F373771

General Info

Members Datasets Scaffolds Average Seq Length
266 157 532 460

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10009124|JGI25407J50210_100091242
Length 551
Sequence MTADWGALQGAIDGDVVLPGAPDYESVRKPVMAGFEHMRPAAVVLCATPADVAATLAVARGLRLPTAIRSGGHSVAGRSSTEGVVLDVTPMRSVAVAGXVATVGAGARLGDLYDALANHGLTIPAGCGPSVGIAGLTLGGGLGILGRKHGLTCDHLLGAQVVLADGRVVDCDEHHDGELFWALRGAGGGHFGVVTSLVFRTLPAPATTVFHLVWPPAAAGAVVQAWQAYAPDAPDELDATLRLTAAGDGQRPPGVEVVGSVLDGEADAAELLGELVDRVGADPVEASRHHLPHRAAKRYLEGLGSVEDRPERSGPEQPPQPGHLYTKSEFFRRPLPGETVAALVGHLTHGLAPGQSREVDFLPWGGAYNRVPADATAFAHRGERFLVQHLVQVGADAAPAERAARDWLARSWALVHPWGSGGVYPNFPDPDLQDWARAYHGSNYDRLRRVKAAYDPGGFSASTSRFPSGEPLAKCDASHSRVTAXPLVSFRQRWXAGGWWQSETVLAVATRGLVTGNLLAGLAPIVLHHGPGCEGFSTSSAARNDLGTVGS

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
156 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
157 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 5.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10009124 3300003373 Bacteria 2508
2 JGI25407J50210_10001033 3300003373 Bacteria 6101
3 JGI25407J50210_10005006 3300003373 Bacteria 3237
4 Ga0070683_100077247 3300005329 Bacteria 3113
5 Ga0070670_100060359 3300005331 Bacteria 3256
6 Ga0068868_100226636 3300005338 Bacteria 1566
7 Ga0070660_100133928 3300005339 Bacteria 1985
8 Ga0070692_10022008 3300005345 Bacteria 3108
9 Ga0070671_100084622 3300005355 Bacteria 2652
10 Ga0070674_100102906 3300005356 Bacteria 2084
11 Ga0070667_100012806 3300005367 Bacteria 6932
12 Ga0070703_10001470 3300005406 Bacteria 7073
13 Ga0070709_10062007 3300005434 Bacteria 2382
14 Ga0070714_100000524 3300005435 Bacteria 27833
15 Ga0070713_100027307 3300005436 Bacteria 4492
16 Ga0070708_100042868 3300005445 Bacteria 3975
17 Ga0070708_100179292 3300005445 Bacteria 1979
18 Ga0070706_100000366 3300005467 Bacteria 54437
19 Ga0070706_100009707 3300005467 Bacteria 8946
20 Ga0070707_100022603 3300005468 Bacteria 5946
21 Ga0070698_100004226 3300005471 Bacteria 15785
22 Ga0070698_100010887 3300005471 Bacteria 9675
23 Ga0070698_100030647 3300005471 Bacteria 5577
24 Ga0070698_100059757 3300005471 Plasmid 3849
25 Ga0070698_100060726 3300005471 Bacteria 3814
26 Ga0070699_100094464 3300005518 Bacteria 2617
27 Ga0070697_100045331 3300005536 Bacteria 3564
28 Ga0070697_100130061 3300005536 Bacteria 2111
29 Ga0068853_100117217 3300005539 Bacteria 2372
30 Ga0070704_100015100 3300005549 Bacteria 4842
31 Ga0068855_100121270 3300005563 Bacteria 2992
32 Ga0070664_100123965 3300005564 Bacteria 2265
33 Ga0070664_100216140 3300005564 Bacteria 1714
34 Ga0070702_100007616 3300005615 Bacteria 5189
35 Ga0070702_100039161 3300005615 Bacteria 2643
36 Ga0068852_100138533 3300005616 Bacteria 2249
37 Ga0068864_100072105 3300005618 Bacteria 3009
38 Ga0068861_100053743 3300005719 Bacteria 3066
39 Ga0068861_100127606 3300005719 Bacteria 2060
40 Ga0068870_10009270 3300005840 Unclassified 4468
41 Ga0068863_100108089 3300005841 Bacteria 2647
42 Ga0068862_100151165 3300005844 Bacteria 2067
43 Ga0081455_10002686 3300005937 Bacteria 21012
44 Ga0081455_10003669 3300005937 Bacteria 17566
45 Ga0081455_10009011 3300005937 Bacteria 10301
46 Ga0081455_10011202 3300005937 Bacteria 9022
47 Ga0081455_10012415 3300005937 Bacteria 8499
48 Ga0081455_10015212 3300005937 Bacteria 7485
49 Ga0081455_10015682 3300005937 Bacteria 7347
50 Ga0081455_10020199 3300005937 Bacteria 6281
51 Ga0081455_10042456 3300005937 Bacteria 3988
52 Ga0081538_10000140 3300005981 Bacteria 74734
53 Ga0081538_10000439 3300005981 Bacteria 46752
54 Ga0081538_10000813 3300005981 Bacteria 33853
55 Ga0081538_10001804 3300005981 Bacteria 21601
56 Ga0081538_10001809 3300005981 Bacteria 21561
57 Ga0081538_10002639 3300005981 Bacteria 17316
58 Ga0081538_10003071 3300005981 Bacteria 15890
59 Ga0081538_10003751 3300005981 Bacteria 14221
60 Ga0081538_10005270 3300005981 Bacteria 11673
61 Ga0081538_10006528 3300005981 Bacteria 10250
62 Ga0081538_10010735 3300005981 Bacteria 7494
63 Ga0081538_10011393 3300005981 Bacteria 7205
64 Ga0081538_10013016 3300005981 Bacteria 6618
65 Ga0081538_10018661 3300005981 Bacteria 5195
66 Ga0081538_10025190 3300005981 Bacteria 4204
67 Ga0081538_10034954 3300005981 Bacteria 3312
68 Ga0081538_10036141 3300005981 Bacteria 3230
69 Ga0081538_10043885 3300005981 Unclassified 2799
70 Ga0081538_10043944 3300005981 Bacteria 2796
71 Ga0081540_1004041 3300005983 Bacteria 11359
72 Ga0081540_1008752 3300005983 Bacteria 7038
73 Ga0081540_1016918 3300005983 Bacteria 4538
74 Ga0081539_10002933 3300005985 Bacteria 22478
75 Ga0081539_10007947 3300005985 Bacteria 9445
76 Ga0081539_10010157 3300005985 Bacteria 7717
77 Ga0081539_10076227 3300005985 Bacteria 1778
78 Ga0070717_10007560 3300006028 Bacteria 8075
79 Ga0070717_10010560 3300006028 Bacteria 6976
80 Ga0068871_100103692 3300006358 Bacteria 2385
81 Ga0075428_100272113 3300006844 Bacteria 1822
82 Ga0075431_100016500 3300006847 Bacteria 7495
83 Ga0075431_100057901 3300006847 Bacteria 3997
84 Ga0075431_100067900 3300006847 Bacteria 3680
85 Ga0075433_10011584 3300006852 Bacteria 7103
86 Ga0075433_10022082 3300006852 Bacteria 5341
87 Ga0075434_100088791 3300006871 Bacteria 3093
88 Ga0075434_100115559 3300006871 Bacteria 2696
89 Ga0075429_100024300 3300006880 Bacteria 5257
90 Ga0075436_100028188 3300006914 Bacteria 3863
91 Ga0075435_100075523 3300007076 Bacteria 2760
92 Ga0111539_10251252 3300009094 Bacteria 2059
93 Ga0105245_10110818 3300009098 Unclassified 2552
94 Ga0114129_10008008 3300009147 Bacteria 15048
95 Ga0114129_10023353 3300009147 Bacteria 8771
96 Ga0114129_10077222 3300009147 Bacteria 4633
97 Ga0105243_10074909 3300009148 Bacteria 2746
98 Ga0105243_10236944 3300009148 Bacteria 1622
99 Ga0105242_10113070 3300009176 Bacteria 2318
100 Ga0105238_10184503 3300009551 Bacteria 2063
101 Ga0105249_10267650 3300009553 Unclassified 1701
102 Ga0105239_10121823 3300010375 Bacteria 2897
103 Ga0157371_10093226 3300013102 Bacteria 2134
104 Ga0157370_10136365 3300013104 Bacteria 2287
105 Ga0157369_10176868 3300013105 Bacteria 2246
106 Ga0157372_10251320 3300013307 Bacteria 2052
107 Ga0157375_10023900 3300013308 Bacteria 5646
108 Ga0163163_10018650 3300014325 Bacteria 6501
109 Ga0163163_10109342 3300014325 Bacteria 2792
110 Ga0163163_10215964 3300014325 Bacteria 1967
111 Ga0157380_10012348 3300014326 Bacteria 6197
112 Ga0157380_10145368 3300014326 Unclassified 2043
113 Ga0157376_10173193 3300014969 Bacteria 1967
114 Ga0213876_10049885 3300021384 Bacteria 2212
115 Ga0207688_10024948 3300025901 Bacteria 3281
116 Ga0207643_10000055 3300025908 Bacteria 73929
117 Ga0207684_10000024 3300025910 Bacteria 322180
118 Ga0207684_10002131 3300025910 Bacteria 20280
119 Ga0207684_10019791 3300025910 Bacteria 5757
120 Ga0207693_10071278 3300025915 Bacteria 2720
121 Ga0207693_10110948 3300025915 Bacteria 2151
122 Ga0207657_10066930 3300025919 Bacteria 3057
123 Ga0207646_10025785 3300025922 Bacteria 5374
124 Ga0207687_10170361 3300025927 Unclassified 1679
125 Ga0207700_10019949 3300025928 Bacteria 4540
126 Ga0207664_10000665 3300025929 Bacteria 23626
127 Ga0207690_10077461 3300025932 Bacteria 2311
128 Ga0207706_10019229 3300025933 Bacteria 6142
129 Ga0207709_10093901 3300025935 Bacteria 1968
130 Ga0207665_10008628 3300025939 Bacteria 6709
131 Ga0207691_10021665 3300025940 Bacteria 6066
132 Ga0207689_10069577 3300025942 Bacteria 2892
133 Ga0207661_10071786 3300025944 Bacteria 2831
134 Ga0207712_10039957 3300025961 Bacteria 3217
135 Ga0207712_10051781 3300025961 Bacteria 2873
136 Ga0207658_10016672 3300025986 Bacteria 5056
137 Ga0207677_10061389 3300026023 Bacteria 2603
138 Ga0207678_10008498 3300026067 Bacteria 9051
139 Ga0207678_10014694 3300026067 Bacteria 6889
140 Ga0207678_10058699 3300026067 Bacteria 3311
141 Ga0207708_10001130 3300026075 Bacteria 20072
142 Ga0207708_10111918 3300026075 Bacteria 2120
143 Ga0207641_10110568 3300026088 Bacteria 2435
144 Ga0207648_10035928 3300026089 Bacteria 4366
145 Ga0207674_10020320 3300026116 Bacteria 7176
146 Ga0207674_10074186 3300026116 Bacteria 3414
147 Ga0207675_100035468 3300026118 Bacteria 4653
148 Ga0207675_100058633 3300026118 Bacteria 3593
149 Ga0207683_10021081 3300026121 Bacteria 5577
150 Ga0207683_10035926 3300026121 Bacteria 4311
151 Ga0307516_10036933 3300031730 Bacteria 4886
152 Ga0307405_10033945 3300031731 Bacteria 3031
153 Ga0307405_10079284 3300031731 Bacteria 2140
154 Ga0307413_10016922 3300031824 Unclassified 3784
155 Ga0307410_10065554 3300031852 Unclassified 2498
156 Ga0307406_10015432 3300031901 Unclassified 4420
157 Ga0307406_10098333 3300031901 Bacteria 1987
158 Ga0307407_10011984 3300031903 Bacteria 4151
159 Ga0307407_10050095 3300031903 Bacteria 2388
160 Ga0307409_100004502 3300031995 Bacteria 7846
161 Ga0307409_100018104 3300031995 Bacteria 4720
162 Ga0307409_100045012 3300031995 Unclassified 3328
163 Ga0307416_100079535 3300032002 Bacteria 2763
164 Ga0307416_100141605 3300032002 Bacteria 2187
165 Ga0307415_100019154 3300032126 Bacteria 4150
166 Ga0307415_100024825 3300032126 Bacteria 3751
167 Ga0307415_100028264 3300032126 Bacteria 3565
168 Ga0307415_100032409 3300032126 Unclassified 3378
169 Ga0373939_0010257 3300035114 Bacteria 2338
170 Ga0395899_0010087 3300037312 Bacteria 7242
171 Ga0395899_0105987 3300037312 Bacteria 2024
172 Ga0395900_0004528 3300037418 Bacteria 14707
173 Ga0395900_0012264 3300037418 Bacteria 8764
174 Ga0395900_0023183 3300037418 Bacteria 6354
175 Ga0395900_0027072 3300037418 Bacteria 5869
176 Ga0395900_0031063 3300037418 Bacteria 5487
177 Ga0395900_0120890 3300037418 Bacteria 2687
178 Ga0395900_0162868 3300037418 Bacteria 2274
179 Ga0395898_0004690 3300037466 Bacteria 14880
180 Ga0395898_0022897 3300037466 Bacteria 6317
181 Ga0395898_0023734 3300037466 Bacteria 6192
182 Ga0395898_0037034 3300037466 Bacteria 4841
183 Ga0395898_0057520 3300037466 Bacteria 3789
184 Ga0395898_0064072 3300037466 Bacteria 3566
185 Ga0395905_0010311 3300037471 Bacteria 9093
186 Ga0395905_0027601 3300037471 Bacteria 5353
187 Ga0395905_0031498 3300037471 Bacteria 4993
188 Ga0395905_0067060 3300037471 Bacteria 3361
189 Ga0395905_0299840 3300037471 Bacteria 1494
190 Ga0436364_1280826 3300037853 Bacteria 93394
191 Ga0395901_0003044 3300038443 Bacteria 16896
192 Ga0395901_0009504 3300038443 Bacteria 9864
193 Ga0395901_0028425 3300038443 Bacteria 5750
194 Ga0395901_0031026 3300038443 Bacteria 5510
195 Ga0395901_0122135 3300038443 Bacteria 2737
196 Ga0395901_0136222 3300038443 Unclassified 2581
197 Ga0395901_0144953 3300038443 Unclassified 2496
198 Ga0395901_0238646 3300038443 Bacteria 1896
199 Ga0395901_0269271 3300038443 Bacteria 1772
200 Ga0436365_1083108 3300039437 Bacteria 1772
201 Ga0439448_0000653 3300042005 Bacteria 8222
202 Ga0439458_0006651 3300042157 Bacteria 2576
203 Ga0439440_0007318 3300042993 Bacteria 2240
204 Ga0439440_0012541 3300042993 Bacteria 1803
205 Ga0466963_0039833 3300044694 Bacteria 3078
206 Ga0466957_0024618 3300044842 Bacteria 3563
207 Ga0466959_0015471 3300045049 Bacteria 5559
208 Ga0466958_0001523 3300045836 Bacteria 11106
209 Ga0466958_0013079 3300045836 Bacteria 4717
210 Ga0466967_0066730 3300045976 Bacteria 3207
211 Ga0495584_0015376 3300046491 Bacteria 3899
212 Ga0496100_0169070 3300048903 Unclassified 1573
213 Ga0496105_0058665 3300048908 Bacteria 3176
214 Ga0496107_0090534 3300048910 Bacteria 2235
215 Ga0496108_0041144 3300048911 Bacteria 3856
216 Ga0496108_0078828 3300048911 Bacteria 2788
217 Ga0496109_0010726 3300048912 Bacteria 7842
218 Ga0496109_0085618 3300048912 Bacteria 2909
219 Ga0496111_0080591 3300048914 Bacteria 2375
220 Ga0496111_0129198 3300048914 Bacteria 1869
221 Ga0496112_0151173 3300048915 Bacteria 2289
222 Ga0496113_0012526 3300048916 Bacteria 5704
223 Ga0496114_0099291 3300048917 Bacteria 2483
224 Ga0501031_0023673 3300049568 Bacteria 4003
225 Ga0501032_0064905 3300049569 Bacteria 2443
226 Ga0501036_0000876 3300049572 Bacteria 22436
227 Ga0501037_0052140 3300049573 Bacteria 2992
228 Ga0501038_0027783 3300049574 Bacteria 5029
229 Ga0501039_0005752 3300049575 Bacteria 9385
230 Ga0501040_0000985 3300049576 Bacteria 18025
231 Ga0501041_0001739 3300049577 Bacteria 12227
232 Ga0501042_0002446 3300049578 Bacteria 11403
233 Ga0501042_0033608 3300049578 Bacteria 3636
234 Ga0501043_0033382 3300049579 Bacteria 4049
235 Ga0501046_0001704 3300049580 Bacteria 21006
236 Ga0501048_0002732 3300049582 Bacteria 13454
237 Ga0501068_0028096 3300049584 Bacteria 3324
238 Ga0501069_0097692 3300049585 Bacteria 1665
239 Ga0501072_0068486 3300049588 Bacteria 2801
240 Ga0501074_0010446 3300049590 Bacteria 6737
241 Ga0501075_0001260 3300049591 Bacteria 16386
242 Ga0501076_0000666 3300049592 Bacteria 22034
243 Ga0501079_0002047 3300049741 Bacteria 14444
244 Ga0501080_0038340 3300049742 Bacteria 4474
245 Ga0501081_0000294 3300049743 Bacteria 26695
246 Ga0501081_0013332 3300049743 Bacteria 5407
247 Ga0501035_0020706 3300049822 Bacteria 6045
248 Ga0501045_0001799 3300049824 Bacteria 14476
249 Ga0501045_0084200 3300049824 Bacteria 2346
250 nmdc:mga05p37_91971_c1 3300050507 Bacteria 3738
251 nmdc:mga06r32_167222_c1 3300050510 Unclassified 2182
252 nmdc:mga06r32_36965_c1 3300050510 Bacteria 4619
253 nmdc:mga0n895_77910_c1 3300050512 Bacteria 3298
254 nmdc:mga0rr50_30831_c1 3300050513 Bacteria 3802
255 nmdc:mga08x19_44672_c1 3300050514 Bacteria 2829
256 nmdc:mga0a205_241828_c1 3300050515 Bacteria 1686
257 nmdc:mga0a205_5038_c1 3300050515 Bacteria 11899
258 Ga0501084_0011556 3300054114 Bacteria 7310
259 Ga0501082_0003123 3300060353 Bacteria 14445
260 Ga0501082_0039792 3300060353 Bacteria 4056
261 Ga0466962_0003576 3300061719 Bacteria 7405
262 Ga0530510_0007068 3300061734 Bacteria 7815
263 Ga0530510_0019592 3300061734 Bacteria 4802
264 2676484228 2675903059 Bacteria 8644972
265 2891331422 2891326441 Bacteria 6439512
266 3003006063 3002998708 Bacteria 11715108
267 JGI25407J50210_10009124
268 JGI25407J50210_10001033
269 JGI25407J50210_10005006
270 Ga0070683_100077247
271 Ga0070670_100060359
272 Ga0068868_100226636
273 Ga0070660_100133928
274 Ga0070692_10022008
275 Ga0070671_100084622
276 Ga0070674_100102906
277 Ga0070667_100012806
278 Ga0070703_10001470
279 Ga0070709_10062007
280 Ga0070714_100000524
281 Ga0070713_100027307
282 Ga0070708_100042868
283 Ga0070708_100179292
284 Ga0070706_100000366
285 Ga0070706_100009707
286 Ga0070707_100022603
287 Ga0070698_100004226
288 Ga0070698_100010887
289 Ga0070698_100030647
290 Ga0070698_100059757
291 Ga0070698_100060726
292 Ga0070699_100094464
293 Ga0070697_100045331
294 Ga0070697_100130061
295 Ga0068853_100117217
296 Ga0070704_100015100
297 Ga0068855_100121270
298 Ga0070664_100123965
299 Ga0070664_100216140
300 Ga0070702_100007616
301 Ga0070702_100039161
302 Ga0068852_100138533
303 Ga0068864_100072105
304 Ga0068861_100053743
305 Ga0068861_100127606
306 Ga0068870_10009270
307 Ga0068863_100108089
308 Ga0068862_100151165
309 Ga0081455_10002686
310 Ga0081455_10003669
311 Ga0081455_10009011
312 Ga0081455_10011202
313 Ga0081455_10012415
314 Ga0081455_10015212
315 Ga0081455_10015682
316 Ga0081455_10020199
317 Ga0081455_10042456
318 Ga0081538_10000140
319 Ga0081538_10000439
320 Ga0081538_10000813
321 Ga0081538_10001804
322 Ga0081538_10001809
323 Ga0081538_10002639
324 Ga0081538_10003071
325 Ga0081538_10003751
326 Ga0081538_10005270
327 Ga0081538_10006528
328 Ga0081538_10010735
329 Ga0081538_10011393
330 Ga0081538_10013016
331 Ga0081538_10018661
332 Ga0081538_10025190
333 Ga0081538_10034954
334 Ga0081538_10036141
335 Ga0081538_10043885
336 Ga0081538_10043944
337 Ga0081540_1004041
338 Ga0081540_1008752
339 Ga0081540_1016918
340 Ga0081539_10002933
341 Ga0081539_10007947
342 Ga0081539_10010157
343 Ga0081539_10076227
344 Ga0070717_10007560
345 Ga0070717_10010560
346 Ga0068871_100103692
347 Ga0075428_100272113
348 Ga0075431_100016500
349 Ga0075431_100057901
350 Ga0075431_100067900
351 Ga0075433_10011584
352 Ga0075433_10022082
353 Ga0075434_100088791
354 Ga0075434_100115559
355 Ga0075429_100024300
356 Ga0075436_100028188
357 Ga0075435_100075523
358 Ga0111539_10251252
359 Ga0105245_10110818
360 Ga0114129_10008008
361 Ga0114129_10023353
362 Ga0114129_10077222
363 Ga0105243_10074909
364 Ga0105243_10236944
365 Ga0105242_10113070
366 Ga0105238_10184503
367 Ga0105249_10267650
368 Ga0105239_10121823
369 Ga0157371_10093226
370 Ga0157370_10136365
371 Ga0157369_10176868
372 Ga0157372_10251320
373 Ga0157375_10023900
374 Ga0163163_10018650
375 Ga0163163_10109342
376 Ga0163163_10215964
377 Ga0157380_10012348
378 Ga0157380_10145368
379 Ga0157376_10173193
380 Ga0213876_10049885
381 Ga0207688_10024948
382 Ga0207643_10000055
383 Ga0207684_10000024
384 Ga0207684_10002131
385 Ga0207684_10019791
386 Ga0207693_10071278
387 Ga0207693_10110948
388 Ga0207657_10066930
389 Ga0207646_10025785
390 Ga0207687_10170361
391 Ga0207700_10019949
392 Ga0207664_10000665
393 Ga0207690_10077461
394 Ga0207706_10019229
395 Ga0207709_10093901
396 Ga0207665_10008628
397 Ga0207691_10021665
398 Ga0207689_10069577
399 Ga0207661_10071786
400 Ga0207712_10039957
401 Ga0207712_10051781
402 Ga0207658_10016672
403 Ga0207677_10061389
404 Ga0207678_10008498
405 Ga0207678_10014694
406 Ga0207678_10058699
407 Ga0207708_10001130
408 Ga0207708_10111918
409 Ga0207641_10110568
410 Ga0207648_10035928
411 Ga0207674_10020320
412 Ga0207674_10074186
413 Ga0207675_100035468
414 Ga0207675_100058633
415 Ga0207683_10021081
416 Ga0207683_10035926
417 Ga0307516_10036933
418 Ga0307405_10033945
419 Ga0307405_10079284
420 Ga0307413_10016922
421 Ga0307410_10065554
422 Ga0307406_10015432
423 Ga0307406_10098333
424 Ga0307407_10011984
425 Ga0307407_10050095
426 Ga0307409_100004502
427 Ga0307409_100018104
428 Ga0307409_100045012
429 Ga0307416_100079535
430 Ga0307416_100141605
431 Ga0307415_100019154
432 Ga0307415_100024825
433 Ga0307415_100028264
434 Ga0307415_100032409
435 Ga0373939_0010257
436 Ga0395899_0010087
437 Ga0395899_0105987
438 Ga0395900_0004528
439 Ga0395900_0012264
440 Ga0395900_0023183
441 Ga0395900_0027072
442 Ga0395900_0031063
443 Ga0395900_0120890
444 Ga0395900_0162868
445 Ga0395898_0004690
446 Ga0395898_0022897
447 Ga0395898_0023734
448 Ga0395898_0037034
449 Ga0395898_0057520
450 Ga0395898_0064072
451 Ga0395905_0010311
452 Ga0395905_0027601
453 Ga0395905_0031498
454 Ga0395905_0067060
455 Ga0395905_0299840
456 Ga0436364_1280826
457 Ga0395901_0003044
458 Ga0395901_0009504
459 Ga0395901_0028425
460 Ga0395901_0031026
461 Ga0395901_0122135
462 Ga0395901_0136222
463 Ga0395901_0144953
464 Ga0395901_0238646
465 Ga0395901_0269271
466 Ga0436365_1083108
467 Ga0439448_0000653
468 Ga0439458_0006651
469 Ga0439440_0007318
470 Ga0439440_0012541
471 Ga0466963_0039833
472 Ga0466957_0024618
473 Ga0466959_0015471
474 Ga0466958_0001523
475 Ga0466958_0013079
476 Ga0466967_0066730
477 Ga0495584_0015376
478 Ga0496100_0169070
479 Ga0496105_0058665
480 Ga0496107_0090534
481 Ga0496108_0041144
482 Ga0496108_0078828
483 Ga0496109_0010726
484 Ga0496109_0085618
485 Ga0496111_0080591
486 Ga0496111_0129198
487 Ga0496112_0151173
488 Ga0496113_0012526
489 Ga0496114_0099291
490 Ga0501031_0023673
491 Ga0501032_0064905
492 Ga0501036_0000876
493 Ga0501037_0052140
494 Ga0501038_0027783
495 Ga0501039_0005752
496 Ga0501040_0000985
497 Ga0501041_0001739
498 Ga0501042_0002446
499 Ga0501042_0033608
500 Ga0501043_0033382
501 Ga0501046_0001704
502 Ga0501048_0002732
503 Ga0501068_0028096
504 Ga0501069_0097692
505 Ga0501072_0068486
506 Ga0501074_0010446
507 Ga0501075_0001260
508 Ga0501076_0000666
509 Ga0501079_0002047
510 Ga0501080_0038340
511 Ga0501081_0000294
512 Ga0501081_0013332
513 Ga0501035_0020706
514 Ga0501045_0001799
515 Ga0501045_0084200
516 nmdc:mga05p37_91971_c1
517 nmdc:mga06r32_167222_c1
518 nmdc:mga06r32_36965_c1
519 nmdc:mga0n895_77910_c1
520 nmdc:mga0rr50_30831_c1
521 nmdc:mga08x19_44672_c1
522 nmdc:mga0a205_241828_c1
523 nmdc:mga0a205_5038_c1
524 Ga0501084_0011556
525 Ga0501082_0003123
526 Ga0501082_0039792
527 Ga0466962_0003576
528 Ga0530510_0007068
529 Ga0530510_0019592
530 2676484228
531 2891331422
532 3003006063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

40

172

0.96

PF08031

BBE

Berberine and berberine like

423

460

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fyc-assembly1.cif.gz_B-2 the crystal structure of encm l144m mutant complex with dioxygen under 15 bars o2 pressure 0.9002 1 472
6fyc-assembly1.cif.gz_B-2 the crystal structure of encm l144m mutant complex with dioxygen under 15 bars o2 pressure 0.8983 1 472
6fye-assembly1.cif.gz_B-2 the crystal structure of encm h138t mutant 0.8979 2 472
6fye-assembly1.cif.gz_B-2 the crystal structure of encm h138t mutant 0.896 2 472
6fyg-assembly1.cif.gz_A the crystal structure of encm v135t mutant 0.895 1 469
ID Description Score Start End Superfamily
af_Q869M2_98_203_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.983 101 205 3.30.465.10
3w8xA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9743 95 204 3.30.465.10
2bvfB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9616 95 205 3.30.465.10
af_Q54U09_47_214_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9599 45 205 3.30.465.10
af_Q869M2_98_203_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9559 101 205 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A1V9IKC9-F1-model_v4 deleted 0.9682 14 205
AF-A0A7R9VP26-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.968 2 205 GO:0016491
GO:0071949
AF-U1GN33-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9637 45 205 GO:0016491
GO:0071949
AF-A0A7C5RT92-F1-model_v4 FAD-binding oxidoreductase 0.962 6 205 GO:0016491
GO:0071949
AF-A0A060BU92-F1-model_v4 CAZy families GT22 protein 0.9616 84 205 GO:0016491
GO:0071949

Map