599478579 484
33 iso_pu_bacteria 2738543023 2739302427 484
34 iso_pu_bacteria 2902048731 2902050300 484
35 iso_pu_bacteria 2919437846 2919442289 484
36 iso_pu_bacteria 2928078545 2928080365 484
37 iso_pu_bacteria 2928147474 2928149462 484
38 iso_pu_bacteria 2932082852 2932083289 484
39 3300009545 Ga0105237_10004250 Ga0105237_1000425010 485
40 3300013104 Ga0157370_10000562 Ga0157370_1000056218 485
41 3300013296 Ga0157374_10174858 Ga0157374_101748582 485
42 3300014497 Ga0182008_10000272 Ga0182008_1000027226 485
43 3300015261 Ga0182006_1000903 Ga0182006_100090317 485
44 3300017792 Ga0163161_10000249 Ga0163161_1000024913 485
45 3300048925 Ga0496122_0000404 Ga0496122_0000404_56136_57614 485
46 3300048928 Ga0496125_0137112 Ga0496125_0137112_15_1493 485
47 iso_pu_bacteria 2738541284 2738760317 485
48 iso_pu_bacteria 2775506987 2776612376 485
49 3300002737 JGI25162J39368_1000427 JGI25162J39368_10004278 486
50 3300003214 JGI25165J46597_1000548 JGI25165J46597_100054811 486
51 3300005563 Ga0068855_100000070 Ga0068855_10000007027 486
52 3300005563 Ga0068855_100000621 Ga0068855_10000062113 486
53 3300009093 Ga0105240_10280480 Ga0105240_102804801 486
54 3300010375 Ga0105239_10000002 Ga0105239_1000000283 486
55 3300013100 Ga0157373_10003550 Ga0157373_100035505 486
56 3300013102 Ga0157371_10000141 Ga0157371_1000014116 486
57 3300013104 Ga0157370_10065664 Ga0157370_100656642 486
58 3300013307 Ga0157372_10000061 Ga0157372_10000061104 486
59 3300025231 Ga0207427_100090 Ga0207427_100090103 486
60 3300025233 Ga0209437_100034 Ga0209437_100034312 486
61 3300025250 Ga0209026_1001588 Ga0209026_10015887 486
62 3300025261 Ga0209233_1000038 Ga0209233_1000038312 486
63 3300025261 Ga0209233_1001253 Ga0209233_10012535 486
64 3300025904 Ga0207647_10000263 Ga0207647_100002635 486
65 3300025949 Ga0207667_10000009 Ga0207667_10000009483 486
66 3300025949 Ga0207667_10001434 Ga0207667_1000143414 486
67 3300031911 Ga0307412_10033898 Ga0307412_100338985 486
68 3300044712 Ga0453684_0001969 Ga0453684_0001969_21061_22563 486
69 3300045051 Ga0451576_0023876 Ga0451576_0023876_3988_5490 486
70 3300047472 Ga0495686_0005143 Ga0495686_0005143_520_1998 486
71 3300053080 Ga0500635_0002508 Ga0500635_0002508_404_1882 486
72 iso_pu_bacteria 2839989709 2839991564 486
73 3300003781 Ga0055536_1000001 Ga0055536_1000001546 487
74 3300005842 Ga0068858_100138977 Ga0068858_1001389771 487
75 3300006195 Ga0075366_10002387 Ga0075366_100023876 487
76 3300009545 Ga0105237_10007444 Ga0105237_100074449 487
77 3300013102 Ga0157371_10000180 Ga0157371_1000018048 487
78 3300013104 Ga0157370_10002039 Ga0157370_100020395 487
79 3300013104 Ga0157370_10009780 Ga0157370_100097806 487
80 3300013306 Ga0163162_10000141 Ga0163162_1000014141 487
81 3300014326 Ga0157380_10000133 Ga0157380_100001337 487
82 3300014497 Ga0182008_10000815 Ga0182008_100008153 487
83 3300015261 Ga0182006_1002748 Ga0182006_10027487 487
84 3300015682 Ga0183373_1001 Ga0183373_1001418 487
85 3300017792 Ga0163161_10000425 Ga0163161_1000042532 487
86 3300025292 Ga0209676_1000008 Ga0209676_1000008317 487
87 3300025298 Ga0209050_1000055 Ga0209050_100005595 487
88 3300025914 Ga0207671_10002787 Ga0207671_100027879 487
89 3300026078 Ga0207702_10000273 Ga0207702_1000027347 487
90 3300028794 Ga0307515_10000144 Ga0307515_10000144124 487
91 3300028794 Ga0307515_10003557 Ga0307515_1000355710 487
92 3300028800 Ga0265338_10026169 Ga0265338_100261696 487
93 3300032004 Ga0307414_10091074 Ga0307414_100910741 487
94 3300033179 Ga0307507_10001815 Ga0307507_100018153 487
95 3300046507 Ga0495606_0015341 Ga0495606_0015341_1266_2747 487
96 3300046507 Ga0495606_0032448 Ga0495606_0032448_85_1566 487
97 3300046512 Ga0495610_0000152 Ga0495610_0000152_28418_29929 487
98 3300046538 Ga0495609_0004189 Ga0495609_0004189_2687_4168 487
99 3300046558 Ga0495633_0000027 Ga0495633_0000027_137723_139204 487
100 3300046616 Ga0495668_0000010 Ga0495668_0000010_24057_25538 487
101 3300046660 Ga0495625_0000381 Ga0495625_0000381_5108_6589 487
102 3300046660 Ga0495625_0000939 Ga0495625_0000939_16811_18292 487
103 3300047472 Ga0495686_0002885 Ga0495686_0002885_10560_12041 487
104 3300047472 Ga0495686_0022632 Ga0495686_0022632_478_1959 487
105 3300050493 nmdc:mga0k408_2754_c1 nmdc:mga0k408_2754_c1_3413_4894 487
106 3300053125 Ga0500618_000013 Ga0500618_000013_115708_117189 487
107 3300053156 Ga0500622_0003288 Ga0500622_0003288_3216_4700 487
108 iso_pu_bacteria 2738541302 2738852066 487
109 iso_pu_bacteria 2818991437 2819546609 487
110 iso_pu_bacteria 2857627736 2857629643 487
111 iso_pu_bacteria 2904445276 2904446755 487
112 3300001979 JGI24740J21852_10032923 JGI24740J21852_100329231 488
113 3300001990 JGI24737J22298_10008214 JGI24737J22298_100082143 488
114 3300001990 JGI24737J22298_10009247 JGI24737J22298_100092471 488
115 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002371 488
116 3300002773 JGI25152J39213_1000034 JGI25152J39213_100003426 488
117 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001232 488
118 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001568 488
119 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001457 488
120 3300003316 rootH1_10016152 rootH1_1001615217 488
121 3300003320 rootH2_10006566 rootH2_1000656659 488
122 3300003323 rootH1_10016448 rootH1_100164483 488
123 3300003323 rootH1_10175387 rootH1_101753871 488
124 3300005288 Ga0065714_10007298 Ga0065714_100072983 488
125 3300005327 Ga0070658_10069024 Ga0070658_100690242 488
126 3300005328 Ga0070676_10000294 Ga0070676_1000029419 488
127 3300005338 Ga0068868_100024791 Ga0068868_1000247911 488
128 3300005366 Ga0070659_100000394 Ga0070659_10000039426 488
129 3300005456 Ga0070678_100009572 Ga0070678_1000095723 488
130 3300005457 Ga0070662_100000030 Ga0070662_1000000303 488
131 3300005459 Ga0068867_100010298 Ga0068867_1000102985 488
132 3300005539 Ga0068853_100038937 Ga0068853_1000389374 488
133 3300005548 Ga0070665_100000083 Ga0070665_10000008398 488
134 3300005563 Ga0068855_100027968 Ga0068855_1000279685 488
135 3300005616 Ga0068852_100020767 Ga0068852_1000207675 488
136 3300006195 Ga0075366_10005842 Ga0075366_100058425 488
137 3300006237 Ga0097621_100000440 Ga0097621_10000044023 488
138 3300006358 Ga0068871_100000181 Ga0068871_10000018114 488
139 3300006881 Ga0068865_100004009 Ga0068865_1000040098 488
140 3300009093 Ga0105240_10000039 Ga0105240_1000003954 488
141 3300009093 Ga0105240_10005447 Ga0105240_1000544718 488
142 3300009093 Ga0105240_10018503 Ga0105240_1001850310 488
143 3300009093 Ga0105240_10053096 Ga0105240_100530964 488
144 3300009174 Ga0105241_10000904 Ga0105241_100009043 488
145 3300009174 Ga0105241_10001051 Ga0105241_100010519 488
146 3300009545 Ga0105237_10001449 Ga0105237_100014493 488
147 3300009545 Ga0105237_10001717 Ga0105237_1000171714 488
148 3300009545 Ga0105237_10002523 Ga0105237_1000252313 488
149 3300009545 Ga0105237_10020365 Ga0105237_100203654 488
150 3300009551 Ga0105238_10005256 Ga0105238_1000525611 488
151 3300009551 Ga0105238_10043074 Ga0105238_100430742 488
152 3300010375 Ga0105239_10000006 Ga0105239_1000000628 488
153 3300010375 Ga0105239_10001188 Ga0105239_100011883 488
154 3300010375 Ga0105239_10004552 Ga0105239_100045529 488
155 3300013100 Ga0157373_10000050 Ga0157373_1000005020 488
156 3300013102 Ga0157371_10013511 Ga0157371_100135116 488
157 3300013102 Ga0157371_10133370 Ga0157371_101333701 488
158 3300013105 Ga0157369_10000940 Ga0157369_100009406 488
159 3300013105 Ga0157369_10200452 Ga0157369_102004522 488
160 3300013296 Ga0157374_10001891 Ga0157374_1000189118 488
161 3300013296 Ga0157374_10004070 Ga0157374_1000407012 488
162 3300013296 Ga0157374_10010379 Ga0157374_100103798 488
163 3300013306 Ga0163162_10000068 Ga0163162_1000006898 488
164 3300013306 Ga0163162_10003298 Ga0163162_1000329810 488
165 3300013307 Ga0157372_10005116 Ga0157372_1000511611 488
166 3300013307 Ga0157372_10061196 Ga0157372_100611962 488
167 3300013307 Ga0157372_10077266 Ga0157372_100772661 488
168 3300013308 Ga0157375_10003378 Ga0157375_1000337812 488
169 3300014497 Ga0182008_10003116 Ga0182008_1000311610 488
170 3300015262 Ga0182007_10001756 Ga0182007_100017562 488
171 3300015262 Ga0182007_10007664 Ga0182007_100076644 488
172 3300025245 Ga0207425_1000002 Ga0207425_1000002933 488
173 3300025250 Ga0209026_1000383 Ga0209026_100038339 488
174 3300025258 Ga0209129_1000002 Ga0209129_1000002933 488
175 3300025272 Ga0209455_1010745 Ga0209455_10107452 488
176 3300025294 Ga0209025_1000004 Ga0209025_1000004257 488
177 3300025297 Ga0209758_1000006 Ga0209758_1000006257 488
178 3300025904 Ga0207647_10000448 Ga0207647_1000044834 488
179 3300025907 Ga0207645_10000224 Ga0207645_1000022439 488
180 3300025909 Ga0207705_10051283 Ga0207705_100512832 488
181 3300025911 Ga0207654_10010504 Ga0207654_100105042 488
182 3300025913 Ga0207695_10000058 Ga0207695_10000058152 488
183 3300025913 Ga0207695_10003717 Ga0207695_100037173 488
184 3300025913 Ga0207695_10026002 Ga0207695_100260029 488
185 3300025913 Ga0207695_10104074 Ga0207695_101040742 488
186 3300025913 Ga0207695_10146133 Ga0207695_101461333 488
187 3300025914 Ga0207671_10003920 Ga0207671_100039206 488
188 3300025914 Ga0207671_10004830 Ga0207671_100048303 488
189 3300025914 Ga0207671_10006902 Ga0207671_100069021 488
190 3300025914 Ga0207671_10016123 Ga0207671_100161236 488
191 3300025924 Ga0207694_10013977 Ga0207694_100139776 488
192 3300025932 Ga0207690_10004764 Ga0207690_100047646 488
193 3300025933 Ga0207706_10000129 Ga0207706_1000012986 488
194 3300025938 Ga0207704_10000037 Ga0207704_1000003782 488
195 3300025949 Ga0207667_10133134 Ga0207667_101331342 488
196 3300026023 Ga0207677_10005616 Ga0207677_100056162 488
197 3300026041 Ga0207639_10051821 Ga0207639_100518211 488
198 3300026089 Ga0207648_10000241 Ga0207648_1000024134 488
199 3300026121 Ga0207683_10004019 Ga0207683_100040195 488
200 3300026142 Ga0207698_10001086 Ga0207698_1000108617 488
201 3300028379 Ga0268266_10000095 Ga0268266_10000095102 488
202 3300028786 Ga0307517_10000719 Ga0307517_1000071932 488
203 3300031507 Ga0307509_10038677 Ga0307509_100386775 488
204 3300031731 Ga0307405_10082132 Ga0307405_100821322 488
205 3300033180 Ga0307510_10003007 Ga0307510_100030076 488
206 3300037312 Ga0395899_0000001 Ga0395899_0000001_1651365_1652849 488
207 3300037312 Ga0395899_0000382 Ga0395899_0000382_16552_18036 488
208 3300044693 Ga0466961_0019589 Ga0466961_0019589_968_2452 488
209 3300045049 Ga0466959_0009786 Ga0466959_0009786_4510_5994 488
210 3300045836 Ga0466958_0018363 Ga0466958_0018363_421_1905 488
211 3300046471 Ga0495650_0000003 Ga0495650_0000003_802799_804283 488
212 3300046492 Ga0495585_0000393 Ga0495585_0000393_33023_34507 488
213 3300046506 Ga0495583_0023465 Ga0495583_0023465_1515_2999 488
214 3300046507 Ga0495606_0000116 Ga0495606_0000116_47276_48760 488
215 3300046507 Ga0495606_0008672 Ga0495606_0008672_2268_3752 488
216 3300046512 Ga0495610_0005913 Ga0495610_0005913_6100_7584 488
217 3300046513 Ga0495616_0001938 Ga0495616_0001938_2527_4011 488
218 3300046513 Ga0495616_0009184 Ga0495616_0009184_3643_5127 488
219 3300046558 Ga0495633_0005012 Ga0495633_0005012_1833_3317 488
220 3300046660 Ga0495625_0000219 Ga0495625_0000219_38422_39906 488
221 3300046660 Ga0495625_0040248 Ga0495625_0040248_1577_3061 488
222 3300046665 Ga0495661_0001592 Ga0495661_0001592_9848_11332 488
223 3300046665 Ga0495661_0044006 Ga0495661_0044006_922_2406 488
224 3300046694 Ga0495649_0000037 Ga0495649_0000037_38222_39706 488
225 3300047443 Ga0495687_002275 Ga0495687_002275_4371_5855 488
226 3300049663 Ga0501223_000806 Ga0501223_000806_3081_4580 488
227 3300050493 nmdc:mga0k408_1566_c1 nmdc:mga0k408_1566_c1_1443_2927 488
228 3300050493 nmdc:mga0k408_2175_c1 nmdc:mga0k408_2175_c1_6284_7768 488
229 3300053122 Ga0500608_001259 Ga0500608_001259_3124_4608 488
230 3300053125 Ga0500618_006621 Ga0500618_006621_1638_3122 488
231 3300053157 Ga0500624_000397 Ga0500624_000397_3245_4729 488
232 iso_pu_bacteria 2739367656 2739616827 488
233 iso_pu_bacteria 2739367663 2739647182 488
234 2162886007 SwRhRL2b_contig_3406360 SwRhRL2b_0590.00003520 489
235 3300003781 Ga0055536_1006417 Ga0055536_10064173 489
236 3300005262 Ga0065165_1000226 Ga0065165_100022671 489
237 3300005288 Ga0065714_10002322 Ga0065714_1000232221 489
238 3300005288 Ga0065714_10005038 Ga0065714_1000503811 489
239 3300005289 Ga0065704_10000210 Ga0065704_1000021087 489
240 3300005327 Ga0070658_10000079 Ga0070658_100000793 489
241 3300005563 Ga0068855_100014938 Ga0068855_1000149385 489
242 3300005614 Ga0068856_100021574 Ga0068856_1000215743 489
243 3300013100 Ga0157373_10000276 Ga0157373_100002767 489
244 3300013102 Ga0157371_10000803 Ga0157371_1000080327 489
245 3300013102 Ga0157371_10002864 Ga0157371_100028646 489
246 3300013102 Ga0157371_10009325 Ga0157371_100093255 489
247 3300013104 Ga0157370_10004266 Ga0157370_100042669 489
248 3300013104 Ga0157370_10071192 Ga0157370_100711923 489
249 3300013297 Ga0157378_10057814 Ga0157378_100578143 489
250 3300014497 Ga0182008_10000006 Ga0182008_10000006243 489
251 3300015262 Ga0182007_10005603 Ga0182007_100056035 489
252 3300025292 Ga0209676_1002773 Ga0209676_10027738 489
253 3300025909 Ga0207705_10000112 Ga0207705_100001123 489
254 3300031731 Ga0307405_10032632 Ga0307405_100326322 489
255 3300031911 Ga0307412_10000055 Ga0307412_1000005563 489
256 3300032004 Ga0307414_10002170 Ga0307414_100021702 489
257 3300032004 Ga0307414_10002283 Ga0307414_100022832 489
258 3300032004 Ga0307414_10010958 Ga0307414_100109585 489
259 3300032004 Ga0307414_10154533 Ga0307414_101545332 489
260 3300035115 Ga0373941_0016411 Ga0373941_0016411_427_1914 489
261 3300037418 Ga0395900_0000362 Ga0395900_0000362_9475_10962 489
262 3300037418 Ga0395900_0014591 Ga0395900_0014591_401_1888 489
263 3300037471 Ga0395905_0001575 Ga0395905_0001575_22057_23544 489
264 3300048918 Ga0496115_0070275 Ga0496115_0070275_887_2383 489
265 3300053093 Ga0500651_0003271 Ga0500651_0003271_4959_6443 489
266 3300053125 Ga0500618_013135 Ga0500618_013135_550_2061 489

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

35

144

0.99

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

370

477

0.99

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

149

358

0.98

PF02222

ATP-grasp

ATP-grasp domain

160

328

0.88

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

159

327

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mlk-assembly1.cif.gz_B biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9558 2 439
7kbl-assembly1.cif.gz_A biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to bicarbonate 0.9478 2 438
3jzf-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with benzimidazoles series 0.9475 1 437
3g8d-assembly1.cif.gz_A crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli 0.9432 1 439
5mlk-assembly1.cif.gz_A biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9412 1 440
ID Description Score Start End Superfamily
af_A0A2R8PV58_229_474_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9735 197 439 3.30.470.20
3u9tA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.962 84 444 3.30.470.20
2vpqA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9608 86 437 3.30.470.20
5mlkB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9599 196 439 3.30.470.20
af_A0A2R8PV58_229_474_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.958 197 439 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A4P5V8G0-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 0.9813 324 438 GO:0005524
GO:0016874
AF-A0A5C8MNT5-F1-model_v4 Biotin carboxylase 0.9804 330 440 GO:0005524
GO:0016874
AF-A0A6V8D708-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 0.977 342 438 GO:0003989
GO:0005524
AF-A0A6B3HZR7-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 0.9765 330 425 GO:0005524
GO:0016874
AF-A0A4Q5QFU1-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 0.976 315 438 GO:0003989
GO:0005524

Feature Viewer

pLDDT pTM Quality
86.27 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map