F373734
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 208 | 240 | 388 |
Family's Representative Sequence
| Representative Sequence | 2010549000|RicEn_C1634|RicEn_30160 |
| Length | 428 |
| Sequence | MKSILVINSGSSSIKFALFQIQSYSIKKLYSGLIENVLVEPLLTIKDSDSGKKITELEKVDVSGNPYESAISYVLKWITGKNFRVIAVGHRIVHGGASYSSPIILRDVDLEELSKLNNICPLHQPHNVNGVRIIEELLPDVLQVGCFDTGFHKTCNPISQTFSIPKKYRDNGVKRYGFHGLSYEYISQTMPEIVPSDIVDGKWIVCHLGSGATMCAFHGLKSVATSIGFSAIGGLPMGTRADSLDPGLMIYFMKEYQMTTDEILNLIYKESGLLGVSEISSDIRDLHASDSPKAKLAVDLLAHQITNHFGMLCAELQGCDGIIFTGGIGENDSILRDLVCRNLQWLNFEIDPIANNSIFGGITGRISKENSKDIWVIPTDEELMIARHAYEIIKTSRFTSGTSMLPNFDPDPKFCAIQKKNSGINPTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 3 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 4 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 5 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 6 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 7 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 8 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 9 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 10 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 11 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 12 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 13 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 14 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 15 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 16 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 17 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 18 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 19 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 20 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 21 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 22 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 23 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 24 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 25 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 26 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 31 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 110 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 111 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 112 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 113 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 116 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 175 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 176 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 177 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 178 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 179 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 180 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 181 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 182 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 183 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 184 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 191 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 199 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 200 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 201 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 204 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 205 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 206 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 207 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 208 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.23 |
| Metatranscriptomes | 0 |
| Isolates | 9.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.8 |
| Nodule | 3.01 |
| Rhizoplane | 9.77 |
| Rhizosphere | 54.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C1634 | 2010549000 | Bacteria | 2783 |
| 2 | JGI25158J39367_1000048 | 3300002739 | Bacteria | 27557 |
| 3 | JGI25152J39213_1001860 | 3300002773 | Bacteria | 8506 |
| 4 | JGI25152J39213_1002695 | 3300002773 | Bacteria | 6505 |
| 5 | JGI25152J39213_1005464 | 3300002773 | Bacteria | 3696 |
| 6 | JGI25159J45721_1007211 | 3300002987 | Bacteria | 3213 |
| 7 | JGI25153J46596_10001325 | 3300003215 | Bacteria | 14821 |
| 8 | JGI25153J46596_10004554 | 3300003215 | Bacteria | 7443 |
| 9 | rootL2_10230740 | 3300003322 | Bacteria | 1186 |
| 10 | rootH1_10162899 | 3300003323 | Bacteria | 1969 |
| 11 | JGI25160J50197_1011707 | 3300003354 | Bacteria | 3086 |
| 12 | JGI25161J50226_1000267 | 3300003374 | Bacteria | 30667 |
| 13 | Ga0055526_1000929 | 3300003771 | Bacteria | 21728 |
| 14 | Ga0055524_1005700 | 3300003775 | Bacteria | 5520 |
| 15 | Ga0055528_1002877 | 3300003790 | Bacteria | 8958 |
| 16 | Ga0055528_1006712 | 3300003790 | Bacteria | 5187 |
| 17 | Ga0055540_1017430 | 3300003792 | Bacteria | 2005 |
| 18 | Ga0055540_1021560 | 3300003792 | Bacteria | 1669 |
| 19 | Ga0055543_1000065 | 3300004625 | Bacteria | 97333 |
| 20 | Ga0070683_100000128 | 3300005329 | Bacteria | 49017 |
| 21 | Ga0070670_100146109 | 3300005331 | Bacteria | 2046 |
| 22 | Ga0070680_100137905 | 3300005336 | Bacteria | 2044 |
| 23 | Ga0070668_100049478 | 3300005347 | Bacteria | 3234 |
| 24 | Ga0070671_100008483 | 3300005355 | Bacteria | 8236 |
| 25 | Ga0070671_100010572 | 3300005355 | Bacteria | 7411 |
| 26 | Ga0070709_10146922 | 3300005434 | Bacteria | 1625 |
| 27 | Ga0070711_100051892 | 3300005439 | Unclassified | 2820 |
| 28 | Ga0070711_100070449 | 3300005439 | Bacteria | 2462 |
| 29 | Ga0070694_100060621 | 3300005444 | Bacteria | 2581 |
| 30 | Ga0070706_100015079 | 3300005467 | Bacteria | 7139 |
| 31 | Ga0070707_100098328 | 3300005468 | Bacteria | 2834 |
| 32 | Ga0070697_100047369 | 3300005536 | Bacteria | 3485 |
| 33 | Ga0068855_100004965 | 3300005563 | Bacteria | 16227 |
| 34 | Ga0068856_100003482 | 3300005614 | Bacteria | 15891 |
| 35 | Ga0068862_100066407 | 3300005844 | Bacteria | 3108 |
| 36 | Ga0081538_10053365 | 3300005981 | Bacteria | 2403 |
| 37 | Ga0081539_10001822 | 3300005985 | Bacteria | 33628 |
| 38 | Ga0075365_10000529 | 3300006038 | Bacteria | 14696 |
| 39 | Ga0075365_10109809 | 3300006038 | Bacteria | 1895 |
| 40 | Ga0070712_100008874 | 3300006175 | Bacteria | 6330 |
| 41 | Ga0075367_10004242 | 3300006178 | Bacteria | 6963 |
| 42 | Ga0075367_10007828 | 3300006178 | Bacteria | 5498 |
| 43 | Ga0075369_10000345 | 3300006186 | Bacteria | 13816 |
| 44 | Ga0097621_100045713 | 3300006237 | Bacteria | 3538 |
| 45 | Ga0075370_10045742 | 3300006353 | Bacteria | 2476 |
| 46 | Ga0068871_100029300 | 3300006358 | Bacteria | 4321 |
| 47 | Ga0068871_100086129 | 3300006358 | Bacteria | 2610 |
| 48 | Ga0075431_100017160 | 3300006847 | Bacteria | 7358 |
| 49 | Ga0075429_100038887 | 3300006880 | Bacteria | 4142 |
| 50 | Ga0105251_10003060 | 3300009011 | Bacteria | 12441 |
| 51 | Ga0105240_10005351 | 3300009093 | Bacteria | 19146 |
| 52 | Ga0111539_10093103 | 3300009094 | Bacteria | 3541 |
| 53 | Ga0114129_10224809 | 3300009147 | Bacteria | 2530 |
| 54 | Ga0105248_10007457 | 3300009177 | Bacteria | 12001 |
| 55 | Ga0105249_10010964 | 3300009553 | Bacteria | 7965 |
| 56 | Ga0105249_10167084 | 3300009553 | Bacteria | 2131 |
| 57 | Ga0123342_1026717 | 3300009766 | Bacteria | 3319 |
| 58 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 59 | Ga0157372_10005411 | 3300013307 | Bacteria | 13569 |
| 60 | Ga0163163_10107666 | 3300014325 | Bacteria | 2814 |
| 61 | Ga0157377_10070345 | 3300014745 | Unclassified | 2021 |
| 62 | Ga0209436_100014 | 3300025208 | Bacteria | 127004 |
| 63 | Ga0207425_1001388 | 3300025245 | Bacteria | 10230 |
| 64 | Ga0209129_1000790 | 3300025258 | Bacteria | 19972 |
| 65 | Ga0209129_1002810 | 3300025258 | Bacteria | 8090 |
| 66 | Ga0209129_1003088 | 3300025258 | Bacteria | 7503 |
| 67 | Ga0209673_1002770 | 3300025273 | Bacteria | 11433 |
| 68 | Ga0209673_1006816 | 3300025273 | Bacteria | 5423 |
| 69 | Ga0209673_1008413 | 3300025273 | Bacteria | 4595 |
| 70 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 71 | Ga0209130_1006332 | 3300025284 | Bacteria | 3866 |
| 72 | Ga0209130_1012135 | 3300025284 | Bacteria | 2271 |
| 73 | Ga0209025_1005335 | 3300025294 | Bacteria | 10547 |
| 74 | Ga0209025_1007567 | 3300025294 | Bacteria | 8057 |
| 75 | Ga0209564_1001210 | 3300025295 | Bacteria | 29473 |
| 76 | Ga0209564_1006088 | 3300025295 | Bacteria | 6635 |
| 77 | Ga0209564_1009790 | 3300025295 | Bacteria | 4504 |
| 78 | Ga0209758_1000829 | 3300025297 | Bacteria | 43270 |
| 79 | Ga0209758_1001011 | 3300025297 | Bacteria | 37221 |
| 80 | Ga0209758_1008641 | 3300025297 | Bacteria | 6538 |
| 81 | Ga0209256_1004013 | 3300025299 | Bacteria | 9619 |
| 82 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 83 | Ga0207426_1002374 | 3300025302 | Bacteria | 12184 |
| 84 | Ga0207426_1008003 | 3300025302 | Bacteria | 4340 |
| 85 | Ga0209051_1002227 | 3300025303 | Bacteria | 14303 |
| 86 | Ga0209051_1014319 | 3300025303 | Bacteria | 3708 |
| 87 | Ga0207713_1011173 | 3300025735 | Bacteria | 4908 |
| 88 | Ga0207699_10132422 | 3300025906 | Bacteria | 1628 |
| 89 | Ga0207684_10010553 | 3300025910 | Bacteria | 8120 |
| 90 | Ga0207695_10004444 | 3300025913 | Bacteria | 19118 |
| 91 | Ga0207693_10003615 | 3300025915 | Bacteria | 13202 |
| 92 | Ga0207663_10100980 | 3300025916 | Unclassified | 1937 |
| 93 | Ga0207660_10038680 | 3300025917 | Bacteria | 3331 |
| 94 | Ga0207646_10012657 | 3300025922 | Bacteria | 8097 |
| 95 | Ga0207664_10019623 | 3300025929 | Bacteria | 4999 |
| 96 | Ga0207644_10066680 | 3300025931 | Bacteria | 2621 |
| 97 | Ga0207711_10011986 | 3300025941 | Bacteria | 7205 |
| 98 | Ga0207661_10000029 | 3300025944 | Bacteria | 172511 |
| 99 | Ga0207667_10008734 | 3300025949 | Bacteria | 12010 |
| 100 | Ga0207712_10001438 | 3300025961 | Bacteria | 16253 |
| 101 | Ga0207668_10014061 | 3300025972 | Bacteria | 4949 |
| 102 | Ga0207708_10024360 | 3300026075 | Bacteria | 4578 |
| 103 | Ga0207676_10036241 | 3300026095 | Bacteria | 3751 |
| 104 | Ga0207683_10010516 | 3300026121 | Bacteria | 7895 |
| 105 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 106 | Ga0316575_10027499 | 3300031665 | Bacteria | 2213 |
| 107 | Ga0307405_10007407 | 3300031731 | Bacteria | 5485 |
| 108 | Ga0373955_0070269 | 3300035172 | Bacteria | 1956 |
| 109 | Ga0316574_0030259 | 3300035398 | Bacteria | 3277 |
| 110 | Ga0395905_0017167 | 3300037471 | Bacteria | 6875 |
| 111 | Ga0395901_0000039 | 3300038443 | Bacteria | 206143 |
| 112 | Ga0439466_0012970 | 3300041411 | Bacteria | 3058 |
| 113 | Ga0451577_0000276 | 3300042876 | Bacteria | 99531 |
| 114 | Ga0466972_0094252 | 3300044658 | Bacteria | 1419 |
| 115 | Ga0453683_0009719 | 3300044673 | Bacteria | 6411 |
| 116 | Ga0466965_0021191 | 3300044683 | Bacteria | 3128 |
| 117 | Ga0466966_0004256 | 3300044684 | Bacteria | 9442 |
| 118 | Ga0466963_0094681 | 3300044694 | Bacteria | 2037 |
| 119 | Ga0453684_0000891 | 3300044712 | Bacteria | 99637 |
| 120 | Ga0451576_0002533 | 3300045051 | Bacteria | 27062 |
| 121 | Ga0451576_0004399 | 3300045051 | Bacteria | 18339 |
| 122 | Ga0495590_0000297 | 3300046457 | Bacteria | 26237 |
| 123 | Ga0495590_0006281 | 3300046457 | Bacteria | 4652 |
| 124 | Ga0495629_0005191 | 3300046459 | Bacteria | 9751 |
| 125 | Ga0495653_0027608 | 3300046463 | Bacteria | 4542 |
| 126 | Ga0495662_0023505 | 3300046476 | Bacteria | 2976 |
| 127 | Ga0495585_0074790 | 3300046492 | Bacteria | 1843 |
| 128 | Ga0495594_0024581 | 3300046499 | Bacteria | 3237 |
| 129 | Ga0495596_0030746 | 3300046500 | Bacteria | 2148 |
| 130 | Ga0495583_0009564 | 3300046506 | Bacteria | 5776 |
| 131 | Ga0495606_0026635 | 3300046507 | Bacteria | 4118 |
| 132 | Ga0495610_0092520 | 3300046512 | Bacteria | 1368 |
| 133 | Ga0495616_0000980 | 3300046513 | Bacteria | 20449 |
| 134 | Ga0495616_0007201 | 3300046513 | Bacteria | 6668 |
| 135 | Ga0495620_0018013 | 3300046515 | Bacteria | 3506 |
| 136 | Ga0495620_0037979 | 3300046515 | Bacteria | 2140 |
| 137 | Ga0495630_0008311 | 3300046517 | Bacteria | 7451 |
| 138 | Ga0495632_0000330 | 3300046519 | Bacteria | 45417 |
| 139 | Ga0495632_0011756 | 3300046519 | Bacteria | 5095 |
| 140 | Ga0495643_0009869 | 3300046522 | Bacteria | 5902 |
| 141 | Ga0495648_0024591 | 3300046524 | Bacteria | 4097 |
| 142 | Ga0495642_0000488 | 3300046528 | Bacteria | 20311 |
| 143 | Ga0495652_0003542 | 3300046529 | Bacteria | 15341 |
| 144 | Ga0495654_0002842 | 3300046530 | Bacteria | 10879 |
| 145 | Ga0495597_0007013 | 3300046542 | Bacteria | 5775 |
| 146 | Ga0495645_0021772 | 3300046543 | Bacteria | 4634 |
| 147 | Ga0495625_0020537 | 3300046660 | Bacteria | 5097 |
| 148 | Ga0495635_0077747 | 3300046663 | Bacteria | 2273 |
| 149 | Ga0495599_0012507 | 3300046678 | Bacteria | 5234 |
| 150 | Ga0495623_0004899 | 3300046679 | Bacteria | 8770 |
| 151 | Ga0495646_0016514 | 3300046680 | Bacteria | 4686 |
| 152 | Ga0495658_0023797 | 3300046683 | Bacteria | 3255 |
| 153 | Ga0495669_0004076 | 3300046684 | Bacteria | 6009 |
| 154 | Ga0495613_0231372 | 3300046689 | Bacteria | 1295 |
| 155 | Ga0495624_0000451 | 3300046690 | Bacteria | 32323 |
| 156 | Ga0495670_0063537 | 3300046691 | Bacteria | 1859 |
| 157 | Ga0495649_0083008 | 3300046694 | Bacteria | 1712 |
| 158 | Ga0495660_0037499 | 3300046810 | Bacteria | 2699 |
| 159 | Ga0495604_0000412 | 3300047317 | Bacteria | 38635 |
| 160 | Ga0495604_0005337 | 3300047317 | Bacteria | 10188 |
| 161 | Ga0495674_0009738 | 3300047319 | Bacteria | 9122 |
| 162 | Ga0495680_0004353 | 3300047322 | Bacteria | 13564 |
| 163 | Ga0495680_0041865 | 3300047322 | Bacteria | 3638 |
| 164 | Ga0495683_0005175 | 3300047323 | Bacteria | 7266 |
| 165 | Ga0495683_0017426 | 3300047323 | Bacteria | 3723 |
| 166 | Ga0495687_014880 | 3300047443 | Bacteria | 3977 |
| 167 | Ga0495675_0045422 | 3300047444 | Bacteria | 2797 |
| 168 | Ga0495675_0051937 | 3300047444 | Bacteria | 2603 |
| 169 | Ga0495686_0070556 | 3300047472 | Bacteria | 2153 |
| 170 | Ga0495593_0000498 | 3300047673 | Bacteria | 22191 |
| 171 | Ga0495593_0040317 | 3300047673 | Bacteria | 2514 |
| 172 | Ga0495593_0048608 | 3300047673 | Bacteria | 2254 |
| 173 | Ga0495602_0000636 | 3300048088 | Bacteria | 32890 |
| 174 | Ga0495626_0013200 | 3300048091 | Bacteria | 4301 |
| 175 | Ga0496100_0001053 | 3300048903 | Bacteria | 13304 |
| 176 | Ga0496100_0010074 | 3300048903 | Bacteria | 5339 |
| 177 | Ga0496101_0017421 | 3300048904 | Bacteria | 4872 |
| 178 | Ga0496102_0006446 | 3300048905 | Bacteria | 10007 |
| 179 | Ga0496103_0006542 | 3300048906 | Bacteria | 6950 |
| 180 | Ga0496103_0032987 | 3300048906 | Bacteria | 3162 |
| 181 | Ga0496104_0005682 | 3300048907 | Bacteria | 10921 |
| 182 | Ga0496104_0021515 | 3300048907 | Bacteria | 5922 |
| 183 | Ga0496104_0050792 | 3300048907 | Bacteria | 3912 |
| 184 | Ga0496105_0024301 | 3300048908 | Bacteria | 4923 |
| 185 | Ga0496105_0132387 | 3300048908 | Bacteria | 2055 |
| 186 | Ga0496105_0160535 | 3300048908 | Bacteria | 1845 |
| 187 | Ga0496106_0005252 | 3300048909 | Bacteria | 9595 |
| 188 | Ga0496106_0024471 | 3300048909 | Bacteria | 4490 |
| 189 | Ga0496107_0000706 | 3300048910 | Bacteria | 19050 |
| 190 | Ga0496107_0033495 | 3300048910 | Bacteria | 3676 |
| 191 | Ga0496108_0060638 | 3300048911 | Bacteria | 3183 |
| 192 | Ga0496110_0030323 | 3300048913 | Bacteria | 4661 |
| 193 | Ga0496110_0062462 | 3300048913 | Bacteria | 3289 |
| 194 | Ga0496111_0006033 | 3300048914 | Bacteria | 7831 |
| 195 | Ga0496111_0103650 | 3300048914 | Bacteria | 2092 |
| 196 | Ga0496112_0008353 | 3300048915 | Bacteria | 9272 |
| 197 | Ga0496113_0010469 | 3300048916 | Bacteria | 6131 |
| 198 | Ga0496113_0026181 | 3300048916 | Bacteria | 4167 |
| 199 | Ga0496114_0001576 | 3300048917 | Bacteria | 17323 |
| 200 | Ga0496116_0030675 | 3300048919 | Bacteria | 3858 |
| 201 | Ga0496116_0130528 | 3300048919 | Bacteria | 1433 |
| 202 | Ga0496117_0014468 | 3300048920 | Bacteria | 6794 |
| 203 | Ga0496118_0135999 | 3300048921 | Bacteria | 1568 |
| 204 | Ga0496120_0026973 | 3300048923 | Bacteria | 3540 |
| 205 | Ga0496122_0007597 | 3300048925 | Bacteria | 11984 |
| 206 | Ga0496122_0021244 | 3300048925 | Bacteria | 5819 |
| 207 | Ga0496122_0029572 | 3300048925 | Bacteria | 4618 |
| 208 | Ga0496123_0016957 | 3300048926 | Bacteria | 5883 |
| 209 | Ga0496123_0020304 | 3300048926 | Bacteria | 5201 |
| 210 | Ga0496123_0041053 | 3300048926 | Bacteria | 3213 |
| 211 | Ga0496124_0001772 | 3300048927 | Bacteria | 30048 |
| 212 | Ga0496124_0069471 | 3300048927 | Bacteria | 2924 |
| 213 | Ga0496124_0082157 | 3300048927 | Bacteria | 2645 |
| 214 | Ga0496124_0135327 | 3300048927 | Bacteria | 1952 |
| 215 | Ga0496125_0011567 | 3300048928 | Bacteria | 8816 |
| 216 | Ga0496125_0025074 | 3300048928 | Bacteria | 5470 |
| 217 | Ga0496126_0029495 | 3300048929 | Bacteria | 5212 |
| 218 | Ga0496126_0032852 | 3300048929 | Bacteria | 4884 |
| 219 | Ga0501033_0122431 | 3300049570 | Bacteria | 1887 |
| 220 | Ga0501034_0062292 | 3300049571 | Bacteria | 3746 |
| 221 | Ga0501042_0130814 | 3300049578 | Bacteria | 1809 |
| 222 | Ga0501047_0005409 | 3300049581 | Bacteria | 12008 |
| 223 | Ga0501075_0151420 | 3300049591 | Bacteria | 1768 |
| 224 | Ga0501083_0028110 | 3300049744 | Bacteria | 3878 |
| 225 | Ga0501280_000717 | 3300049776 | Bacteria | 7353 |
| 226 | nmdc:mga0yw44_117998_c1 | 3300050492 | Bacteria | 1707 |
| 227 | nmdc:mga06z11_6928_c1 | 3300050494 | Bacteria | 4641 |
| 228 | nmdc:mga06z11_7993_c1 | 3300050494 | Bacteria | 4051 |
| 229 | nmdc:mga08y16_132260_c1 | 3300050511 | Bacteria | 2594 |
| 230 | nmdc:mga0sz30_4747_c1 | 3300050516 | Bacteria | 4935 |
| 231 | Ga0500644_0000627 | 3300053088 | Bacteria | 13205 |
| 232 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 233 | Ga0500594_0000136 | 3300053118 | Bacteria | 20347 |
| 234 | Ga0500628_000008 | 3300053129 | Bacteria | 151664 |
| 235 | Ga0500652_000028 | 3300053131 | Bacteria | 92605 |
| 236 | Ga0500636_0066609 | 3300053177 | Bacteria | 2094 |
| 237 | Ga0501084_0007087 | 3300054114 | Bacteria | 9236 |
| 238 | Ga0501082_0003534 | 3300060353 | Bacteria | 13650 |
| 239 | Ga0466962_0065430 | 3300061719 | Bacteria | 1736 |
| 240 | Ga0530510_0016091 | 3300061734 | Bacteria | 5288 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221599 | 2644002887 | 321 |
| 2 | 3300044658 | Ga0466972_0094252 | Ga0466972_0094252_19_1029 | 333 |
| 3 | 3300003322 | rootL2_10230740 | rootL2_102307401 | 338 |
| 4 | 3300049571 | Ga0501034_0062292 | Ga0501034_0062292_427_1608 | 346 |
| 5 | 3300046543 | Ga0495645_0021772 | Ga0495645_0021772_12_1112 | 348 |
| 6 | iso_pu_bacteria | 2751185897 | 2753767818 | 348 |
| 7 | 3300038443 | Ga0395901_0000039 | Ga0395901_0000039_30481_31686 | 350 |
| 8 | 3300037471 | Ga0395905_0017167 | Ga0395905_0017167_2612_3814 | 357 |
| 9 | 3300005563 | Ga0068855_100004965 | Ga0068855_10000496516 | 360 |
| 10 | 3300009093 | Ga0105240_10005351 | Ga0105240_100053513 | 360 |
| 11 | 3300025913 | Ga0207695_10004444 | Ga0207695_100044443 | 360 |
| 12 | 3300025949 | Ga0207667_10008734 | Ga0207667_100087343 | 360 |
| 13 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_826580_827707 | 363 |
| 14 | 3300046689 | Ga0495613_0231372 | Ga0495613_0231372_12_1127 | 364 |
| 15 | 3300053131 | Ga0500652_000028 | Ga0500652_000028_49835_50974 | 365 |
| 16 | 3300009011 | Ga0105251_10003060 | Ga0105251_1000306012 | 366 |
| 17 | 3300009553 | Ga0105249_10010964 | Ga0105249_100109642 | 366 |
| 18 | 3300025302 | Ga0207426_1002374 | Ga0207426_10023747 | 366 |
| 19 | 3300025735 | Ga0207713_1011173 | Ga0207713_10111733 | 366 |
| 20 | 3300046500 | Ga0495596_0030746 | Ga0495596_0030746_245_1435 | 366 |
| 21 | 3300046515 | Ga0495620_0037979 | Ga0495620_0037979_774_1964 | 366 |
| 22 | 3300047323 | Ga0495683_0005175 | Ga0495683_0005175_252_1442 | 366 |
| 23 | 3300048903 | Ga0496100_0001053 | Ga0496100_0001053_2370_3560 | 366 |
| 24 | 3300048904 | Ga0496101_0017421 | Ga0496101_0017421_1321_2511 | 366 |
| 25 | 3300048906 | Ga0496103_0006542 | Ga0496103_0006542_4519_5709 | 366 |
| 26 | 3300048909 | Ga0496106_0005252 | Ga0496106_0005252_648_1838 | 366 |
| 27 | 3300048910 | Ga0496107_0000706 | Ga0496107_0000706_16394_17584 | 366 |
| 28 | 3300048913 | Ga0496110_0030323 | Ga0496110_0030323_1123_2313 | 366 |
| 29 | 3300048914 | Ga0496111_0103650 | Ga0496111_0103650_479_1669 | 366 |
| 30 | 3300048915 | Ga0496112_0008353 | Ga0496112_0008353_6604_7794 | 366 |
| 31 | 3300048916 | Ga0496113_0026181 | Ga0496113_0026181_670_1860 | 366 |
| 32 | 3300048919 | Ga0496116_0030675 | Ga0496116_0030675_1400_2590 | 366 |
| 33 | 3300048920 | Ga0496117_0014468 | Ga0496117_0014468_2968_4158 | 366 |
| 34 | 3300048921 | Ga0496118_0135999 | Ga0496118_0135999_239_1429 | 366 |
| 35 | 3300048925 | Ga0496122_0007597 | Ga0496122_0007597_2542_3732 | 366 |
| 36 | 3300048926 | Ga0496123_0020304 | Ga0496123_0020304_3595_4785 | 366 |
| 37 | 3300048927 | Ga0496124_0001772 | Ga0496124_0001772_11317_12507 | 366 |
| 38 | 3300048928 | Ga0496125_0025074 | Ga0496125_0025074_586_1776 | 366 |
| 39 | 3300047322 | Ga0495680_0041865 | Ga0495680_0041865_624_1850 | 367 |
| 40 | 3300047444 | Ga0495675_0051937 | Ga0495675_0051937_91_1317 | 367 |
| 41 | 3300047673 | Ga0495593_0040317 | Ga0495593_0040317_1179_2381 | 367 |
| 42 | 3300049581 | Ga0501047_0005409 | Ga0501047_0005409_6882_8069 | 368 |
| 43 | 3300049744 | Ga0501083_0028110 | Ga0501083_0028110_83_1270 | 368 |
| 44 | 3300054114 | Ga0501084_0007087 | Ga0501084_0007087_3329_4516 | 368 |
| 45 | 3300060353 | Ga0501082_0003534 | Ga0501082_0003534_4016_5203 | 368 |
| 46 | 3300046457 | Ga0495590_0000297 | Ga0495590_0000297_3623_4822 | 373 |
| 47 | 3300048907 | Ga0496104_0021515 | Ga0496104_0021515_4137_5327 | 373 |
| 48 | 3300048929 | Ga0496126_0029495 | Ga0496126_0029495_2031_3221 | 373 |
| 49 | 3300046459 | Ga0495629_0005191 | Ga0495629_0005191_8385_9575 | 374 |
| 50 | 3300046463 | Ga0495653_0027608 | Ga0495653_0027608_2270_3460 | 374 |
| 51 | 3300046507 | Ga0495606_0026635 | Ga0495606_0026635_1468_2658 | 374 |
| 52 | 3300046517 | Ga0495630_0008311 | Ga0495630_0008311_2161_3351 | 374 |
| 53 | 3300046529 | Ga0495652_0003542 | Ga0495652_0003542_13732_14922 | 374 |
| 54 | 3300046663 | Ga0495635_0077747 | Ga0495635_0077747_774_1964 | 374 |
| 55 | 3300046678 | Ga0495599_0012507 | Ga0495599_0012507_1833_3023 | 374 |
| 56 | 3300046679 | Ga0495623_0004899 | Ga0495623_0004899_163_1353 | 374 |
| 57 | 3300046680 | Ga0495646_0016514 | Ga0495646_0016514_738_1928 | 374 |
| 58 | 3300046690 | Ga0495624_0000451 | Ga0495624_0000451_27911_29101 | 374 |
| 59 | 3300047317 | Ga0495604_0005337 | Ga0495604_0005337_6981_8171 | 374 |
| 60 | 3300047319 | Ga0495674_0009738 | Ga0495674_0009738_208_1398 | 374 |
| 61 | 3300047322 | Ga0495680_0004353 | Ga0495680_0004353_2370_3560 | 374 |
| 62 | 3300047444 | Ga0495675_0045422 | Ga0495675_0045422_1335_2525 | 374 |
| 63 | 3300047673 | Ga0495593_0000498 | Ga0495593_0000498_18250_19440 | 374 |
| 64 | 3300047673 | Ga0495593_0048608 | Ga0495593_0048608_174_1364 | 374 |
| 65 | 3300048088 | Ga0495602_0000636 | Ga0495602_0000636_31068_32258 | 374 |
| 66 | 3300048908 | Ga0496105_0024301 | Ga0496105_0024301_134_1324 | 374 |
| 67 | 3300046476 | Ga0495662_0023505 | Ga0495662_0023505_1484_2662 | 377 |
| 68 | 3300047317 | Ga0495604_0000412 | Ga0495604_0000412_36581_37759 | 377 |
| 69 | 3300053177 | Ga0500636_0066609 | Ga0500636_0066609_317_1495 | 377 |
| 70 | 3300014745 | Ga0157377_10070345 | Ga0157377_100703452 | 378 |
| 71 | 3300031731 | Ga0307405_10007407 | Ga0307405_100074073 | 378 |
| 72 | 3300048927 | Ga0496124_0082157 | Ga0496124_0082157_27_1223 | 378 |
| 73 | 3300005536 | Ga0070697_100047369 | Ga0070697_1000473692 | 380 |
| 74 | 3300006847 | Ga0075431_100017160 | Ga0075431_1000171602 | 380 |
| 75 | 3300009147 | Ga0114129_10224809 | Ga0114129_102248093 | 380 |
| 76 | 3300046694 | Ga0495649_0083008 | Ga0495649_0083008_106_1308 | 380 |
| 77 | iso_pu_bacteria | 2510917028 | 2511183059 | 380 |
| 78 | iso_pu_bacteria | 2513237088 | 2513597014 | 380 |
| 79 | iso_pu_bacteria | 2519899620 | 2520377701 | 380 |
| 80 | iso_pu_bacteria | 2582581294 | 2585204507 | 380 |
| 81 | iso_pu_bacteria | 2582581867 | 2585402793 | 380 |
| 82 | iso_pu_bacteria | 2585427590 | 2585823544 | 380 |
| 83 | iso_pu_bacteria | 2765235802 | 2765469183 | 380 |
| 84 | iso_pu_bacteria | 2842509118 | 2842514947 | 380 |
| 85 | iso_pu_bacteria | 2852387548 | 2852392968 | 380 |
| 86 | iso_pu_bacteria | 2923556063 | 2923561041 | 380 |
| 87 | iso_pu_bacteria | 2996887358 | 2996892677 | 380 |
| 88 | iso_pu_bacteria | 3005445848 | 3005447767 | 380 |
| 89 | iso_pu_bacteria | 3005452660 | 3005457296 | 380 |
| 90 | iso_pu_bacteria | 8005258706 | 8005264696 | 380 |
| 91 | iso_pu_bacteria | 8005321885 | 8005327204 | 380 |
| 92 | iso_pu_bacteria | 8005542996 | 8005546299 | 380 |
| 93 | iso_pu_bacteria | 8057575449 | 8057579577 | 380 |
| 94 | 3300005467 | Ga0070706_100015079 | Ga0070706_1000150795 | 381 |
| 95 | 3300005468 | Ga0070707_100098328 | Ga0070707_1000983283 | 381 |
| 96 | 3300025910 | Ga0207684_10010553 | Ga0207684_100105532 | 381 |
| 97 | 3300025922 | Ga0207646_10012657 | Ga0207646_100126573 | 381 |
| 98 | 3300048908 | Ga0496105_0132387 | Ga0496105_0132387_545_1723 | 381 |
| 99 | 3300048917 | Ga0496114_0001576 | Ga0496114_0001576_5196_6374 | 381 |
| 100 | 3300005329 | Ga0070683_100000128 | Ga0070683_10000012810 | 382 |
| 101 | 3300005981 | Ga0081538_10053365 | Ga0081538_100533652 | 382 |
| 102 | 3300025944 | Ga0207661_10000029 | Ga0207661_1000002971 | 382 |
| 103 | 3300046499 | Ga0495594_0024581 | Ga0495594_0024581_384_1595 | 382 |
| 104 | 3300046513 | Ga0495616_0000980 | Ga0495616_0000980_2298_3509 | 382 |
| 105 | 3300046519 | Ga0495632_0000330 | Ga0495632_0000330_14440_15651 | 382 |
| 106 | 3300046528 | Ga0495642_0000488 | Ga0495642_0000488_2187_3398 | 382 |
| 107 | 3300046530 | Ga0495654_0002842 | Ga0495654_0002842_5678_6889 | 382 |
| 108 | 3300046684 | Ga0495669_0004076 | Ga0495669_0004076_680_1891 | 382 |
| 109 | iso_pu_bacteria | 2582581306 | 2585264421 | 382 |
| 110 | iso_pu_bacteria | 2582581865 | 2585389785 | 382 |
| 111 | iso_pu_bacteria | 2582581866 | 2585395648 | 382 |
| 112 | iso_pu_bacteria | 2941499720 | 2941503045 | 382 |
| 113 | iso_pu_bacteria | 3003930520 | 3003935557 | 382 |
| 114 | 3300002739 | JGI25158J39367_1000048 | JGI25158J39367_100004828 | 383 |
| 115 | 3300002773 | JGI25152J39213_1001860 | JGI25152J39213_10018605 | 383 |
| 116 | 3300002773 | JGI25152J39213_1002695 | JGI25152J39213_10026953 | 383 |
| 117 | 3300002773 | JGI25152J39213_1005464 | JGI25152J39213_10054642 | 383 |
| 118 | 3300002987 | JGI25159J45721_1007211 | JGI25159J45721_10072113 | 383 |
| 119 | 3300003215 | JGI25153J46596_10001325 | JGI25153J46596_100013255 | 383 |
| 120 | 3300003215 | JGI25153J46596_10004554 | JGI25153J46596_100045543 | 383 |
| 121 | 3300003323 | rootH1_10162899 | rootH1_101628991 | 383 |
| 122 | 3300003354 | JGI25160J50197_1011707 | JGI25160J50197_10117072 | 383 |
| 123 | 3300003374 | JGI25161J50226_1000267 | JGI25161J50226_10002677 | 383 |
| 124 | 3300003771 | Ga0055526_1000929 | Ga0055526_100092918 | 383 |
| 125 | 3300003775 | Ga0055524_1005700 | Ga0055524_10057003 | 383 |
| 126 | 3300003790 | Ga0055528_1002877 | Ga0055528_10028778 | 383 |
| 127 | 3300003790 | Ga0055528_1006712 | Ga0055528_10067124 | 383 |
| 128 | 3300003792 | Ga0055540_1017430 | Ga0055540_10174302 | 383 |
| 129 | 3300003792 | Ga0055540_1021560 | Ga0055540_10215601 | 383 |
| 130 | 3300004625 | Ga0055543_1000065 | Ga0055543_100006575 | 383 |
| 131 | 3300005347 | Ga0070668_100049478 | Ga0070668_1000494782 | 383 |
| 132 | 3300005355 | Ga0070671_100008483 | Ga0070671_1000084835 | 383 |
| 133 | 3300006038 | Ga0075365_10000529 | Ga0075365_100005299 | 383 |
| 134 | 3300006178 | Ga0075367_10007828 | Ga0075367_100078282 | 383 |
| 135 | 3300009553 | Ga0105249_10167084 | Ga0105249_101670842 | 383 |
| 136 | 3300025208 | Ga0209436_100014 | Ga0209436_100014123 | 383 |
| 137 | 3300025245 | Ga0207425_1001388 | Ga0207425_10013882 | 383 |
| 138 | 3300025258 | Ga0209129_1000790 | Ga0209129_10007906 | 383 |
| 139 | 3300025258 | Ga0209129_1002810 | Ga0209129_10028107 | 383 |
| 140 | 3300025258 | Ga0209129_1003088 | Ga0209129_10030884 | 383 |
| 141 | 3300025273 | Ga0209673_1002770 | Ga0209673_10027702 | 383 |
| 142 | 3300025273 | Ga0209673_1006816 | Ga0209673_10068162 | 383 |
| 143 | 3300025273 | Ga0209673_1008413 | Ga0209673_10084133 | 383 |
| 144 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004517 | 383 |
| 145 | 3300025284 | Ga0209130_1012135 | Ga0209130_10121352 | 383 |
| 146 | 3300025294 | Ga0209025_1005335 | Ga0209025_10053356 | 383 |
| 147 | 3300025294 | Ga0209025_1007567 | Ga0209025_10075677 | 383 |
| 148 | 3300025295 | Ga0209564_1001210 | Ga0209564_100121022 | 383 |
| 149 | 3300025295 | Ga0209564_1006088 | Ga0209564_10060885 | 383 |
| 150 | 3300025295 | Ga0209564_1009790 | Ga0209564_10097902 | 383 |
| 151 | 3300025297 | Ga0209758_1000829 | Ga0209758_100082932 | 383 |
| 152 | 3300025297 | Ga0209758_1001011 | Ga0209758_100101114 | 383 |
| 153 | 3300025299 | Ga0209256_1004013 | Ga0209256_10040133 | 383 |
| 154 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003209 | 383 |
| 155 | 3300025302 | Ga0207426_1008003 | Ga0207426_10080032 | 383 |
| 156 | 3300025303 | Ga0209051_1002227 | Ga0209051_100222711 | 383 |
| 157 | 3300025303 | Ga0209051_1014319 | Ga0209051_10143193 | 383 |
| 158 | 3300025961 | Ga0207712_10001438 | Ga0207712_1000143815 | 383 |
| 159 | 3300025972 | Ga0207668_10014061 | Ga0207668_100140613 | 383 |
| 160 | 3300046457 | Ga0495590_0006281 | Ga0495590_0006281_1222_2394 | 383 |
| 161 | 3300046506 | Ga0495583_0009564 | Ga0495583_0009564_1024_2196 | 383 |
| 162 | 3300046512 | Ga0495610_0092520 | Ga0495610_0092520_43_1215 | 383 |
| 163 | 3300046513 | Ga0495616_0007201 | Ga0495616_0007201_4187_5359 | 383 |
| 164 | 3300046515 | Ga0495620_0018013 | Ga0495620_0018013_252_1424 | 383 |
| 165 | 3300046519 | Ga0495632_0011756 | Ga0495632_0011756_1258_2430 | 383 |
| 166 | 3300046522 | Ga0495643_0009869 | Ga0495643_0009869_4199_5371 | 383 |
| 167 | 3300046542 | Ga0495597_0007013 | Ga0495597_0007013_1547_2719 | 383 |
| 168 | 3300046660 | Ga0495625_0020537 | Ga0495625_0020537_1274_2446 | 383 |
| 169 | 3300046810 | Ga0495660_0037499 | Ga0495660_0037499_499_1671 | 383 |
| 170 | 3300047323 | Ga0495683_0017426 | Ga0495683_0017426_1258_2430 | 383 |
| 171 | 3300047443 | Ga0495687_014880 | Ga0495687_014880_282_1454 | 383 |
| 172 | 3300047472 | Ga0495686_0070556 | Ga0495686_0070556_491_1663 | 383 |
| 173 | 3300048091 | Ga0495626_0013200 | Ga0495626_0013200_1303_2475 | 383 |
| 174 | 3300048903 | Ga0496100_0010074 | Ga0496100_0010074_710_1882 | 383 |
| 175 | 3300048905 | Ga0496102_0006446 | Ga0496102_0006446_3827_4999 | 383 |
| 176 | 3300048906 | Ga0496103_0032987 | Ga0496103_0032987_1642_2814 | 383 |
| 177 | 3300048907 | Ga0496104_0005682 | Ga0496104_0005682_3993_5165 | 383 |
| 178 | 3300048908 | Ga0496105_0160535 | Ga0496105_0160535_520_1692 | 383 |
| 179 | 3300048909 | Ga0496106_0024471 | Ga0496106_0024471_2165_3337 | 383 |
| 180 | 3300048910 | Ga0496107_0033495 | Ga0496107_0033495_2267_3439 | 383 |
| 181 | 3300048911 | Ga0496108_0060638 | Ga0496108_0060638_165_1337 | 383 |
| 182 | 3300048913 | Ga0496110_0062462 | Ga0496110_0062462_1280_2452 | 383 |
| 183 | 3300048914 | Ga0496111_0006033 | Ga0496111_0006033_6066_7238 | 383 |
| 184 | 3300048916 | Ga0496113_0010469 | Ga0496113_0010469_165_1337 | 383 |
| 185 | 3300048919 | Ga0496116_0130528 | Ga0496116_0130528_38_1210 | 383 |
| 186 | 3300048923 | Ga0496120_0026973 | Ga0496120_0026973_1090_2262 | 383 |
| 187 | 3300048925 | Ga0496122_0021244 | Ga0496122_0021244_1515_2687 | 383 |
| 188 | 3300048926 | Ga0496123_0016957 | Ga0496123_0016957_2132_3304 | 383 |
| 189 | 3300048927 | Ga0496124_0069471 | Ga0496124_0069471_690_1862 | 383 |
| 190 | 3300048927 | Ga0496124_0135327 | Ga0496124_0135327_347_1519 | 383 |
| 191 | 3300050492 | nmdc:mga0yw44_117998_c1 | nmdc:mga0yw44_117998_c1_267_1439 | 383 |
| 192 | 3300050494 | nmdc:mga06z11_7993_c1 | nmdc:mga06z11_7993_c1_1874_3046 | 383 |
| 193 | iso_pu_bacteria | 2883087390 | 2883095815 | 383 |
| 194 | 3300009766 | Ga0123342_1026717 | Ga0123342_10267174 | 384 |
| 195 | 3300025297 | Ga0209758_1008641 | Ga0209758_10086412 | 385 |
| 196 | 3300041411 | Ga0439466_0012970 | Ga0439466_0012970_844_2022 | 385 |
| 197 | iso_pu_bacteria | 2585427594 | 2585847591 | 386 |
| 198 | 3300005331 | Ga0070670_100146109 | Ga0070670_1001461092 | 387 |
| 199 | 3300005355 | Ga0070671_100010572 | Ga0070671_1000105723 | 387 |
| 200 | 3300005985 | Ga0081539_10001822 | Ga0081539_100018227 | 387 |
| 201 | 3300006237 | Ga0097621_100045713 | Ga0097621_1000457133 | 387 |
| 202 | 3300006358 | Ga0068871_100029300 | Ga0068871_1000293002 | 387 |
| 203 | 3300009177 | Ga0105248_10007457 | Ga0105248_100074575 | 387 |
| 204 | 3300014325 | Ga0163163_10107666 | Ga0163163_101076661 | 387 |
| 205 | 3300025931 | Ga0207644_10066680 | Ga0207644_100666802 | 387 |
| 206 | 3300025941 | Ga0207711_10011986 | Ga0207711_100119863 | 387 |
| 207 | 3300026095 | Ga0207676_10036241 | Ga0207676_100362411 | 387 |
| 208 | 3300031238 | Ga0265332_10000006 | Ga0265332_10000006118 | 387 |
| 209 | 3300046683 | Ga0495658_0023797 | Ga0495658_0023797_923_2098 | 387 |
| 210 | 3300046691 | Ga0495670_0063537 | Ga0495670_0063537_663_1838 | 387 |
| 211 | 3300053118 | Ga0500594_0000136 | Ga0500594_0000136_16178_17383 | 387 |
| 212 | 3300005336 | Ga0070680_100137905 | Ga0070680_1001379052 | 388 |
| 213 | 3300006038 | Ga0075365_10109809 | Ga0075365_101098092 | 388 |
| 214 | 3300006178 | Ga0075367_10004242 | Ga0075367_100042424 | 388 |
| 215 | 3300006186 | Ga0075369_10000345 | Ga0075369_1000034514 | 388 |
| 216 | 3300006353 | Ga0075370_10045742 | Ga0075370_100457422 | 388 |
| 217 | 3300025917 | Ga0207660_10038680 | Ga0207660_100386802 | 388 |
| 218 | 3300044673 | Ga0453683_0009719 | Ga0453683_0009719_1636_2820 | 388 |
| 219 | 3300044683 | Ga0466965_0021191 | Ga0466965_0021191_1806_3017 | 388 |
| 220 | 3300044684 | Ga0466966_0004256 | Ga0466966_0004256_3759_4970 | 388 |
| 221 | 3300044694 | Ga0466963_0094681 | Ga0466963_0094681_111_1310 | 388 |
| 222 | 3300045051 | Ga0451576_0004399 | Ga0451576_0004399_6601_7785 | 388 |
| 223 | 3300049776 | Ga0501280_000717 | Ga0501280_000717_3738_4922 | 388 |
| 224 | 3300050494 | nmdc:mga06z11_6928_c1 | nmdc:mga06z11_6928_c1_1902_3086 | 388 |
| 225 | 3300050516 | nmdc:mga0sz30_4747_c1 | nmdc:mga0sz30_4747_c1_3246_4430 | 388 |
| 226 | 3300053088 | Ga0500644_0000627 | Ga0500644_0000627_2471_3679 | 388 |
| 227 | 3300053129 | Ga0500628_000008 | Ga0500628_000008_26376_27584 | 388 |
| 228 | 3300061719 | Ga0466962_0065430 | Ga0466962_0065430_55_1266 | 388 |
| 229 | 3300005434 | Ga0070709_10146922 | Ga0070709_101469222 | 389 |
| 230 | 3300005439 | Ga0070711_100070449 | Ga0070711_1000704492 | 389 |
| 231 | 3300006358 | Ga0068871_100086129 | Ga0068871_1000861292 | 389 |
| 232 | 3300025906 | Ga0207699_10132422 | Ga0207699_101324221 | 389 |
| 233 | 3300026121 | Ga0207683_10010516 | Ga0207683_100105166 | 389 |
| 234 | 3300035172 | Ga0373955_0070269 | Ga0373955_0070269_488_1669 | 389 |
| 235 | 3300048907 | Ga0496104_0050792 | Ga0496104_0050792_1932_3125 | 390 |
| 236 | 3300049578 | Ga0501042_0130814 | Ga0501042_0130814_369_1562 | 390 |
| 237 | 3300031665 | Ga0316575_10027499 | Ga0316575_100274992 | 391 |
| 238 | 3300035398 | Ga0316574_0030259 | Ga0316574_0030259_1624_2823 | 391 |
| 239 | 3300046524 | Ga0495648_0024591 | Ga0495648_0024591_709_1905 | 391 |
| 240 | 3300006880 | Ga0075429_100038887 | Ga0075429_1000388872 | 392 |
| 241 | 3300009094 | Ga0111539_10093103 | Ga0111539_100931032 | 392 |
| 242 | 3300046492 | Ga0495585_0074790 | Ga0495585_0074790_52_1260 | 392 |
| 243 | 3300050511 | nmdc:mga08y16_132260_c1 | nmdc:mga08y16_132260_c1_471_1673 | 392 |
| 244 | 3300005444 | Ga0070694_100060621 | Ga0070694_1000606212 | 393 |
| 245 | 3300005439 | Ga0070711_100051892 | Ga0070711_1000518922 | 394 |
| 246 | 3300005614 | Ga0068856_100003482 | Ga0068856_1000034829 | 394 |
| 247 | 3300005844 | Ga0068862_100066407 | Ga0068862_1000664073 | 394 |
| 248 | 3300006175 | Ga0070712_100008874 | Ga0070712_1000088746 | 394 |
| 249 | 3300013102 | Ga0157371_10000013 | Ga0157371_10000013117 | 394 |
| 250 | 3300013307 | Ga0157372_10005411 | Ga0157372_100054117 | 394 |
| 251 | 3300025915 | Ga0207693_10003615 | Ga0207693_100036155 | 394 |
| 252 | 3300025916 | Ga0207663_10100980 | Ga0207663_101009802 | 394 |
| 253 | 3300025929 | Ga0207664_10019623 | Ga0207664_100196233 | 394 |
| 254 | 3300026075 | Ga0207708_10024360 | Ga0207708_100243602 | 394 |
| 255 | 3300042876 | Ga0451577_0000276 | Ga0451577_0000276_47331_48533 | 394 |
| 256 | 3300044712 | Ga0453684_0000891 | Ga0453684_0000891_50966_52168 | 394 |
| 257 | 3300045051 | Ga0451576_0002533 | Ga0451576_0002533_19263_20465 | 394 |
| 258 | 3300049570 | Ga0501033_0122431 | Ga0501033_0122431_46_1263 | 395 |
| 259 | 3300049591 | Ga0501075_0151420 | Ga0501075_0151420_293_1510 | 395 |
| 260 | 3300061734 | Ga0530510_0016091 | Ga0530510_0016091_2872_4089 | 395 |
| 261 | 3300025284 | Ga0209130_1006332 | Ga0209130_10063322 | 400 |
| 262 | 3300048925 | Ga0496122_0029572 | Ga0496122_0029572_386_1624 | 405 |
| 263 | 3300048926 | Ga0496123_0041053 | Ga0496123_0041053_1391_2629 | 405 |
| 264 | 3300048928 | Ga0496125_0011567 | Ga0496125_0011567_441_1679 | 405 |
| 265 | 3300048929 | Ga0496126_0032852 | Ga0496126_0032852_852_2090 | 405 |
| 266 | 2010549000 | RicEn_C1634 | RicEn_30160 | 428 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3khy-assembly1.cif.gz_B | crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 | 0.9185 | 1 | 388 |
| 4dq8-assembly1.cif.gz_B | crystal structure of acetate kinase acka from mycobacterium marinum | 0.9103 | 1 | 392 |
| 4dq8-assembly1.cif.gz_B | crystal structure of acetate kinase acka from mycobacterium marinum | 0.9056 | 1 | 392 |
| 3khy-assembly1.cif.gz_B | crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 | 0.9048 | 1 | 388 |
| 3r9p-assembly1.cif.gz_B-2 | crystal structure of acka from mycobacterium paratuberculosis atcc baa-968 / k-10 | 0.8964 | 1 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2iirA02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9534 | 202 | 394 | 3.30.420.40 |
| 1x3mA02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9505 | 200 | 392 | 3.30.420.40 |
| 4h0oB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9039 | 200 | 394 | 3.30.420.40 |
| 2iirA02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8953 | 202 | 394 | 3.30.420.40 |
| 1x3mA02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8882 | 200 | 392 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1HMZ2-F1-model_v4 | Acetate kinase | 0.982 | 204 | 318 |
GO:0005829
GO:0006083 GO:0008776 |
| AF-G2GYA5-F1-model_v4 | Acetate kinase | 0.9797 | 139 | 327 |
GO:0005524
GO:0005829 GO:0006083 GO:0008776 GO:0047761 |
| AF-A0A529X2V2-F1-model_v4 | deleted | 0.9797 | 172 | 310 |
|
| AF-Q92JB7-F1-model_v4 | Acetate kinase (AckA)-like protein (EC 2.3.1.129) | 0.9797 | 229 | 343 |
GO:0005829
GO:0006083 GO:0008776 GO:0008780 |
| AF-A0A431I0G1-F1-model_v4 | Acetate kinase | 0.9755 | 131 | 272 |
GO:0005524
GO:0005829 GO:0006083 GO:0008776 GO:0047761 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar