F373799

General Info

Members Datasets Scaffolds Average Seq Length
266 168 266 167

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10019666|Ga0070658_100196662
Length 171
Sequence VSSVRVARDDDWPAIREVHRAAFGGGRRTGDVVVSLVDELRADPALYVPDLSFVSMSGNVVAGHVMNTWNLVGDVPVLQLSPLGVLPEHQGQGHGTALARASVDAVRERGEPALIVEGNPAYYGRFGFVRADELGLLPPPEALYDSAVQVVVFDEARLPRGQVQYSAPFRR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 2.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.26
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10284112 3300003320 Bacteria 1470
2 Ga0070658_10019666 3300005327 Bacteria 5407
3 Ga0070658_10515124 3300005327 Bacteria 1034
4 Ga0070683_100490227 3300005329 Bacteria 1174
5 Ga0070680_100090804 3300005336 Bacteria 2528
6 Ga0070680_100172148 3300005336 Bacteria 1822
7 Ga0070680_101382317 3300005336 Bacteria 609
8 Ga0070682_100026315 3300005337 Bacteria 3480
9 Ga0070660_100005908 3300005339 Bacteria 8465
10 Ga0070660_100010570 3300005339 Bacteria 6523
11 Ga0070660_100226146 3300005339 Bacteria 1522
12 Ga0070660_100977131 3300005339 Bacteria 715
13 Ga0070691_10858435 3300005341 Unclassified 557
14 Ga0070661_100069377 3300005344 Bacteria 2591
15 Ga0070674_100517287 3300005356 Bacteria 996
16 Ga0070659_100079843 3300005366 Unclassified 2612
17 Ga0070714_100069248 3300005435 Bacteria 3046
18 Ga0070714_100195864 3300005435 Bacteria 1846
19 Ga0070681_10122188 3300005458 Bacteria 2537
20 Ga0070681_10214158 3300005458 Bacteria 1843
21 Ga0070681_10217372 3300005458 Bacteria 1827
22 Ga0068867_100338346 3300005459 Bacteria 1252
23 Ga0070698_100443923 3300005471 Bacteria 1233
24 Ga0070679_100048029 3300005530 Bacteria 4254
25 Ga0070679_100071141 3300005530 Bacteria 3469
26 Ga0070684_100022728 3300005535 Bacteria 5235
27 Ga0070684_100085476 3300005535 Bacteria 2797
28 Ga0070684_100240851 3300005535 Unclassified 1653
29 Ga0070684_100711521 3300005535 Bacteria 937
30 Ga0068853_100310782 3300005539 Bacteria 1459
31 Ga0070686_100279190 3300005544 Bacteria 1231
32 Ga0070693_100319809 3300005547 Unclassified 1052
33 Ga0068856_100226097 3300005614 Bacteria 1887
34 Ga0070702_100090524 3300005615 Bacteria 1855
35 Ga0068863_101210748 3300005841 Bacteria 761
36 Ga0070717_11030892 3300006028 Bacteria 749
37 Ga0075434_100032113 3300006871 Bacteria 5176
38 Ga0075435_100466238 3300007076 Bacteria 1090
39 Ga0105240_10016335 3300009093 Bacteria 10053
40 Ga0105240_10937845 3300009093 Bacteria 929
41 Ga0111539_10164799 3300009094 Bacteria 2592
42 Ga0105245_10545701 3300009098 Unclassified 1181
43 Ga0157373_10168869 3300013100 Bacteria 1539
44 Ga0157370_10215167 3300013104 Bacteria 1780
45 Ga0157369_10067444 3300013105 Bacteria 3846
46 Ga0157369_10390567 3300013105 Bacteria 1444
47 Ga0157369_10553947 3300013105 Bacteria 1188
48 Ga0157374_11035603 3300013296 Bacteria 840
49 Ga0163162_10743620 3300013306 Bacteria 1100
50 Ga0157372_10316753 3300013307 Bacteria 1816
51 Ga0157372_10358446 3300013307 Bacteria 1699
52 Ga0157372_10478267 3300013307 Bacteria 1452
53 Ga0157372_10739747 3300013307 Bacteria 1144
54 Ga0157372_10799169 3300013307 Bacteria 1096
55 Ga0157375_10244853 3300013308 Bacteria 1953
56 Ga0157377_10672399 3300014745 Bacteria 748
57 Ga0157376_10007904 3300014969 Bacteria 7630
58 Ga0197907_10951149 3300020069 Unclassified 727
59 Ga0206356_10211683 3300020070 Bacteria 1729
60 Ga0206356_11141355 3300020070 Bacteria 599
61 Ga0206354_11320685 3300020081 Unclassified 1314
62 Ga0206353_10139796 3300020082 Unclassified 1513
63 Ga0224712_10257040 3300022467 Unclassified 808
64 Ga0207699_10561704 3300025906 Bacteria 828
65 Ga0207705_10021243 3300025909 Bacteria 4630
66 Ga0207705_10499743 3300025909 Bacteria 944
67 Ga0207707_10010390 3300025912 Bacteria 8078
68 Ga0207693_10121790 3300025915 Bacteria 2049
69 Ga0207660_10009325 3300025917 Bacteria 6354
70 Ga0207660_10277951 3300025917 Bacteria 1328
71 Ga0207660_10676481 3300025917 Unclassified 842
72 Ga0207657_10015884 3300025919 Bacteria 7274
73 Ga0207657_10017303 3300025919 Bacteria 6917
74 Ga0207657_10026746 3300025919 Bacteria 5295
75 Ga0207649_10038851 3300025920 Bacteria 2884
76 Ga0207652_10025802 3300025921 Bacteria 4890
77 Ga0207652_10114928 3300025921 Bacteria 2390
78 Ga0207652_10935977 3300025921 Unclassified 764
79 Ga0207664_10030012 3300025929 Bacteria 4148
80 Ga0207664_10046112 3300025929 Bacteria 3420
81 Ga0207664_10064998 3300025929 Bacteria 2920
82 Ga0207690_10295143 3300025932 Bacteria 1266
83 Ga0207669_10381691 3300025937 Bacteria 1098
84 Ga0207704_11066300 3300025938 Unclassified 686
85 Ga0207661_10283266 3300025944 Unclassified 1482
86 Ga0207661_10297278 3300025944 Bacteria 1447
87 Ga0207661_10492040 3300025944 Bacteria 1120
88 Ga0207667_10512604 3300025949 Bacteria 1216
89 Ga0207677_10201049 3300026023 Unclassified 1584
90 Ga0207639_10448352 3300026041 Bacteria 1171
91 Ga0207639_10684231 3300026041 Bacteria 951
92 Ga0207678_10319111 3300026067 Unclassified 1336
93 Ga0207702_10042590 3300026078 Bacteria 3809
94 Ga0207702_11212115 3300026078 Bacteria 749
95 Ga0265337_1111042 3300028556 Unclassified 744
96 Ga0265338_10006871 3300028800 Bacteria 14326
97 Ga0265338_10060226 3300028800 Bacteria 3338
98 Ga0265325_10026439 3300031241 Bacteria 3143
99 Ga0265339_10003596 3300031249 Bacteria 10824
100 Ga0265331_10073695 3300031250 Bacteria 1594
101 Ga0265327_10096963 3300031251 Bacteria 1429
102 Ga0265316_10152123 3300031344 Bacteria 1733
103 Ga0265313_10140892 3300031595 Bacteria 1037
104 Ga0265314_10025749 3300031711 Bacteria 4431
105 Ga0265342_10068331 3300031712 Bacteria 2077
106 Ga0307405_10093757 3300031731 Unclassified 1995
107 Ga0307413_10210058 3300031824 Unclassified 1413
108 Ga0307407_10030887 3300031903 Bacteria 2895
109 Ga0307409_100877254 3300031995 Bacteria 909
110 Ga0307411_10406003 3300032005 Unclassified 1127
111 Ga0307415_100270592 3300032126 Unclassified 1391
112 Ga0373937_0113513 3300036401 Bacteria 2521
113 Ga0373937_1225597 3300036401 Bacteria 699
114 Ga0395899_0183163 3300037312 Bacteria 1469
115 Ga0395900_0216930 3300037418 Bacteria 1930
116 Ga0395898_0019754 3300037466 Bacteria 6851
117 Ga0395898_0020407 3300037466 Bacteria 6729
118 Ga0395898_0081564 3300037466 Bacteria 3118
119 Ga0395898_0104877 3300037466 Bacteria 2711
120 Ga0395898_0147273 3300037466 Bacteria 2254
121 Ga0395898_0555789 3300037466 Bacteria 1090
122 Ga0395898_1108390 3300037466 Bacteria 725
123 Ga0395905_0006795 3300037471 Bacteria 11463
124 Ga0395905_0243985 3300037471 Bacteria 1678
125 Ga0395901_0026769 3300038443 Bacteria 5921
126 Ga0395901_0073306 3300038443 Bacteria 3570
127 Ga0395901_0558552 3300038443 Bacteria 1159
128 Ga0451807_1712332 3300041486 Bacteria 707
129 Ga0466969_0000591 3300044656 Bacteria 19709
130 Ga0466965_0083005 3300044683 Bacteria 1622
131 Ga0466966_0003367 3300044684 Bacteria 10543
132 Ga0466961_0025254 3300044693 Bacteria 3821
133 Ga0466961_0163523 3300044693 Bacteria 1387
134 Ga0466961_0370256 3300044693 Unclassified 871
135 Ga0466963_0004430 3300044694 Bacteria 8161
136 Ga0466963_0014974 3300044694 Bacteria 4792
137 Ga0466963_0153572 3300044694 Bacteria 1599
138 Ga0466963_0324834 3300044694 Bacteria 1083
139 Ga0466963_0395554 3300044694 Bacteria 974
140 Ga0466964_0007254 3300044706 Bacteria 4144
141 Ga0466964_0010339 3300044706 Bacteria 3520
142 Ga0466964_0036150 3300044706 Bacteria 1979
143 Ga0466964_0123198 3300044706 Bacteria 1171
144 Ga0453684_1076894 3300044712 Unclassified 851
145 Ga0466971_0348466 3300044719 Bacteria 716
146 Ga0466968_0002250 3300044735 Bacteria 7058
147 Ga0466968_0045118 3300044735 Bacteria 1869
148 Ga0466968_0092229 3300044735 Bacteria 1344
149 Ga0466970_0281959 3300044765 Bacteria 934
150 Ga0466957_0025759 3300044842 Bacteria 3487
151 Ga0466957_0320355 3300044842 Bacteria 1046
152 Ga0466959_0006164 3300045049 Bacteria 8285
153 Ga0466959_0017899 3300045049 Bacteria 5197
154 Ga0466959_0381704 3300045049 Bacteria 959
155 Ga0466958_0007053 3300045836 Bacteria 6149
156 Ga0466958_0105024 3300045836 Bacteria 1760
157 Ga0466958_0268665 3300045836 Bacteria 1092
158 Ga0466958_0578129 3300045836 Bacteria 730
159 Ga0466967_0001067 3300045976 Bacteria 15133
160 Ga0466967_0009233 3300045976 Bacteria 7300
161 Ga0466967_0025980 3300045976 Bacteria 4840
162 Ga0466967_0062189 3300045976 Bacteria 3314
163 Ga0466967_0078496 3300045976 Bacteria 2974
164 Ga0466967_0165630 3300045976 Bacteria 2077
165 Ga0466967_0226729 3300045976 Bacteria 1778
166 Ga0466967_0875848 3300045976 Bacteria 893
167 Ga0466967_1190418 3300045976 Bacteria 759
168 Ga0466967_1201638 3300045976 Unclassified 755
169 Ga0495617_034581 3300046452 Bacteria 1697
170 Ga0495592_0090579 3300046454 Bacteria 2194
171 Ga0495603_0048335 3300046455 Bacteria 2533
172 Ga0495629_0418179 3300046459 Bacteria 910
173 Ga0495651_0048918 3300046462 Bacteria 3264
174 Ga0495651_0054711 3300046462 Bacteria 3068
175 Ga0495651_0440761 3300046462 Bacteria 843
176 Ga0495653_0041496 3300046463 Bacteria 3591
177 Ga0495582_0088292 3300046473 Bacteria 1727
178 Ga0495662_0173714 3300046476 Bacteria 1062
179 Ga0495664_0267349 3300046477 Bacteria 1033
180 Ga0495664_0270671 3300046477 Bacteria 1026
181 Ga0495664_0325058 3300046477 Unclassified 927
182 Ga0495584_0037835 3300046491 Bacteria 2439
183 Ga0495594_0413047 3300046499 Bacteria 768
184 Ga0495596_0029428 3300046500 Bacteria 2202
185 Ga0495607_0044620 3300046501 Bacteria 2613
186 Ga0495608_0064399 3300046511 Bacteria 2403
187 Ga0495618_0069559 3300046514 Bacteria 2238
188 Ga0495630_0286734 3300046517 Bacteria 1258
189 Ga0495630_0695259 3300046517 Unclassified 778
190 Ga0495630_0920894 3300046517 Unclassified 665
191 Ga0495631_0124211 3300046518 Unclassified 1110
192 Ga0495644_0015615 3300046523 Bacteria 2910
193 Ga0495666_0365250 3300046526 Bacteria 650
194 Ga0495642_0127529 3300046528 Bacteria 1094
195 Ga0495652_0011063 3300046529 Bacteria 8176
196 Ga0495652_0132663 3300046529 Bacteria 1969
197 Ga0495652_0228543 3300046529 Bacteria 1393
198 Ga0495652_0416569 3300046529 Bacteria 947
199 Ga0495586_0378027 3300046535 Bacteria 814
200 Ga0495587_0031796 3300046536 Bacteria 3193
201 Ga0495587_0314961 3300046536 Bacteria 874
202 Ga0495609_0104992 3300046538 Unclassified 1222
203 Ga0495645_0009395 3300046543 Bacteria 6836
204 Ga0495645_0017921 3300046543 Bacteria 5081
205 Ga0495667_0041147 3300046559 Bacteria 3065
206 Ga0495667_0234298 3300046559 Bacteria 1170
207 Ga0495668_0069348 3300046616 Bacteria 1939
208 Ga0495611_0177337 3300046648 Unclassified 996
209 Ga0495635_0032286 3300046663 Bacteria 3633
210 Ga0495657_0095738 3300046675 Bacteria 1897
211 Ga0495599_0001457 3300046678 Bacteria 13574
212 Ga0495599_0043804 3300046678 Bacteria 2808
213 Ga0495623_0026167 3300046679 Bacteria 3757
214 Ga0495623_0419354 3300046679 Bacteria 717
215 Ga0495646_0024904 3300046680 Bacteria 3765
216 Ga0495647_0018169 3300046681 Bacteria 2499
217 Ga0495624_0014162 3300046690 Bacteria 5421
218 Ga0495589_0022440 3300046794 Bacteria 3221
219 Ga0495600_0042214 3300046809 Bacteria 2973
220 Ga0495600_0098594 3300046809 Bacteria 1905
221 Ga0495581_0242456 3300047315 Bacteria 1054
222 Ga0495674_0263909 3300047319 Bacteria 1414
223 Ga0495674_0303300 3300047319 Bacteria 1304
224 Ga0495676_0119399 3300047321 Bacteria 1921
225 Ga0495676_0432308 3300047321 Unclassified 870
226 Ga0495680_0100846 3300047322 Bacteria 2151
227 Ga0495675_0318336 3300047444 Bacteria 921
228 Ga0495677_0027023 3300047445 Bacteria 2082
229 Ga0495679_047306 3300047446 Bacteria 1305
230 Ga0495593_0163493 3300047673 Bacteria 1123
231 Ga0495602_0034367 3300048088 Bacteria 4743
232 Ga0495602_0422381 3300048088 Bacteria 946
233 Ga0496100_0378073 3300048903 Bacteria 1075
234 Ga0496100_0428286 3300048903 Bacteria 1011
235 Ga0496101_0759497 3300048904 Bacteria 765
236 Ga0496102_0140766 3300048905 Bacteria 2262
237 Ga0496105_0550305 3300048908 Bacteria 901
238 Ga0496107_0455336 3300048910 Bacteria 950
239 Ga0496108_0056160 3300048911 Bacteria 3307
240 Ga0496109_0453287 3300048912 Bacteria 1211
241 Ga0496111_0546227 3300048914 Bacteria 851
242 Ga0496112_0013949 3300048915 Bacteria 7435
243 Ga0496112_0028178 3300048915 Bacteria 5419
244 Ga0496113_0043560 3300048916 Bacteria 3322
245 Ga0496114_0049159 3300048917 Bacteria 3509
246 Ga0501047_0591128 3300049581 Bacteria 932
247 Ga0501070_0002034 3300049586 Bacteria 17788
248 Ga0501072_0038908 3300049588 Bacteria 3733
249 Ga0501073_0521318 3300049589 Bacteria 821
250 Ga0501074_0009207 3300049590 Bacteria 7176
251 Ga0501074_0098789 3300049590 Bacteria 2089
252 Ga0501079_0383910 3300049741 Bacteria 1101
253 Ga0501079_0454911 3300049741 Bacteria 1005
254 Ga0501080_0016641 3300049742 Bacteria 6791
255 Ga0501083_0001504 3300049744 Bacteria 15925
256 nmdc:mga0rr50_387409_c1 3300050513 Bacteria 1179
257 Ga0495601_0017959 3300053077 Bacteria 4300
258 Ga0495601_0046817 3300053077 Bacteria 2722
259 Ga0495601_0077087 3300053077 Bacteria 2135
260 Ga0495601_0388580 3300053077 Bacteria 905
261 Ga0495612_0059387 3300053078 Bacteria 1581
262 Ga0495612_0103548 3300053078 Bacteria 1213
263 Ga0495595_0008597 3300053084 Bacteria 4199
264 Ga0495619_0013151 3300053085 Bacteria 5215
265 Ga0495619_0244920 3300053085 Bacteria 1242
266 Ga0466962_0365746 3300061719 Bacteria 719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_11066300 Ga0207704_110663001 128
2 3300020070 Ga0206356_11141355 Ga0206356_111413551 138
3 3300044712 Ga0453684_1076894 Ga0453684_1076894_24_449 141
4 3300037471 Ga0395905_0006795 Ga0395905_0006795_4125_4616 147
5 3300025929 Ga0207664_10030012 Ga0207664_100300122 153
6 3300005471 Ga0070698_100443923 Ga0070698_1004439232 159
7 3300044842 Ga0466957_0320355 Ga0466957_0320355_320_814 162
8 3300045836 Ga0466958_0105024 Ga0466958_0105024_1189_1683 162
9 3300005327 Ga0070658_10515124 Ga0070658_105151242 163
10 3300025909 Ga0207705_10499743 Ga0207705_104997431 163
11 3300025949 Ga0207667_10512604 Ga0207667_105126042 163
12 3300045049 Ga0466959_0381704 Ga0466959_0381704_79_576 164
13 3300005327 Ga0070658_10019666 Ga0070658_100196662 165
14 3300005329 Ga0070683_100490227 Ga0070683_1004902272 165
15 3300005336 Ga0070680_100172148 Ga0070680_1001721482 165
16 3300005339 Ga0070660_100226146 Ga0070660_1002261462 165
17 3300005339 Ga0070660_100977131 Ga0070660_1009771311 165
18 3300005344 Ga0070661_100069377 Ga0070661_1000693772 165
19 3300005458 Ga0070681_10214158 Ga0070681_102141581 165
20 3300005530 Ga0070679_100048029 Ga0070679_1000480292 165
21 3300005535 Ga0070684_100022728 Ga0070684_1000227282 165
22 3300005539 Ga0068853_100310782 Ga0068853_1003107822 165
23 3300009093 Ga0105240_10016335 Ga0105240_100163352 165
24 3300013104 Ga0157370_10215167 Ga0157370_102151672 165
25 3300013105 Ga0157369_10067444 Ga0157369_100674443 165
26 3300013105 Ga0157369_10553947 Ga0157369_105539472 165
27 3300013307 Ga0157372_10316753 Ga0157372_103167532 165
28 3300013307 Ga0157372_10478267 Ga0157372_104782672 165
29 3300020069 Ga0197907_10951149 Ga0197907_109511491 165
30 3300020070 Ga0206356_10211683 Ga0206356_102116832 165
31 3300020082 Ga0206353_10139796 Ga0206353_101397962 165
32 3300022467 Ga0224712_10257040 Ga0224712_102570402 165
33 3300025909 Ga0207705_10021243 Ga0207705_100212432 165
34 3300025917 Ga0207660_10277951 Ga0207660_102779512 165
35 3300025917 Ga0207660_10676481 Ga0207660_106764812 165
36 3300025919 Ga0207657_10017303 Ga0207657_100173038 165
37 3300025920 Ga0207649_10038851 Ga0207649_100388512 165
38 3300025921 Ga0207652_10935977 Ga0207652_109359772 165
39 3300025929 Ga0207664_10064998 Ga0207664_100649983 165
40 3300025944 Ga0207661_10297278 Ga0207661_102972782 165
41 3300025944 Ga0207661_10492040 Ga0207661_104920401 165
42 3300026041 Ga0207639_10448352 Ga0207639_104483522 165
43 3300026041 Ga0207639_10684231 Ga0207639_106842312 165
44 3300037466 Ga0395898_0020407 Ga0395898_0020407_4032_4535 165
45 3300037466 Ga0395898_0104877 Ga0395898_0104877_1350_1853 165
46 3300037466 Ga0395898_0555789 Ga0395898_0555789_499_999 165
47 3300037466 Ga0395898_1108390 Ga0395898_1108390_49_555 165
48 3300038443 Ga0395901_0558552 Ga0395901_0558552_397_906 165
49 3300044693 Ga0466961_0370256 Ga0466961_0370256_179_682 165
50 3300044694 Ga0466963_0004430 Ga0466963_0004430_3268_3774 165
51 3300044694 Ga0466963_0324834 Ga0466963_0324834_275_778 165
52 3300045976 Ga0466967_0009233 Ga0466967_0009233_262_771 165
53 3300045976 Ga0466967_0062189 Ga0466967_0062189_131_634 165
54 3300045976 Ga0466967_0875848 Ga0466967_0875848_226_741 165
55 3300045976 Ga0466967_1190418 Ga0466967_1190418_129_635 165
56 3300046463 Ga0495653_0041496 Ga0495653_0041496_1344_1841 165
57 3300046477 Ga0495664_0267349 Ga0495664_0267349_77_577 165
58 3300046517 Ga0495630_0286734 Ga0495630_0286734_637_1134 165
59 3300046526 Ga0495666_0365250 Ga0495666_0365250_115_615 165
60 3300046535 Ga0495586_0378027 Ga0495586_0378027_272_772 165
61 3300046663 Ga0495635_0032286 Ga0495635_0032286_733_1230 165
62 3300047321 Ga0495676_0432308 Ga0495676_0432308_276_776 165
63 3300047673 Ga0495593_0163493 Ga0495593_0163493_348_845 165
64 3300049581 Ga0501047_0591128 Ga0501047_0591128_221_727 165
65 3300049586 Ga0501070_0002034 Ga0501070_0002034_30_536 165
66 3300049588 Ga0501072_0038908 Ga0501072_0038908_1685_2191 165
67 3300049589 Ga0501073_0521318 Ga0501073_0521318_210_716 165
68 3300049590 Ga0501074_0009207 Ga0501074_0009207_3716_4222 165
69 3300049590 Ga0501074_0098789 Ga0501074_0098789_1008_1514 165
70 3300049741 Ga0501079_0383910 Ga0501079_0383910_103_609 165
71 3300049741 Ga0501079_0454911 Ga0501079_0454911_214_720 165
72 3300049742 Ga0501080_0016641 Ga0501080_0016641_4041_4547 165
73 3300049744 Ga0501083_0001504 Ga0501083_0001504_8901_9407 165
74 3300053078 Ga0495612_0059387 Ga0495612_0059387_810_1310 165
75 3300053085 Ga0495619_0013151 Ga0495619_0013151_219_716 165
76 3300005336 Ga0070680_100090804 Ga0070680_1000908042 166
77 3300005336 Ga0070680_101382317 Ga0070680_1013823171 166
78 3300005337 Ga0070682_100026315 Ga0070682_1000263152 166
79 3300005339 Ga0070660_100005908 Ga0070660_1000059083 166
80 3300005339 Ga0070660_100010570 Ga0070660_1000105704 166
81 3300005356 Ga0070674_100517287 Ga0070674_1005172873 166
82 3300005366 Ga0070659_100079843 Ga0070659_1000798432 166
83 3300005435 Ga0070714_100069248 Ga0070714_1000692482 166
84 3300005435 Ga0070714_100195864 Ga0070714_1001958642 166
85 3300005458 Ga0070681_10122188 Ga0070681_101221882 166
86 3300005458 Ga0070681_10217372 Ga0070681_102173722 166
87 3300005459 Ga0068867_100338346 Ga0068867_1003383462 166
88 3300005530 Ga0070679_100071141 Ga0070679_1000711413 166
89 3300005535 Ga0070684_100240851 Ga0070684_1002408512 166
90 3300005535 Ga0070684_100711521 Ga0070684_1007115211 166
91 3300005547 Ga0070693_100319809 Ga0070693_1003198091 166
92 3300006028 Ga0070717_11030892 Ga0070717_110308922 166
93 3300009093 Ga0105240_10937845 Ga0105240_109378452 166
94 3300013100 Ga0157373_10168869 Ga0157373_101688692 166
95 3300013105 Ga0157369_10390567 Ga0157369_103905672 166
96 3300013296 Ga0157374_11035603 Ga0157374_110356032 166
97 3300013307 Ga0157372_10358446 Ga0157372_103584462 166
98 3300013307 Ga0157372_10799169 Ga0157372_107991692 166
99 3300020081 Ga0206354_11320685 Ga0206354_113206852 166
100 3300025906 Ga0207699_10561704 Ga0207699_105617042 166
101 3300025912 Ga0207707_10010390 Ga0207707_100103902 166
102 3300025917 Ga0207660_10009325 Ga0207660_100093253 166
103 3300025919 Ga0207657_10015884 Ga0207657_100158845 166
104 3300025919 Ga0207657_10026746 Ga0207657_100267462 166
105 3300025921 Ga0207652_10025802 Ga0207652_100258022 166
106 3300025921 Ga0207652_10114928 Ga0207652_101149283 166
107 3300025929 Ga0207664_10046112 Ga0207664_100461122 166
108 3300025932 Ga0207690_10295143 Ga0207690_102951432 166
109 3300025937 Ga0207669_10381691 Ga0207669_103816912 166
110 3300025944 Ga0207661_10283266 Ga0207661_102832662 166
111 3300026067 Ga0207678_10319111 Ga0207678_103191112 166
112 3300026078 Ga0207702_11212115 Ga0207702_112121151 166
113 3300031731 Ga0307405_10093757 Ga0307405_100937573 166
114 3300031824 Ga0307413_10210058 Ga0307413_102100582 166
115 3300031903 Ga0307407_10030887 Ga0307407_100308873 166
116 3300031995 Ga0307409_100877254 Ga0307409_1008772542 166
117 3300032005 Ga0307411_10406003 Ga0307411_104060032 166
118 3300032126 Ga0307415_100270592 Ga0307415_1002705922 166
119 3300036401 Ga0373937_0113513 Ga0373937_0113513_1297_1800 166
120 3300037466 Ga0395898_0019754 Ga0395898_0019754_1875_2378 166
121 3300037466 Ga0395898_0147273 Ga0395898_0147273_1003_1503 166
122 3300038443 Ga0395901_0073306 Ga0395901_0073306_1908_2411 166
123 3300044684 Ga0466966_0003367 Ga0466966_0003367_7639_8145 166
124 3300044693 Ga0466961_0163523 Ga0466961_0163523_146_652 166
125 3300044694 Ga0466963_0153572 Ga0466963_0153572_709_1215 166
126 3300044694 Ga0466963_0395554 Ga0466963_0395554_402_902 166
127 3300044706 Ga0466964_0010339 Ga0466964_0010339_2914_3420 166
128 3300044706 Ga0466964_0036150 Ga0466964_0036150_228_728 166
129 3300044706 Ga0466964_0123198 Ga0466964_0123198_605_1105 166
130 3300044719 Ga0466971_0348466 Ga0466971_0348466_48_554 166
131 3300044735 Ga0466968_0045118 Ga0466968_0045118_281_781 166
132 3300044735 Ga0466968_0092229 Ga0466968_0092229_454_960 166
133 3300045049 Ga0466959_0017899 Ga0466959_0017899_3513_4019 166
134 3300045836 Ga0466958_0268665 Ga0466958_0268665_425_931 166
135 3300045836 Ga0466958_0578129 Ga0466958_0578129_55_555 166
136 3300045976 Ga0466967_0001067 Ga0466967_0001067_6592_7092 166
137 3300045976 Ga0466967_0025980 Ga0466967_0025980_694_1200 166
138 3300045976 Ga0466967_0078496 Ga0466967_0078496_886_1386 166
139 3300045976 Ga0466967_1201638 Ga0466967_1201638_88_591 166
140 3300046454 Ga0495592_0090579 Ga0495592_0090579_759_1262 166
141 3300046462 Ga0495651_0440761 Ga0495651_0440761_117_620 166
142 3300046476 Ga0495662_0173714 Ga0495662_0173714_231_734 166
143 3300046477 Ga0495664_0325058 Ga0495664_0325058_348_851 166
144 3300046514 Ga0495618_0069559 Ga0495618_0069559_1104_1607 166
145 3300046517 Ga0495630_0920894 Ga0495630_0920894_69_572 166
146 3300046529 Ga0495652_0132663 Ga0495652_0132663_905_1408 166
147 3300046529 Ga0495652_0416569 Ga0495652_0416569_415_918 166
148 3300046536 Ga0495587_0314961 Ga0495587_0314961_205_708 166
149 3300046543 Ga0495645_0009395 Ga0495645_0009395_2102_2605 166
150 3300046678 Ga0495599_0043804 Ga0495599_0043804_1807_2310 166
151 3300046679 Ga0495623_0419354 Ga0495623_0419354_167_670 166
152 3300046681 Ga0495647_0018169 Ga0495647_0018169_1375_1878 166
153 3300047444 Ga0495675_0318336 Ga0495675_0318336_158_661 166
154 3300048088 Ga0495602_0422381 Ga0495602_0422381_164_667 166
155 3300048915 Ga0496112_0013949 Ga0496112_0013949_5708_6214 166
156 3300048915 Ga0496112_0028178 Ga0496112_0028178_1087_1590 166
157 3300048916 Ga0496113_0043560 Ga0496113_0043560_2253_2756 166
158 3300053077 Ga0495601_0046817 Ga0495601_0046817_622_1125 166
159 3300053077 Ga0495601_0388580 Ga0495601_0388580_93_596 166
160 3300003320 rootH2_10284112 rootH2_102841122 168
161 3300005341 Ga0070691_10858435 Ga0070691_108584351 168
162 3300005535 Ga0070684_100085476 Ga0070684_1000854762 168
163 3300005544 Ga0070686_100279190 Ga0070686_1002791902 168
164 3300005614 Ga0068856_100226097 Ga0068856_1002260972 168
165 3300005615 Ga0070702_100090524 Ga0070702_1000905242 168
166 3300005841 Ga0068863_101210748 Ga0068863_1012107482 168
167 3300006871 Ga0075434_100032113 Ga0075434_1000321135 168
168 3300007076 Ga0075435_100466238 Ga0075435_1004662382 168
169 3300009094 Ga0111539_10164799 Ga0111539_101647992 168
170 3300009098 Ga0105245_10545701 Ga0105245_105457012 168
171 3300013306 Ga0163162_10743620 Ga0163162_107436202 168
172 3300013307 Ga0157372_10739747 Ga0157372_107397472 168
173 3300013308 Ga0157375_10244853 Ga0157375_102448532 168
174 3300014745 Ga0157377_10672399 Ga0157377_106723991 168
175 3300014969 Ga0157376_10007904 Ga0157376_100079044 168
176 3300025915 Ga0207693_10121790 Ga0207693_101217902 168
177 3300026023 Ga0207677_10201049 Ga0207677_102010492 168
178 3300026078 Ga0207702_10042590 Ga0207702_100425902 168
179 3300028556 Ga0265337_1111042 Ga0265337_11110422 168
180 3300028800 Ga0265338_10006871 Ga0265338_100068715 168
181 3300028800 Ga0265338_10060226 Ga0265338_100602262 168
182 3300031241 Ga0265325_10026439 Ga0265325_100264393 168
183 3300031249 Ga0265339_10003596 Ga0265339_1000359615 168
184 3300031250 Ga0265331_10073695 Ga0265331_100736952 168
185 3300031251 Ga0265327_10096963 Ga0265327_100969632 168
186 3300031344 Ga0265316_10152123 Ga0265316_101521232 168
187 3300031595 Ga0265313_10140892 Ga0265313_101408922 168
188 3300031711 Ga0265314_10025749 Ga0265314_100257494 168
189 3300031712 Ga0265342_10068331 Ga0265342_100683312 168
190 3300036401 Ga0373937_1225597 Ga0373937_1225597_147_653 168
191 3300037312 Ga0395899_0183163 Ga0395899_0183163_751_1257 168
192 3300037418 Ga0395900_0216930 Ga0395900_0216930_1114_1620 168
193 3300037466 Ga0395898_0081564 Ga0395898_0081564_2593_3099 168
194 3300037471 Ga0395905_0243985 Ga0395905_0243985_1147_1653 168
195 3300038443 Ga0395901_0026769 Ga0395901_0026769_4180_4686 168
196 3300041486 Ga0451807_1712332 Ga0451807_1712332_20_526 168
197 3300044656 Ga0466969_0000591 Ga0466969_0000591_4340_4849 168
198 3300044683 Ga0466965_0083005 Ga0466965_0083005_151_660 168
199 3300044693 Ga0466961_0025254 Ga0466961_0025254_2989_3498 168
200 3300044694 Ga0466963_0014974 Ga0466963_0014974_4146_4655 168
201 3300044706 Ga0466964_0007254 Ga0466964_0007254_2999_3508 168
202 3300044735 Ga0466968_0002250 Ga0466968_0002250_3150_3659 168
203 3300044765 Ga0466970_0281959 Ga0466970_0281959_190_699 168
204 3300044842 Ga0466957_0025759 Ga0466957_0025759_220_729 168
205 3300045049 Ga0466959_0006164 Ga0466959_0006164_7726_8235 168
206 3300045836 Ga0466958_0007053 Ga0466958_0007053_2398_2907 168
207 3300045976 Ga0466967_0165630 Ga0466967_0165630_1106_1615 168
208 3300045976 Ga0466967_0226729 Ga0466967_0226729_575_1084 168
209 3300046452 Ga0495617_034581 Ga0495617_034581_1000_1506 168
210 3300046455 Ga0495603_0048335 Ga0495603_0048335_1310_1816 168
211 3300046459 Ga0495629_0418179 Ga0495629_0418179_244_750 168
212 3300046462 Ga0495651_0048918 Ga0495651_0048918_512_1018 168
213 3300046462 Ga0495651_0054711 Ga0495651_0054711_1849_2355 168
214 3300046473 Ga0495582_0088292 Ga0495582_0088292_360_866 168
215 3300046477 Ga0495664_0270671 Ga0495664_0270671_107_616 168
216 3300046491 Ga0495584_0037835 Ga0495584_0037835_268_774 168
217 3300046499 Ga0495594_0413047 Ga0495594_0413047_189_695 168
218 3300046500 Ga0495596_0029428 Ga0495596_0029428_970_1476 168
219 3300046501 Ga0495607_0044620 Ga0495607_0044620_250_756 168
220 3300046511 Ga0495608_0064399 Ga0495608_0064399_196_705 168
221 3300046517 Ga0495630_0695259 Ga0495630_0695259_230_736 168
222 3300046518 Ga0495631_0124211 Ga0495631_0124211_51_557 168
223 3300046523 Ga0495644_0015615 Ga0495644_0015615_1941_2447 168
224 3300046528 Ga0495642_0127529 Ga0495642_0127529_449_955 168
225 3300046529 Ga0495652_0011063 Ga0495652_0011063_4892_5401 168
226 3300046529 Ga0495652_0228543 Ga0495652_0228543_683_1192 168
227 3300046536 Ga0495587_0031796 Ga0495587_0031796_1810_2319 168
228 3300046538 Ga0495609_0104992 Ga0495609_0104992_633_1139 168
229 3300046543 Ga0495645_0017921 Ga0495645_0017921_2764_3273 168
230 3300046559 Ga0495667_0041147 Ga0495667_0041147_1719_2225 168
231 3300046559 Ga0495667_0234298 Ga0495667_0234298_145_651 168
232 3300046616 Ga0495668_0069348 Ga0495668_0069348_1303_1809 168
233 3300046648 Ga0495611_0177337 Ga0495611_0177337_283_789 168
234 3300046675 Ga0495657_0095738 Ga0495657_0095738_600_1106 168
235 3300046678 Ga0495599_0001457 Ga0495599_0001457_1450_1959 168
236 3300046679 Ga0495623_0026167 Ga0495623_0026167_324_833 168
237 3300046680 Ga0495646_0024904 Ga0495646_0024904_2480_2986 168
238 3300046690 Ga0495624_0014162 Ga0495624_0014162_18_524 168
239 3300046794 Ga0495589_0022440 Ga0495589_0022440_1882_2388 168
240 3300046809 Ga0495600_0042214 Ga0495600_0042214_1140_1646 168
241 3300046809 Ga0495600_0098594 Ga0495600_0098594_997_1506 168
242 3300047315 Ga0495581_0242456 Ga0495581_0242456_346_852 168
243 3300047319 Ga0495674_0263909 Ga0495674_0263909_319_825 168
244 3300047319 Ga0495674_0303300 Ga0495674_0303300_541_1050 168
245 3300047321 Ga0495676_0119399 Ga0495676_0119399_100_606 168
246 3300047322 Ga0495680_0100846 Ga0495680_0100846_1439_1948 168
247 3300047445 Ga0495677_0027023 Ga0495677_0027023_448_954 168
248 3300047446 Ga0495679_047306 Ga0495679_047306_631_1137 168
249 3300048088 Ga0495602_0034367 Ga0495602_0034367_1516_2025 168
250 3300048903 Ga0496100_0378073 Ga0496100_0378073_281_787 168
251 3300048903 Ga0496100_0428286 Ga0496100_0428286_281_787 168
252 3300048904 Ga0496101_0759497 Ga0496101_0759497_155_661 168
253 3300048905 Ga0496102_0140766 Ga0496102_0140766_391_897 168
254 3300048908 Ga0496105_0550305 Ga0496105_0550305_193_699 168
255 3300048910 Ga0496107_0455336 Ga0496107_0455336_397_903 168
256 3300048911 Ga0496108_0056160 Ga0496108_0056160_1562_2068 168
257 3300048912 Ga0496109_0453287 Ga0496109_0453287_121_627 168
258 3300048914 Ga0496111_0546227 Ga0496111_0546227_202_708 168
259 3300048917 Ga0496114_0049159 Ga0496114_0049159_1965_2471 168
260 3300050513 nmdc:mga0rr50_387409_c1 nmdc:mga0rr50_387409_c1_443_949 168
261 3300053077 Ga0495601_0017959 Ga0495601_0017959_2770_3279 168
262 3300053077 Ga0495601_0077087 Ga0495601_0077087_1377_1886 168
263 3300053078 Ga0495612_0103548 Ga0495612_0103548_469_975 168
264 3300053084 Ga0495595_0008597 Ga0495595_0008597_2183_2689 168
265 3300053085 Ga0495619_0244920 Ga0495619_0244920_232_738 168
266 3300061719 Ga0466962_0365746 Ga0466962_0365746_121_630 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

3

131

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

12

128

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.917 1 168
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.9107 1 166
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.8963 1 168
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.8769 1 166
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8248 46 125
ID Description Score Start End Superfamily
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9147 1 167 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9133 2 168 3.40.630.30
4zbgA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9087 1 166 3.40.630.30
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9043 1 167 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8876 2 168 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538HME9-F1-model_v4 N-acetyltransferase 0.9651 1 167 GO:0016747
AF-A0A538CQK2-F1-model_v4 N-acetyltransferase 0.9638 1 164 GO:0016747
AF-A0A538EP60-F1-model_v4 N-acetyltransferase 0.9603 2 164 GO:0016747
AF-A0A538IFG0-F1-model_v4 N-acetyltransferase 0.9564 1 168 GO:0016747
AF-A0A1Y1Y478-F1-model_v4 Acyl-CoA N-acyltransferase 0.9515 1 168 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.09 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map