F373734

General Info

Members Datasets Scaffolds Average Seq Length
266 208 240 388

Family's Representative Sequence

Representative Sequence 2010549000|RicEn_C1634|RicEn_30160
Length 428
Sequence MKSILVINSGSSSIKFALFQIQSYSIKKLYSGLIENVLVEPLLTIKDSDSGKKITELEKVDVSGNPYESAISYVLKWITGKNFRVIAVGHRIVHGGASYSSPIILRDVDLEELSKLNNICPLHQPHNVNGVRIIEELLPDVLQVGCFDTGFHKTCNPISQTFSIPKKYRDNGVKRYGFHGLSYEYISQTMPEIVPSDIVDGKWIVCHLGSGATMCAFHGLKSVATSIGFSAIGGLPMGTRADSLDPGLMIYFMKEYQMTTDEILNLIYKESGLLGVSEISSDIRDLHASDSPKAKLAVDLLAHQITNHFGMLCAELQGCDGIIFTGGIGENDSILRDLVCRNLQWLNFEIDPIANNSIFGGITGRISKENSKDIWVIPTDEELMIARHAYEIIKTSRFTSGTSMLPNFDPDPKFCAIQKKNSGINPTP

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2519899620 Rhizobium sp. Pop5 Isolate Nodule
5 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
6 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
7 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
8 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
9 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
10 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
11 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
12 2643221599 Rhizobium sp. Root708 Isolate Unclassified
13 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
14 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
15 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
16 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
17 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
18 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
19 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
20 2996887358 Rhizobium sp. R711 Isolate Nodule
21 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
22 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
23 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
198 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 8005258706 Rhizobium sp. R693 Isolate Nodule
206 8005321885 Rhizobium sp. R72 Isolate Nodule
207 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
208 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.23
Metatranscriptomes 0
Isolates 9.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.8
Nodule 3.01
Rhizoplane 9.77
Rhizosphere 54.14
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1634 2010549000 Bacteria 2783
2 JGI25158J39367_1000048 3300002739 Bacteria 27557
3 JGI25152J39213_1001860 3300002773 Bacteria 8506
4 JGI25152J39213_1002695 3300002773 Bacteria 6505
5 JGI25152J39213_1005464 3300002773 Bacteria 3696
6 JGI25159J45721_1007211 3300002987 Bacteria 3213
7 JGI25153J46596_10001325 3300003215 Bacteria 14821
8 JGI25153J46596_10004554 3300003215 Bacteria 7443
9 rootL2_10230740 3300003322 Bacteria 1186
10 rootH1_10162899 3300003323 Bacteria 1969
11 JGI25160J50197_1011707 3300003354 Bacteria 3086
12 JGI25161J50226_1000267 3300003374 Bacteria 30667
13 Ga0055526_1000929 3300003771 Bacteria 21728
14 Ga0055524_1005700 3300003775 Bacteria 5520
15 Ga0055528_1002877 3300003790 Bacteria 8958
16 Ga0055528_1006712 3300003790 Bacteria 5187
17 Ga0055540_1017430 3300003792 Bacteria 2005
18 Ga0055540_1021560 3300003792 Bacteria 1669
19 Ga0055543_1000065 3300004625 Bacteria 97333
20 Ga0070683_100000128 3300005329 Bacteria 49017
21 Ga0070670_100146109 3300005331 Bacteria 2046
22 Ga0070680_100137905 3300005336 Bacteria 2044
23 Ga0070668_100049478 3300005347 Bacteria 3234
24 Ga0070671_100008483 3300005355 Bacteria 8236
25 Ga0070671_100010572 3300005355 Bacteria 7411
26 Ga0070709_10146922 3300005434 Bacteria 1625
27 Ga0070711_100051892 3300005439 Unclassified 2820
28 Ga0070711_100070449 3300005439 Bacteria 2462
29 Ga0070694_100060621 3300005444 Bacteria 2581
30 Ga0070706_100015079 3300005467 Bacteria 7139
31 Ga0070707_100098328 3300005468 Bacteria 2834
32 Ga0070697_100047369 3300005536 Bacteria 3485
33 Ga0068855_100004965 3300005563 Bacteria 16227
34 Ga0068856_100003482 3300005614 Bacteria 15891
35 Ga0068862_100066407 3300005844 Bacteria 3108
36 Ga0081538_10053365 3300005981 Bacteria 2403
37 Ga0081539_10001822 3300005985 Bacteria 33628
38 Ga0075365_10000529 3300006038 Bacteria 14696
39 Ga0075365_10109809 3300006038 Bacteria 1895
40 Ga0070712_100008874 3300006175 Bacteria 6330
41 Ga0075367_10004242 3300006178 Bacteria 6963
42 Ga0075367_10007828 3300006178 Bacteria 5498
43 Ga0075369_10000345 3300006186 Bacteria 13816
44 Ga0097621_100045713 3300006237 Bacteria 3538
45 Ga0075370_10045742 3300006353 Bacteria 2476
46 Ga0068871_100029300 3300006358 Bacteria 4321
47 Ga0068871_100086129 3300006358 Bacteria 2610
48 Ga0075431_100017160 3300006847 Bacteria 7358
49 Ga0075429_100038887 3300006880 Bacteria 4142
50 Ga0105251_10003060 3300009011 Bacteria 12441
51 Ga0105240_10005351 3300009093 Bacteria 19146
52 Ga0111539_10093103 3300009094 Bacteria 3541
53 Ga0114129_10224809 3300009147 Bacteria 2530
54 Ga0105248_10007457 3300009177 Bacteria 12001
55 Ga0105249_10010964 3300009553 Bacteria 7965
56 Ga0105249_10167084 3300009553 Bacteria 2131
57 Ga0123342_1026717 3300009766 Bacteria 3319
58 Ga0157371_10000013 3300013102 Bacteria 352631
59 Ga0157372_10005411 3300013307 Bacteria 13569
60 Ga0163163_10107666 3300014325 Bacteria 2814
61 Ga0157377_10070345 3300014745 Unclassified 2021
62 Ga0209436_100014 3300025208 Bacteria 127004
63 Ga0207425_1001388 3300025245 Bacteria 10230
64 Ga0209129_1000790 3300025258 Bacteria 19972
65 Ga0209129_1002810 3300025258 Bacteria 8090
66 Ga0209129_1003088 3300025258 Bacteria 7503
67 Ga0209673_1002770 3300025273 Bacteria 11433
68 Ga0209673_1006816 3300025273 Bacteria 5423
69 Ga0209673_1008413 3300025273 Bacteria 4595
70 Ga0209130_1000004 3300025284 Bacteria 633436
71 Ga0209130_1006332 3300025284 Bacteria 3866
72 Ga0209130_1012135 3300025284 Bacteria 2271
73 Ga0209025_1005335 3300025294 Bacteria 10547
74 Ga0209025_1007567 3300025294 Bacteria 8057
75 Ga0209564_1001210 3300025295 Bacteria 29473
76 Ga0209564_1006088 3300025295 Bacteria 6635
77 Ga0209564_1009790 3300025295 Bacteria 4504
78 Ga0209758_1000829 3300025297 Bacteria 43270
79 Ga0209758_1001011 3300025297 Bacteria 37221
80 Ga0209758_1008641 3300025297 Bacteria 6538
81 Ga0209256_1004013 3300025299 Bacteria 9619
82 Ga0207426_1000003 3300025302 Bacteria 1063212
83 Ga0207426_1002374 3300025302 Bacteria 12184
84 Ga0207426_1008003 3300025302 Bacteria 4340
85 Ga0209051_1002227 3300025303 Bacteria 14303
86 Ga0209051_1014319 3300025303 Bacteria 3708
87 Ga0207713_1011173 3300025735 Bacteria 4908
88 Ga0207699_10132422 3300025906 Bacteria 1628
89 Ga0207684_10010553 3300025910 Bacteria 8120
90 Ga0207695_10004444 3300025913 Bacteria 19118
91 Ga0207693_10003615 3300025915 Bacteria 13202
92 Ga0207663_10100980 3300025916 Unclassified 1937
93 Ga0207660_10038680 3300025917 Bacteria 3331
94 Ga0207646_10012657 3300025922 Bacteria 8097
95 Ga0207664_10019623 3300025929 Bacteria 4999
96 Ga0207644_10066680 3300025931 Bacteria 2621
97 Ga0207711_10011986 3300025941 Bacteria 7205
98 Ga0207661_10000029 3300025944 Bacteria 172511
99 Ga0207667_10008734 3300025949 Bacteria 12010
100 Ga0207712_10001438 3300025961 Bacteria 16253
101 Ga0207668_10014061 3300025972 Bacteria 4949
102 Ga0207708_10024360 3300026075 Bacteria 4578
103 Ga0207676_10036241 3300026095 Bacteria 3751
104 Ga0207683_10010516 3300026121 Bacteria 7895
105 Ga0265332_10000006 3300031238 Bacteria 327963
106 Ga0316575_10027499 3300031665 Bacteria 2213
107 Ga0307405_10007407 3300031731 Bacteria 5485
108 Ga0373955_0070269 3300035172 Bacteria 1956
109 Ga0316574_0030259 3300035398 Bacteria 3277
110 Ga0395905_0017167 3300037471 Bacteria 6875
111 Ga0395901_0000039 3300038443 Bacteria 206143
112 Ga0439466_0012970 3300041411 Bacteria 3058
113 Ga0451577_0000276 3300042876 Bacteria 99531
114 Ga0466972_0094252 3300044658 Bacteria 1419
115 Ga0453683_0009719 3300044673 Bacteria 6411
116 Ga0466965_0021191 3300044683 Bacteria 3128
117 Ga0466966_0004256 3300044684 Bacteria 9442
118 Ga0466963_0094681 3300044694 Bacteria 2037
119 Ga0453684_0000891 3300044712 Bacteria 99637
120 Ga0451576_0002533 3300045051 Bacteria 27062
121 Ga0451576_0004399 3300045051 Bacteria 18339
122 Ga0495590_0000297 3300046457 Bacteria 26237
123 Ga0495590_0006281 3300046457 Bacteria 4652
124 Ga0495629_0005191 3300046459 Bacteria 9751
125 Ga0495653_0027608 3300046463 Bacteria 4542
126 Ga0495662_0023505 3300046476 Bacteria 2976
127 Ga0495585_0074790 3300046492 Bacteria 1843
128 Ga0495594_0024581 3300046499 Bacteria 3237
129 Ga0495596_0030746 3300046500 Bacteria 2148
130 Ga0495583_0009564 3300046506 Bacteria 5776
131 Ga0495606_0026635 3300046507 Bacteria 4118
132 Ga0495610_0092520 3300046512 Bacteria 1368
133 Ga0495616_0000980 3300046513 Bacteria 20449
134 Ga0495616_0007201 3300046513 Bacteria 6668
135 Ga0495620_0018013 3300046515 Bacteria 3506
136 Ga0495620_0037979 3300046515 Bacteria 2140
137 Ga0495630_0008311 3300046517 Bacteria 7451
138 Ga0495632_0000330 3300046519 Bacteria 45417
139 Ga0495632_0011756 3300046519 Bacteria 5095
140 Ga0495643_0009869 3300046522 Bacteria 5902
141 Ga0495648_0024591 3300046524 Bacteria 4097
142 Ga0495642_0000488 3300046528 Bacteria 20311
143 Ga0495652_0003542 3300046529 Bacteria 15341
144 Ga0495654_0002842 3300046530 Bacteria 10879
145 Ga0495597_0007013 3300046542 Bacteria 5775
146 Ga0495645_0021772 3300046543 Bacteria 4634
147 Ga0495625_0020537 3300046660 Bacteria 5097
148 Ga0495635_0077747 3300046663 Bacteria 2273
149 Ga0495599_0012507 3300046678 Bacteria 5234
150 Ga0495623_0004899 3300046679 Bacteria 8770
151 Ga0495646_0016514 3300046680 Bacteria 4686
152 Ga0495658_0023797 3300046683 Bacteria 3255
153 Ga0495669_0004076 3300046684 Bacteria 6009
154 Ga0495613_0231372 3300046689 Bacteria 1295
155 Ga0495624_0000451 3300046690 Bacteria 32323
156 Ga0495670_0063537 3300046691 Bacteria 1859
157 Ga0495649_0083008 3300046694 Bacteria 1712
158 Ga0495660_0037499 3300046810 Bacteria 2699
159 Ga0495604_0000412 3300047317 Bacteria 38635
160 Ga0495604_0005337 3300047317 Bacteria 10188
161 Ga0495674_0009738 3300047319 Bacteria 9122
162 Ga0495680_0004353 3300047322 Bacteria 13564
163 Ga0495680_0041865 3300047322 Bacteria 3638
164 Ga0495683_0005175 3300047323 Bacteria 7266
165 Ga0495683_0017426 3300047323 Bacteria 3723
166 Ga0495687_014880 3300047443 Bacteria 3977
167 Ga0495675_0045422 3300047444 Bacteria 2797
168 Ga0495675_0051937 3300047444 Bacteria 2603
169 Ga0495686_0070556 3300047472 Bacteria 2153
170 Ga0495593_0000498 3300047673 Bacteria 22191
171 Ga0495593_0040317 3300047673 Bacteria 2514
172 Ga0495593_0048608 3300047673 Bacteria 2254
173 Ga0495602_0000636 3300048088 Bacteria 32890
174 Ga0495626_0013200 3300048091 Bacteria 4301
175 Ga0496100_0001053 3300048903 Bacteria 13304
176 Ga0496100_0010074 3300048903 Bacteria 5339
177 Ga0496101_0017421 3300048904 Bacteria 4872
178 Ga0496102_0006446 3300048905 Bacteria 10007
179 Ga0496103_0006542 3300048906 Bacteria 6950
180 Ga0496103_0032987 3300048906 Bacteria 3162
181 Ga0496104_0005682 3300048907 Bacteria 10921
182 Ga0496104_0021515 3300048907 Bacteria 5922
183 Ga0496104_0050792 3300048907 Bacteria 3912
184 Ga0496105_0024301 3300048908 Bacteria 4923
185 Ga0496105_0132387 3300048908 Bacteria 2055
186 Ga0496105_0160535 3300048908 Bacteria 1845
187 Ga0496106_0005252 3300048909 Bacteria 9595
188 Ga0496106_0024471 3300048909 Bacteria 4490
189 Ga0496107_0000706 3300048910 Bacteria 19050
190 Ga0496107_0033495 3300048910 Bacteria 3676
191 Ga0496108_0060638 3300048911 Bacteria 3183
192 Ga0496110_0030323 3300048913 Bacteria 4661
193 Ga0496110_0062462 3300048913 Bacteria 3289
194 Ga0496111_0006033 3300048914 Bacteria 7831
195 Ga0496111_0103650 3300048914 Bacteria 2092
196 Ga0496112_0008353 3300048915 Bacteria 9272
197 Ga0496113_0010469 3300048916 Bacteria 6131
198 Ga0496113_0026181 3300048916 Bacteria 4167
199 Ga0496114_0001576 3300048917 Bacteria 17323
200 Ga0496116_0030675 3300048919 Bacteria 3858
201 Ga0496116_0130528 3300048919 Bacteria 1433
202 Ga0496117_0014468 3300048920 Bacteria 6794
203 Ga0496118_0135999 3300048921 Bacteria 1568
204 Ga0496120_0026973 3300048923 Bacteria 3540
205 Ga0496122_0007597 3300048925 Bacteria 11984
206 Ga0496122_0021244 3300048925 Bacteria 5819
207 Ga0496122_0029572 3300048925 Bacteria 4618
208 Ga0496123_0016957 3300048926 Bacteria 5883
209 Ga0496123_0020304 3300048926 Bacteria 5201
210 Ga0496123_0041053 3300048926 Bacteria 3213
211 Ga0496124_0001772 3300048927 Bacteria 30048
212 Ga0496124_0069471 3300048927 Bacteria 2924
213 Ga0496124_0082157 3300048927 Bacteria 2645
214 Ga0496124_0135327 3300048927 Bacteria 1952
215 Ga0496125_0011567 3300048928 Bacteria 8816
216 Ga0496125_0025074 3300048928 Bacteria 5470
217 Ga0496126_0029495 3300048929 Bacteria 5212
218 Ga0496126_0032852 3300048929 Bacteria 4884
219 Ga0501033_0122431 3300049570 Bacteria 1887
220 Ga0501034_0062292 3300049571 Bacteria 3746
221 Ga0501042_0130814 3300049578 Bacteria 1809
222 Ga0501047_0005409 3300049581 Bacteria 12008
223 Ga0501075_0151420 3300049591 Bacteria 1768
224 Ga0501083_0028110 3300049744 Bacteria 3878
225 Ga0501280_000717 3300049776 Bacteria 7353
226 nmdc:mga0yw44_117998_c1 3300050492 Bacteria 1707
227 nmdc:mga06z11_6928_c1 3300050494 Bacteria 4641
228 nmdc:mga06z11_7993_c1 3300050494 Bacteria 4051
229 nmdc:mga08y16_132260_c1 3300050511 Bacteria 2594
230 nmdc:mga0sz30_4747_c1 3300050516 Bacteria 4935
231 Ga0500644_0000627 3300053088 Bacteria 13205
232 Ga0500555_000002 3300053103 Bacteria 1314346
233 Ga0500594_0000136 3300053118 Bacteria 20347
234 Ga0500628_000008 3300053129 Bacteria 151664
235 Ga0500652_000028 3300053131 Bacteria 92605
236 Ga0500636_0066609 3300053177 Bacteria 2094
237 Ga0501084_0007087 3300054114 Bacteria 9236
238 Ga0501082_0003534 3300060353 Bacteria 13650
239 Ga0466962_0065430 3300061719 Bacteria 1736
240 Ga0530510_0016091 3300061734 Bacteria 5288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221599 2644002887 321
2 3300044658 Ga0466972_0094252 Ga0466972_0094252_19_1029 333
3 3300003322 rootL2_10230740 rootL2_102307401 338
4 3300049571 Ga0501034_0062292 Ga0501034_0062292_427_1608 346
5 3300046543 Ga0495645_0021772 Ga0495645_0021772_12_1112 348
6 iso_pu_bacteria 2751185897 2753767818 348
7 3300038443 Ga0395901_0000039 Ga0395901_0000039_30481_31686 350
8 3300037471 Ga0395905_0017167 Ga0395905_0017167_2612_3814 357
9 3300005563 Ga0068855_100004965 Ga0068855_10000496516 360
10 3300009093 Ga0105240_10005351 Ga0105240_100053513 360
11 3300025913 Ga0207695_10004444 Ga0207695_100044443 360
12 3300025949 Ga0207667_10008734 Ga0207667_100087343 360
13 3300053103 Ga0500555_000002 Ga0500555_000002_826580_827707 363
14 3300046689 Ga0495613_0231372 Ga0495613_0231372_12_1127 364
15 3300053131 Ga0500652_000028 Ga0500652_000028_49835_50974 365
16 3300009011 Ga0105251_10003060 Ga0105251_1000306012 366
17 3300009553 Ga0105249_10010964 Ga0105249_100109642 366
18 3300025302 Ga0207426_1002374 Ga0207426_10023747 366
19 3300025735 Ga0207713_1011173 Ga0207713_10111733 366
20 3300046500 Ga0495596_0030746 Ga0495596_0030746_245_1435 366
21 3300046515 Ga0495620_0037979 Ga0495620_0037979_774_1964 366
22 3300047323 Ga0495683_0005175 Ga0495683_0005175_252_1442 366
23 3300048903 Ga0496100_0001053 Ga0496100_0001053_2370_3560 366
24 3300048904 Ga0496101_0017421 Ga0496101_0017421_1321_2511 366
25 3300048906 Ga0496103_0006542 Ga0496103_0006542_4519_5709 366
26 3300048909 Ga0496106_0005252 Ga0496106_0005252_648_1838 366
27 3300048910 Ga0496107_0000706 Ga0496107_0000706_16394_17584 366
28 3300048913 Ga0496110_0030323 Ga0496110_0030323_1123_2313 366
29 3300048914 Ga0496111_0103650 Ga0496111_0103650_479_1669 366
30 3300048915 Ga0496112_0008353 Ga0496112_0008353_6604_7794 366
31 3300048916 Ga0496113_0026181 Ga0496113_0026181_670_1860 366
32 3300048919 Ga0496116_0030675 Ga0496116_0030675_1400_2590 366
33 3300048920 Ga0496117_0014468 Ga0496117_0014468_2968_4158 366
34 3300048921 Ga0496118_0135999 Ga0496118_0135999_239_1429 366
35 3300048925 Ga0496122_0007597 Ga0496122_0007597_2542_3732 366
36 3300048926 Ga0496123_0020304 Ga0496123_0020304_3595_4785 366
37 3300048927 Ga0496124_0001772 Ga0496124_0001772_11317_12507 366
38 3300048928 Ga0496125_0025074 Ga0496125_0025074_586_1776 366
39 3300047322 Ga0495680_0041865 Ga0495680_0041865_624_1850 367
40 3300047444 Ga0495675_0051937 Ga0495675_0051937_91_1317 367
41 3300047673 Ga0495593_0040317 Ga0495593_0040317_1179_2381 367
42 3300049581 Ga0501047_0005409 Ga0501047_0005409_6882_8069 368
43 3300049744 Ga0501083_0028110 Ga0501083_0028110_83_1270 368
44 3300054114 Ga0501084_0007087 Ga0501084_0007087_3329_4516 368
45 3300060353 Ga0501082_0003534 Ga0501082_0003534_4016_5203 368
46 3300046457 Ga0495590_0000297 Ga0495590_0000297_3623_4822 373
47 3300048907 Ga0496104_0021515 Ga0496104_0021515_4137_5327 373
48 3300048929 Ga0496126_0029495 Ga0496126_0029495_2031_3221 373
49 3300046459 Ga0495629_0005191 Ga0495629_0005191_8385_9575 374
50 3300046463 Ga0495653_0027608 Ga0495653_0027608_2270_3460 374
51 3300046507 Ga0495606_0026635 Ga0495606_0026635_1468_2658 374
52 3300046517 Ga0495630_0008311 Ga0495630_0008311_2161_3351 374
53 3300046529 Ga0495652_0003542 Ga0495652_0003542_13732_14922 374
54 3300046663 Ga0495635_0077747 Ga0495635_0077747_774_1964 374
55 3300046678 Ga0495599_0012507 Ga0495599_0012507_1833_3023 374
56 3300046679 Ga0495623_0004899 Ga0495623_0004899_163_1353 374
57 3300046680 Ga0495646_0016514 Ga0495646_0016514_738_1928 374
58 3300046690 Ga0495624_0000451 Ga0495624_0000451_27911_29101 374
59 3300047317 Ga0495604_0005337 Ga0495604_0005337_6981_8171 374
60 3300047319 Ga0495674_0009738 Ga0495674_0009738_208_1398 374
61 3300047322 Ga0495680_0004353 Ga0495680_0004353_2370_3560 374
62 3300047444 Ga0495675_0045422 Ga0495675_0045422_1335_2525 374
63 3300047673 Ga0495593_0000498 Ga0495593_0000498_18250_19440 374
64 3300047673 Ga0495593_0048608 Ga0495593_0048608_174_1364 374
65 3300048088 Ga0495602_0000636 Ga0495602_0000636_31068_32258 374
66 3300048908 Ga0496105_0024301 Ga0496105_0024301_134_1324 374
67 3300046476 Ga0495662_0023505 Ga0495662_0023505_1484_2662 377
68 3300047317 Ga0495604_0000412 Ga0495604_0000412_36581_37759 377
69 3300053177 Ga0500636_0066609 Ga0500636_0066609_317_1495 377
70 3300014745 Ga0157377_10070345 Ga0157377_100703452 378
71 3300031731 Ga0307405_10007407 Ga0307405_100074073 378
72 3300048927 Ga0496124_0082157 Ga0496124_0082157_27_1223 378
73 3300005536 Ga0070697_100047369 Ga0070697_1000473692 380
74 3300006847 Ga0075431_100017160 Ga0075431_1000171602 380
75 3300009147 Ga0114129_10224809 Ga0114129_102248093 380
76 3300046694 Ga0495649_0083008 Ga0495649_0083008_106_1308 380
77 iso_pu_bacteria 2510917028 2511183059 380
78 iso_pu_bacteria 2513237088 2513597014 380
79 iso_pu_bacteria 2519899620 2520377701 380
80 iso_pu_bacteria 2582581294 2585204507 380
81 iso_pu_bacteria 2582581867 2585402793 380
82 iso_pu_bacteria 2585427590 2585823544 380
83 iso_pu_bacteria 2765235802 2765469183 380
84 iso_pu_bacteria 2842509118 2842514947 380
85 iso_pu_bacteria 2852387548 2852392968 380
86 iso_pu_bacteria 2923556063 2923561041 380
87 iso_pu_bacteria 2996887358 2996892677 380
88 iso_pu_bacteria 3005445848 3005447767 380
89 iso_pu_bacteria 3005452660 3005457296 380
90 iso_pu_bacteria 8005258706 8005264696 380
91 iso_pu_bacteria 8005321885 8005327204 380
92 iso_pu_bacteria 8005542996 8005546299 380
93 iso_pu_bacteria 8057575449 8057579577 380
94 3300005467 Ga0070706_100015079 Ga0070706_1000150795 381
95 3300005468 Ga0070707_100098328 Ga0070707_1000983283 381
96 3300025910 Ga0207684_10010553 Ga0207684_100105532 381
97 3300025922 Ga0207646_10012657 Ga0207646_100126573 381
98 3300048908 Ga0496105_0132387 Ga0496105_0132387_545_1723 381
99 3300048917 Ga0496114_0001576 Ga0496114_0001576_5196_6374 381
100 3300005329 Ga0070683_100000128 Ga0070683_10000012810 382
101 3300005981 Ga0081538_10053365 Ga0081538_100533652 382
102 3300025944 Ga0207661_10000029 Ga0207661_1000002971 382
103 3300046499 Ga0495594_0024581 Ga0495594_0024581_384_1595 382
104 3300046513 Ga0495616_0000980 Ga0495616_0000980_2298_3509 382
105 3300046519 Ga0495632_0000330 Ga0495632_0000330_14440_15651 382
106 3300046528 Ga0495642_0000488 Ga0495642_0000488_2187_3398 382
107 3300046530 Ga0495654_0002842 Ga0495654_0002842_5678_6889 382
108 3300046684 Ga0495669_0004076 Ga0495669_0004076_680_1891 382
109 iso_pu_bacteria 2582581306 2585264421 382
110 iso_pu_bacteria 2582581865 2585389785 382
111 iso_pu_bacteria 2582581866 2585395648 382
112 iso_pu_bacteria 2941499720 2941503045 382
113 iso_pu_bacteria 3003930520 3003935557 382
114 3300002739 JGI25158J39367_1000048 JGI25158J39367_100004828 383
115 3300002773 JGI25152J39213_1001860 JGI25152J39213_10018605 383
116 3300002773 JGI25152J39213_1002695 JGI25152J39213_10026953 383
117 3300002773 JGI25152J39213_1005464 JGI25152J39213_10054642 383
118 3300002987 JGI25159J45721_1007211 JGI25159J45721_10072113 383
119 3300003215 JGI25153J46596_10001325 JGI25153J46596_100013255 383
120 3300003215 JGI25153J46596_10004554 JGI25153J46596_100045543 383
121 3300003323 rootH1_10162899 rootH1_101628991 383
122 3300003354 JGI25160J50197_1011707 JGI25160J50197_10117072 383
123 3300003374 JGI25161J50226_1000267 JGI25161J50226_10002677 383
124 3300003771 Ga0055526_1000929 Ga0055526_100092918 383
125 3300003775 Ga0055524_1005700 Ga0055524_10057003 383
126 3300003790 Ga0055528_1002877 Ga0055528_10028778 383
127 3300003790 Ga0055528_1006712 Ga0055528_10067124 383
128 3300003792 Ga0055540_1017430 Ga0055540_10174302 383
129 3300003792 Ga0055540_1021560 Ga0055540_10215601 383
130 3300004625 Ga0055543_1000065 Ga0055543_100006575 383
131 3300005347 Ga0070668_100049478 Ga0070668_1000494782 383
132 3300005355 Ga0070671_100008483 Ga0070671_1000084835 383
133 3300006038 Ga0075365_10000529 Ga0075365_100005299 383
134 3300006178 Ga0075367_10007828 Ga0075367_100078282 383
135 3300009553 Ga0105249_10167084 Ga0105249_101670842 383
136 3300025208 Ga0209436_100014 Ga0209436_100014123 383
137 3300025245 Ga0207425_1001388 Ga0207425_10013882 383
138 3300025258 Ga0209129_1000790 Ga0209129_10007906 383
139 3300025258 Ga0209129_1002810 Ga0209129_10028107 383
140 3300025258 Ga0209129_1003088 Ga0209129_10030884 383
141 3300025273 Ga0209673_1002770 Ga0209673_10027702 383
142 3300025273 Ga0209673_1006816 Ga0209673_10068162 383
143 3300025273 Ga0209673_1008413 Ga0209673_10084133 383
144 3300025284 Ga0209130_1000004 Ga0209130_1000004517 383
145 3300025284 Ga0209130_1012135 Ga0209130_10121352 383
146 3300025294 Ga0209025_1005335 Ga0209025_10053356 383
147 3300025294 Ga0209025_1007567 Ga0209025_10075677 383
148 3300025295 Ga0209564_1001210 Ga0209564_100121022 383
149 3300025295 Ga0209564_1006088 Ga0209564_10060885 383
150 3300025295 Ga0209564_1009790 Ga0209564_10097902 383
151 3300025297 Ga0209758_1000829 Ga0209758_100082932 383
152 3300025297 Ga0209758_1001011 Ga0209758_100101114 383
153 3300025299 Ga0209256_1004013 Ga0209256_10040133 383
154 3300025302 Ga0207426_1000003 Ga0207426_1000003209 383
155 3300025302 Ga0207426_1008003 Ga0207426_10080032 383
156 3300025303 Ga0209051_1002227 Ga0209051_100222711 383
157 3300025303 Ga0209051_1014319 Ga0209051_10143193 383
158 3300025961 Ga0207712_10001438 Ga0207712_1000143815 383
159 3300025972 Ga0207668_10014061 Ga0207668_100140613 383
160 3300046457 Ga0495590_0006281 Ga0495590_0006281_1222_2394 383
161 3300046506 Ga0495583_0009564 Ga0495583_0009564_1024_2196 383
162 3300046512 Ga0495610_0092520 Ga0495610_0092520_43_1215 383
163 3300046513 Ga0495616_0007201 Ga0495616_0007201_4187_5359 383
164 3300046515 Ga0495620_0018013 Ga0495620_0018013_252_1424 383
165 3300046519 Ga0495632_0011756 Ga0495632_0011756_1258_2430 383
166 3300046522 Ga0495643_0009869 Ga0495643_0009869_4199_5371 383
167 3300046542 Ga0495597_0007013 Ga0495597_0007013_1547_2719 383
168 3300046660 Ga0495625_0020537 Ga0495625_0020537_1274_2446 383
169 3300046810 Ga0495660_0037499 Ga0495660_0037499_499_1671 383
170 3300047323 Ga0495683_0017426 Ga0495683_0017426_1258_2430 383
171 3300047443 Ga0495687_014880 Ga0495687_014880_282_1454 383
172 3300047472 Ga0495686_0070556 Ga0495686_0070556_491_1663 383
173 3300048091 Ga0495626_0013200 Ga0495626_0013200_1303_2475 383
174 3300048903 Ga0496100_0010074 Ga0496100_0010074_710_1882 383
175 3300048905 Ga0496102_0006446 Ga0496102_0006446_3827_4999 383
176 3300048906 Ga0496103_0032987 Ga0496103_0032987_1642_2814 383
177 3300048907 Ga0496104_0005682 Ga0496104_0005682_3993_5165 383
178 3300048908 Ga0496105_0160535 Ga0496105_0160535_520_1692 383
179 3300048909 Ga0496106_0024471 Ga0496106_0024471_2165_3337 383
180 3300048910 Ga0496107_0033495 Ga0496107_0033495_2267_3439 383
181 3300048911 Ga0496108_0060638 Ga0496108_0060638_165_1337 383
182 3300048913 Ga0496110_0062462 Ga0496110_0062462_1280_2452 383
183 3300048914 Ga0496111_0006033 Ga0496111_0006033_6066_7238 383
184 3300048916 Ga0496113_0010469 Ga0496113_0010469_165_1337 383
185 3300048919 Ga0496116_0130528 Ga0496116_0130528_38_1210 383
186 3300048923 Ga0496120_0026973 Ga0496120_0026973_1090_2262 383
187 3300048925 Ga0496122_0021244 Ga0496122_0021244_1515_2687 383
188 3300048926 Ga0496123_0016957 Ga0496123_0016957_2132_3304 383
189 3300048927 Ga0496124_0069471 Ga0496124_0069471_690_1862 383
190 3300048927 Ga0496124_0135327 Ga0496124_0135327_347_1519 383
191 3300050492 nmdc:mga0yw44_117998_c1 nmdc:mga0yw44_117998_c1_267_1439 383
192 3300050494 nmdc:mga06z11_7993_c1 nmdc:mga06z11_7993_c1_1874_3046 383
193 iso_pu_bacteria 2883087390 2883095815 383
194 3300009766 Ga0123342_1026717 Ga0123342_10267174 384
195 3300025297 Ga0209758_1008641 Ga0209758_10086412 385
196 3300041411 Ga0439466_0012970 Ga0439466_0012970_844_2022 385
197 iso_pu_bacteria 2585427594 2585847591 386
198 3300005331 Ga0070670_100146109 Ga0070670_1001461092 387
199 3300005355 Ga0070671_100010572 Ga0070671_1000105723 387
200 3300005985 Ga0081539_10001822 Ga0081539_100018227 387
201 3300006237 Ga0097621_100045713 Ga0097621_1000457133 387
202 3300006358 Ga0068871_100029300 Ga0068871_1000293002 387
203 3300009177 Ga0105248_10007457 Ga0105248_100074575 387
204 3300014325 Ga0163163_10107666 Ga0163163_101076661 387
205 3300025931 Ga0207644_10066680 Ga0207644_100666802 387
206 3300025941 Ga0207711_10011986 Ga0207711_100119863 387
207 3300026095 Ga0207676_10036241 Ga0207676_100362411 387
208 3300031238 Ga0265332_10000006 Ga0265332_10000006118 387
209 3300046683 Ga0495658_0023797 Ga0495658_0023797_923_2098 387
210 3300046691 Ga0495670_0063537 Ga0495670_0063537_663_1838 387
211 3300053118 Ga0500594_0000136 Ga0500594_0000136_16178_17383 387
212 3300005336 Ga0070680_100137905 Ga0070680_1001379052 388
213 3300006038 Ga0075365_10109809 Ga0075365_101098092 388
214 3300006178 Ga0075367_10004242 Ga0075367_100042424 388
215 3300006186 Ga0075369_10000345 Ga0075369_1000034514 388
216 3300006353 Ga0075370_10045742 Ga0075370_100457422 388
217 3300025917 Ga0207660_10038680 Ga0207660_100386802 388
218 3300044673 Ga0453683_0009719 Ga0453683_0009719_1636_2820 388
219 3300044683 Ga0466965_0021191 Ga0466965_0021191_1806_3017 388
220 3300044684 Ga0466966_0004256 Ga0466966_0004256_3759_4970 388
221 3300044694 Ga0466963_0094681 Ga0466963_0094681_111_1310 388
222 3300045051 Ga0451576_0004399 Ga0451576_0004399_6601_7785 388
223 3300049776 Ga0501280_000717 Ga0501280_000717_3738_4922 388
224 3300050494 nmdc:mga06z11_6928_c1 nmdc:mga06z11_6928_c1_1902_3086 388
225 3300050516 nmdc:mga0sz30_4747_c1 nmdc:mga0sz30_4747_c1_3246_4430 388
226 3300053088 Ga0500644_0000627 Ga0500644_0000627_2471_3679 388
227 3300053129 Ga0500628_000008 Ga0500628_000008_26376_27584 388
228 3300061719 Ga0466962_0065430 Ga0466962_0065430_55_1266 388
229 3300005434 Ga0070709_10146922 Ga0070709_101469222 389
230 3300005439 Ga0070711_100070449 Ga0070711_1000704492 389
231 3300006358 Ga0068871_100086129 Ga0068871_1000861292 389
232 3300025906 Ga0207699_10132422 Ga0207699_101324221 389
233 3300026121 Ga0207683_10010516 Ga0207683_100105166 389
234 3300035172 Ga0373955_0070269 Ga0373955_0070269_488_1669 389
235 3300048907 Ga0496104_0050792 Ga0496104_0050792_1932_3125 390
236 3300049578 Ga0501042_0130814 Ga0501042_0130814_369_1562 390
237 3300031665 Ga0316575_10027499 Ga0316575_100274992 391
238 3300035398 Ga0316574_0030259 Ga0316574_0030259_1624_2823 391
239 3300046524 Ga0495648_0024591 Ga0495648_0024591_709_1905 391
240 3300006880 Ga0075429_100038887 Ga0075429_1000388872 392
241 3300009094 Ga0111539_10093103 Ga0111539_100931032 392
242 3300046492 Ga0495585_0074790 Ga0495585_0074790_52_1260 392
243 3300050511 nmdc:mga08y16_132260_c1 nmdc:mga08y16_132260_c1_471_1673 392
244 3300005444 Ga0070694_100060621 Ga0070694_1000606212 393
245 3300005439 Ga0070711_100051892 Ga0070711_1000518922 394
246 3300005614 Ga0068856_100003482 Ga0068856_1000034829 394
247 3300005844 Ga0068862_100066407 Ga0068862_1000664073 394
248 3300006175 Ga0070712_100008874 Ga0070712_1000088746 394
249 3300013102 Ga0157371_10000013 Ga0157371_10000013117 394
250 3300013307 Ga0157372_10005411 Ga0157372_100054117 394
251 3300025915 Ga0207693_10003615 Ga0207693_100036155 394
252 3300025916 Ga0207663_10100980 Ga0207663_101009802 394
253 3300025929 Ga0207664_10019623 Ga0207664_100196233 394
254 3300026075 Ga0207708_10024360 Ga0207708_100243602 394
255 3300042876 Ga0451577_0000276 Ga0451577_0000276_47331_48533 394
256 3300044712 Ga0453684_0000891 Ga0453684_0000891_50966_52168 394
257 3300045051 Ga0451576_0002533 Ga0451576_0002533_19263_20465 394
258 3300049570 Ga0501033_0122431 Ga0501033_0122431_46_1263 395
259 3300049591 Ga0501075_0151420 Ga0501075_0151420_293_1510 395
260 3300061734 Ga0530510_0016091 Ga0530510_0016091_2872_4089 395
261 3300025284 Ga0209130_1006332 Ga0209130_10063322 400
262 3300048925 Ga0496122_0029572 Ga0496122_0029572_386_1624 405
263 3300048926 Ga0496123_0041053 Ga0496123_0041053_1391_2629 405
264 3300048928 Ga0496125_0011567 Ga0496125_0011567_441_1679 405
265 3300048929 Ga0496126_0032852 Ga0496126_0032852_852_2090 405
266 2010549000 RicEn_C1634 RicEn_30160 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

3

387

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.9185 1 388
4dq8-assembly1.cif.gz_B crystal structure of acetate kinase acka from mycobacterium marinum 0.9103 1 392
4dq8-assembly1.cif.gz_B crystal structure of acetate kinase acka from mycobacterium marinum 0.9056 1 392
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.9048 1 388
3r9p-assembly1.cif.gz_B-2 crystal structure of acka from mycobacterium paratuberculosis atcc baa-968 / k-10 0.8964 1 393
ID Description Score Start End Superfamily
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9534 202 394 3.30.420.40
1x3mA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9505 200 392 3.30.420.40
4h0oB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9039 200 394 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8953 202 394 3.30.420.40
1x3mA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8882 200 392 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7S1HMZ2-F1-model_v4 Acetate kinase 0.982 204 318 GO:0005829
GO:0006083
GO:0008776
AF-G2GYA5-F1-model_v4 Acetate kinase 0.9797 139 327 GO:0005524
GO:0005829
GO:0006083
GO:0008776
GO:0047761
AF-A0A529X2V2-F1-model_v4 deleted 0.9797 172 310
AF-Q92JB7-F1-model_v4 Acetate kinase (AckA)-like protein (EC 2.3.1.129) 0.9797 229 343 GO:0005829
GO:0006083
GO:0008776
GO:0008780
AF-A0A431I0G1-F1-model_v4 Acetate kinase 0.9755 131 272 GO:0005524
GO:0005829
GO:0006083
GO:0008776
GO:0047761

Feature Viewer

pLDDT pTM Quality
86.96 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map