F373666

General Info

Members Datasets Scaffolds Average Seq Length
265 200 530 243

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_002780|Ga0500618_002780_536_1357
Length 273
Sequence MLLSACLPFATVGAARGKQSDNRIARDITMKQDIEIKTADGVAKAALFRPDNGAPAERGVIFYMDAMGPRDSLYGMAQRLADAGHIVLLPDLFYRFGAYGPFDGSAFGNPASRETIMTMLRGTTQEMTKQDSSAFLDALSAAGAKGPVGTVGYCMGGGRAVTAAAAYPEGIAAAASFHGGNLASDAEDSPHRLAANIKARVYVGVAGVDNSFPPEQSARLAEALRTGGVDHTIENYVGMAHGWTVPDHHGVYDETGAERHWKRLLNLFEEALA

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
159 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
160 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
161 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
162 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
163 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
164 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
165 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
166 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
167 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
168 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
169 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
170 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
171 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
172 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
173 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
174 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
175 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
176 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
177 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
178 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
179 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
180 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
181 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
182 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
183 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
184 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
185 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
186 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
187 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
188 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
189 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
190 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
191 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
192 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
193 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
194 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
195 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
196 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
197 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
198 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
199 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
200 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.77
Metatranscriptomes 0
Isolates 16.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.15
Nodule 4.91
Rhizoplane 4.53
Rhizosphere 50.19
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_002780 3300053125 Bacteria 6350
2 JGI25158J39367_1000054 3300002739 Bacteria 26274
3 JGI25152J39213_1009939 3300002773 Bacteria 2216
4 JGI25150J39212_1007233 3300002774 Bacteria 2240
5 JGI25159J45721_1000265 3300002987 Bacteria 24451
6 JGI25159J45721_1002796 3300002987 Bacteria 6444
7 JGI25151J46595_10000321 3300003187 Bacteria 51966
8 JGI25153J46596_10007180 3300003215 Bacteria 5522
9 rootH1_10132233 3300003323 Bacteria 2683
10 rootH1_10138963 3300003323 Bacteria 2537
11 JGI25160J50197_1000006 3300003354 Bacteria 316247
12 JGI25160J50197_1017385 3300003354 Bacteria 2280
13 JGI25161J50226_1000004 3300003374 Bacteria 316212
14 JGI25161J50226_1000246 3300003374 Bacteria 32364
15 Ga0055526_1009281 3300003771 Bacteria 4765
16 Ga0055524_1010347 3300003775 Bacteria 3721
17 Ga0055536_1010826 3300003781 Bacteria 3568
18 Ga0055528_1004475 3300003790 Bacteria 6732
19 Ga0055540_1014058 3300003792 Bacteria 2409
20 Ga0055531_10023392 3300003794 Bacteria 2319
21 Ga0055543_1000002 3300004625 Bacteria 390020
22 Ga0055543_1000209 3300004625 Bacteria 47427
23 Ga0065165_1000341 3300005262 Bacteria 76483
24 Ga0065165_1002557 3300005262 Bacteria 15059
25 Ga0065165_1015712 3300005262 Bacteria 2875
26 Ga0070660_100028031 3300005339 Bacteria 4210
27 Ga0070660_100032403 3300005339 Bacteria 3932
28 Ga0070691_10254843 3300005341 Bacteria 942
29 Ga0070687_100131248 3300005343 Bacteria 1447
30 Ga0070675_100429062 3300005354 Bacteria 1183
31 Ga0070659_100019130 3300005366 Bacteria 5181
32 Ga0070659_100040386 3300005366 Bacteria 3645
33 Ga0070681_10011646 3300005458 Bacteria 8708
34 Ga0070681_10035793 3300005458 Bacteria 4987
35 Ga0068853_100073701 3300005539 Bacteria 2977
36 Ga0070665_100000144 3300005548 Bacteria 132302
37 Ga0070665_100170174 3300005548 Bacteria 2180
38 Ga0068855_100038097 3300005563 Bacteria 5714
39 Ga0068856_100108322 3300005614 Bacteria 2775
40 Ga0068852_100062347 3300005616 Bacteria 3243
41 Ga0068861_100729102 3300005719 Bacteria 924
42 Ga0068858_100237658 3300005842 Bacteria 1728
43 Ga0075365_10020251 3300006038 Bacteria 4121
44 Ga0075367_10439877 3300006178 Bacteria 826
45 Ga0075370_10017983 3300006353 Bacteria 3828
46 Ga0105244_10194639 3300009036 Bacteria 957
47 Ga0105240_10000019 3300009093 Bacteria 406211
48 Ga0105240_10260216 3300009093 Bacteria 2002
49 Ga0105240_10278558 3300009093 Bacteria 1922
50 Ga0105248_10072142 3300009177 Bacteria 3880
51 Ga0105248_10301065 3300009177 Bacteria 1806
52 Ga0105248_11019971 3300009177 Bacteria 935
53 Ga0105237_10002268 3300009545 Bacteria 23929
54 Ga0105238_10022312 3300009551 Bacteria 6453
55 Ga0105239_10019615 3300010375 Bacteria 7463
56 Ga0105239_10339493 3300010375 Bacteria 1695
57 Ga0157370_10001984 3300013104 Bacteria 25148
58 Ga0157370_10100932 3300013104 Bacteria 2703
59 Ga0157369_10221379 3300013105 Bacteria 1981
60 Ga0157369_10241392 3300013105 Bacteria 1887
61 Ga0163162_10264417 3300013306 Bacteria 1852
62 Ga0163163_10092125 3300014325 Bacteria 3046
63 Ga0182008_10016103 3300014497 Bacteria 3890
64 Ga0182007_10039167 3300015262 Bacteria 1587
65 Ga0182005_1005616 3300015265 Bacteria 3904
66 Ga0209436_100203 3300025208 Bacteria 27523
67 Ga0209677_101170 3300025253 Bacteria 12069
68 Ga0209759_1033241 3300025256 Bacteria 980
69 Ga0209129_1002380 3300025258 Bacteria 9255
70 Ga0209129_1008435 3300025258 Bacteria 2866
71 Ga0209129_1010052 3300025258 Bacteria 2407
72 Ga0209233_1000698 3300025261 Bacteria 15865
73 Ga0209673_1004225 3300025273 Bacteria 7819
74 Ga0209130_1000019 3300025284 Bacteria 381993
75 Ga0209130_1000032 3300025284 Bacteria 316240
76 Ga0209676_1015959 3300025292 Bacteria 2738
77 Ga0209025_1007184 3300025294 Bacteria 8404
78 Ga0209025_1043197 3300025294 Bacteria 1903
79 Ga0209564_1003805 3300025295 Bacteria 9787
80 Ga0209758_1000839 3300025297 Bacteria 42882
81 Ga0209758_1005800 3300025297 Bacteria 9254
82 Ga0209758_1008021 3300025297 Bacteria 6980
83 Ga0209758_1037954 3300025297 Bacteria 1854
84 Ga0209050_1003361 3300025298 Bacteria 11915
85 Ga0209256_1014674 3300025299 Bacteria 2796
86 Ga0207426_1000005 3300025302 Bacteria 1037188
87 Ga0207426_1000077 3300025302 Bacteria 316246
88 Ga0207426_1000151 3300025302 Bacteria 185103
89 Ga0209051_1014009 3300025303 Bacteria 3770
90 Ga0209051_1022578 3300025303 Bacteria 2646
91 Ga0209257_1002359 3300025304 Bacteria 18962
92 Ga0207705_10001506 3300025909 Bacteria 18507
93 Ga0207695_10000049 3300025913 Bacteria 406233
94 Ga0207695_10011647 3300025913 Bacteria 10627
95 Ga0207695_10139366 3300025913 Bacteria 2376
96 Ga0207695_10233020 3300025913 Bacteria 1745
97 Ga0207671_10000556 3300025914 Bacteria 50250
98 Ga0207660_10003783 3300025917 Bacteria 9851
99 Ga0207657_10003177 3300025919 Bacteria 17574
100 Ga0207652_10007927 3300025921 Bacteria 8527
101 Ga0207681_10245053 3300025923 Bacteria 1397
102 Ga0207694_10053218 3300025924 Bacteria 3138
103 Ga0207659_10561898 3300025926 Bacteria 971
104 Ga0207687_10109720 3300025927 Bacteria 2045
105 Ga0207690_10023155 3300025932 Bacteria 3874
106 Ga0207690_10024530 3300025932 Bacteria 3777
107 Ga0207709_10295865 3300025935 Bacteria 1202
108 Ga0207711_10001692 3300025941 Bacteria 20298
109 Ga0207667_10007827 3300025949 Bacteria 12772
110 Ga0207667_10014163 3300025949 Bacteria 9101
111 Ga0207651_10169447 3300025960 Bacteria 1721
112 Ga0207703_10655917 3300026035 Bacteria 996
113 Ga0207639_10039826 3300026041 Bacteria 3504
114 Ga0207702_10512209 3300026078 Bacteria 1171
115 Ga0207676_10084750 3300026095 Bacteria 2584
116 Ga0207674_10099926 3300026116 Bacteria 2883
117 Ga0207675_100460427 3300026118 Bacteria 1261
118 Ga0207698_10097347 3300026142 Bacteria 2428
119 Ga0209371_1001194 3300027312 Bacteria 18810
120 Ga0268266_10000003 3300028379 Bacteria 1701703
121 Ga0268266_10059097 3300028379 Bacteria 3303
122 Ga0268256_1001399 3300030500 Bacteria 14632
123 Ga0307511_10004903 3300030521 Bacteria 13656
124 Ga0265329_10055889 3300031242 Bacteria 1252
125 Ga0265340_10032326 3300031247 Bacteria 2612
126 Ga0265313_10035856 3300031595 Bacteria 2493
127 Ga0265342_10023139 3300031712 Bacteria 3938
128 Ga0265342_10066778 3300031712 Bacteria 2106
129 Ga0307406_10101519 3300031901 Bacteria 1961
130 Ga0307416_100361480 3300032002 Bacteria 1474
131 Ga0395900_0414252 3300037418 Bacteria 1309
132 Ga0395905_0001828 3300037471 Bacteria 24574
133 Ga0395905_0124433 3300037471 Bacteria 2424
134 Ga0395905_0132292 3300037471 Bacteria 2346
135 Ga0439465_0047598 3300041413 Bacteria 1398
136 Ga0451791_0892297 3300041451 Bacteria 851
137 Ga0439458_0136113 3300042157 Bacteria 653
138 Ga0466967_0123275 3300045976 Bacteria 2398
139 Ga0495638_0087168 3300046460 Bacteria 1886
140 Ga0495607_0112975 3300046501 Bacteria 1437
141 Ga0495606_0005525 3300046507 Bacteria 12066
142 Ga0495606_0060229 3300046507 Bacteria 2432
143 Ga0495610_0052147 3300046512 Bacteria 1987
144 Ga0495643_0003793 3300046522 Bacteria 10925
145 Ga0495643_0061604 3300046522 Bacteria 1989
146 Ga0495597_0142710 3300046542 Bacteria 987
147 Ga0495686_0261336 3300047472 Bacteria 969
148 Ga0496100_0015677 3300048903 Bacteria 4429
149 Ga0496101_0058983 3300048904 Bacteria 2781
150 Ga0496102_0005334 3300048905 Bacteria 10915
151 Ga0496103_0002163 3300048906 Bacteria 12495
152 Ga0496106_0000360 3300048909 Bacteria 32344
153 Ga0496107_0043274 3300048910 Bacteria 3235
154 Ga0496109_0483037 3300048912 Bacteria 1170
155 Ga0496112_0000023 3300048915 Bacteria 156144
156 Ga0496113_0032385 3300048916 Bacteria 3800
157 Ga0496115_0010526 3300048918 Bacteria 6915
158 Ga0496115_0032059 3300048918 Bacteria 4145
159 Ga0496116_0071043 3300048919 Bacteria 2206
160 Ga0496117_0003219 3300048920 Bacteria 19285
161 Ga0496117_0084960 3300048920 Bacteria 2063
162 Ga0496118_0003752 3300048921 Bacteria 18777
163 Ga0496118_0101746 3300048921 Bacteria 1939
164 Ga0496119_0009020 3300048922 Bacteria 8652
165 Ga0496119_0034980 3300048922 Bacteria 3298
166 Ga0496120_0005208 3300048923 Bacteria 10479
167 Ga0496121_0010432 3300048924 Bacteria 10481
168 Ga0496121_0023664 3300048924 Bacteria 5905
169 Ga0496121_0032835 3300048924 Bacteria 4709
170 Ga0496121_0040127 3300048924 Bacteria 4111
171 Ga0496121_0067639 3300048924 Bacteria 2894
172 Ga0496121_0069270 3300048924 Bacteria 2848
173 Ga0496121_0139880 3300048924 Bacteria 1798
174 Ga0496122_0000179 3300048925 Bacteria 149332
175 Ga0496122_0005406 3300048925 Bacteria 15240
176 Ga0496123_0000054 3300048926 Bacteria 234046
177 Ga0496123_0000305 3300048926 Bacteria 95376
178 Ga0496123_0005003 3300048926 Bacteria 13569
179 Ga0496124_0016810 3300048927 Bacteria 6934
180 Ga0496124_0031077 3300048927 Bacteria 4731
181 Ga0496124_0160630 3300048927 Unclassified 1752
182 Ga0496125_0007868 3300048928 Bacteria 11261
183 Ga0496125_0013498 3300048928 Bacteria 8025
184 Ga0496125_0075236 3300048928 Bacteria 2614
185 Ga0501032_0030962 3300049569 Bacteria 3670
186 Ga0501034_0262072 3300049571 Bacteria 1671
187 Ga0501036_0897114 3300049572 Bacteria 728
188 Ga0501043_0136895 3300049579 Bacteria 1918
189 Ga0501043_0232750 3300049579 Bacteria 1423
190 Ga0501046_0235315 3300049580 Bacteria 1352
191 Ga0501047_0511385 3300049581 Unclassified 1027
192 Ga0501067_0045444 3300049583 Bacteria 2439
193 Ga0501068_0023557 3300049584 Bacteria 3609
194 Ga0501069_0022345 3300049585 Bacteria 3440
195 Ga0501069_0065526 3300049585 Bacteria 2031
196 Ga0501071_0235613 3300049587 Bacteria 1380
197 Ga0501073_0012907 3300049589 Bacteria 6091
198 Ga0501073_0056611 3300049589 Bacteria 2742
199 Ga0501073_0445305 3300049589 Bacteria 895
200 Ga0501079_0290338 3300049741 Bacteria 1279
201 Ga0501080_0292255 3300049742 Bacteria 1479
202 Ga0501080_0382376 3300049742 Bacteria 1268
203 Ga0501083_0034289 3300049744 Bacteria 3471
204 Ga0501083_0056600 3300049744 Bacteria 2627
205 Ga0501241_014252 3300049758 Bacteria 1444
206 Ga0501035_0219241 3300049822 Bacteria 1625
207 Ga0501044_0663579 3300049823 Bacteria 931
208 nmdc:mga06z11_345401_c1 3300050494 Bacteria 890
209 nmdc:mga0sz30_31580_c1 3300050516 Bacteria 2192
210 Ga0500595_082356 3300053119 Bacteria 940
211 Ga0500618_011557 3300053125 Bacteria 2338
212 Ga0500618_025027 3300053125 Bacteria 1433
213 Ga0500658_0036300 3300053134 Bacteria 1955
214 Ga0500568_0002073 3300053139 Bacteria 12160
215 Ga0500568_0035494 3300053139 Bacteria 2034
216 Ga0500604_0126430 3300053151 Bacteria 857
217 Ga0500616_0000677 3300053153 Bacteria 39945
218 Ga0500622_0001436 3300053156 Bacteria 19116
219 Ga0500633_0004275 3300053160 Bacteria 3253
220 Ga0500636_0067880 3300053177 Bacteria 2071
221 Ga0501084_0189055 3300054114 Bacteria 1737
222 Ga0501082_0207328 3300060353 Bacteria 1705
223 2511136026 2510917022 Bacteria 6504556
224 2511171478 2510917026 Bacteria 7046020
225 2511184551 2510917028 Bacteria 6185411
226 2511193466 2510917030 Bacteria 7460662
227 2524460968 2524023209 Bacteria 6679728
228 2585227395 2582581298 Bacteria 7315509
229 2585274444 2582581307 Bacteria 6597605
230 2585282887 2582581308 Bacteria 7413247
231 2585322348 2582581315 Bacteria 7318924
232 2585335035 2582581316 Bacteria 7774528
233 2585537325 2585427527 Bacteria 7273426
234 2585550807 2585427529 Bacteria 7395659
235 2585557591 2585427530 Bacteria 7383882
236 2585560896 2585427531 Bacteria 6992870
237 2585824647 2585427590 Bacteria 6824633
238 2585903311 2585427609 Bacteria 6667127
239 2585997032 2585427633 Bacteria 6413184
240 2586001633 2585427634 Bacteria 6455027
241 2587981570 2585428125 Bacteria 6662905
242 2616307553 2615840626 Bacteria 7921970
243 2616555105 2615840698 Bacteria 7319877
244 2617384271 2617270742 Bacteria 6808054
245 2738948828 2738541317 Bacteria 5340176
246 2778176163 2775507266 Bacteria 7392367
247 2819644073 2818991453 Bacteria 7181617
248 2819685553 2818991461 Bacteria 7026071
249 2842298897 2842298080 Bacteria 6123127
250 2842359235 2842357229 Bacteria 6485165
251 2842510914 2842509118 Bacteria 6850950
252 2844534518 2844533157 Bacteria 7517899
253 2852391431 2852387548 Bacteria 8025568
254 2854900353 2854896431 Bacteria 5869725
255 2854920185 2854916844 Bacteria 5725939
256 2857534514 2857531043 Bacteria 6754041
257 2869249185 2869242130 Bacteria 6609239
258 2913313760 2913308742 Bacteria 5350706
259 2919102084 2919100787 Bacteria 7710546
260 2919173278 2919171160 Bacteria 6499771
261 3005450511 3005445848 Bacteria 6906074
262 8005682042 8005682033 Bacteria 6726518
263 8024492919 8024486573 Bacteria 6540512
264 8046773976 8046767195 Bacteria 7547379
265 8057578575 8057575449 Bacteria 7367519
266 Ga0500618_002780
267 JGI25158J39367_1000054
268 JGI25152J39213_1009939
269 JGI25150J39212_1007233
270 JGI25159J45721_1000265
271 JGI25159J45721_1002796
272 JGI25151J46595_10000321
273 JGI25153J46596_10007180
274 rootH1_10132233
275 rootH1_10138963
276 JGI25160J50197_1000006
277 JGI25160J50197_1017385
278 JGI25161J50226_1000004
279 JGI25161J50226_1000246
280 Ga0055526_1009281
281 Ga0055524_1010347
282 Ga0055536_1010826
283 Ga0055528_1004475
284 Ga0055540_1014058
285 Ga0055531_10023392
286 Ga0055543_1000002
287 Ga0055543_1000209
288 Ga0065165_1000341
289 Ga0065165_1002557
290 Ga0065165_1015712
291 Ga0070660_100028031
292 Ga0070660_100032403
293 Ga0070691_10254843
294 Ga0070687_100131248
295 Ga0070675_100429062
296 Ga0070659_100019130
297 Ga0070659_100040386
298 Ga0070681_10011646
299 Ga0070681_10035793
300 Ga0068853_100073701
301 Ga0070665_100000144
302 Ga0070665_100170174
303 Ga0068855_100038097
304 Ga0068856_100108322
305 Ga0068852_100062347
306 Ga0068861_100729102
307 Ga0068858_100237658
308 Ga0075365_10020251
309 Ga0075367_10439877
310 Ga0075370_10017983
311 Ga0105244_10194639
312 Ga0105240_10000019
313 Ga0105240_10260216
314 Ga0105240_10278558
315 Ga0105248_10072142
316 Ga0105248_10301065
317 Ga0105248_11019971
318 Ga0105237_10002268
319 Ga0105238_10022312
320 Ga0105239_10019615
321 Ga0105239_10339493
322 Ga0157370_10001984
323 Ga0157370_10100932
324 Ga0157369_10221379
325 Ga0157369_10241392
326 Ga0163162_10264417
327 Ga0163163_10092125
328 Ga0182008_10016103
329 Ga0182007_10039167
330 Ga0182005_1005616
331 Ga0209436_100203
332 Ga0209677_101170
333 Ga0209759_1033241
334 Ga0209129_1002380
335 Ga0209129_1008435
336 Ga0209129_1010052
337 Ga0209233_1000698
338 Ga0209673_1004225
339 Ga0209130_1000019
340 Ga0209130_1000032
341 Ga0209676_1015959
342 Ga0209025_1007184
343 Ga0209025_1043197
344 Ga0209564_1003805
345 Ga0209758_1000839
346 Ga0209758_1005800
347 Ga0209758_1008021
348 Ga0209758_1037954
349 Ga0209050_1003361
350 Ga0209256_1014674
351 Ga0207426_1000005
352 Ga0207426_1000077
353 Ga0207426_1000151
354 Ga0209051_1014009
355 Ga0209051_1022578
356 Ga0209257_1002359
357 Ga0207705_10001506
358 Ga0207695_10000049
359 Ga0207695_10011647
360 Ga0207695_10139366
361 Ga0207695_10233020
362 Ga0207671_10000556
363 Ga0207660_10003783
364 Ga0207657_10003177
365 Ga0207652_10007927
366 Ga0207681_10245053
367 Ga0207694_10053218
368 Ga0207659_10561898
369 Ga0207687_10109720
370 Ga0207690_10023155
371 Ga0207690_10024530
372 Ga0207709_10295865
373 Ga0207711_10001692
374 Ga0207667_10007827
375 Ga0207667_10014163
376 Ga0207651_10169447
377 Ga0207703_10655917
378 Ga0207639_10039826
379 Ga0207702_10512209
380 Ga0207676_10084750
381 Ga0207674_10099926
382 Ga0207675_100460427
383 Ga0207698_10097347
384 Ga0209371_1001194
385 Ga0268266_10000003
386 Ga0268266_10059097
387 Ga0268256_1001399
388 Ga0307511_10004903
389 Ga0265329_10055889
390 Ga0265340_10032326
391 Ga0265313_10035856
392 Ga0265342_10023139
393 Ga0265342_10066778
394 Ga0307406_10101519
395 Ga0307416_100361480
396 Ga0395900_0414252
397 Ga0395905_0001828
398 Ga0395905_0124433
399 Ga0395905_0132292
400 Ga0439465_0047598
401 Ga0451791_0892297
402 Ga0439458_0136113
403 Ga0466967_0123275
404 Ga0495638_0087168
405 Ga0495607_0112975
406 Ga0495606_0005525
407 Ga0495606_0060229
408 Ga0495610_0052147
409 Ga0495643_0003793
410 Ga0495643_0061604
411 Ga0495597_0142710
412 Ga0495686_0261336
413 Ga0496100_0015677
414 Ga0496101_0058983
415 Ga0496102_0005334
416 Ga0496103_0002163
417 Ga0496106_0000360
418 Ga0496107_0043274
419 Ga0496109_0483037
420 Ga0496112_0000023
421 Ga0496113_0032385
422 Ga0496115_0010526
423 Ga0496115_0032059
424 Ga0496116_0071043
425 Ga0496117_0003219
426 Ga0496117_0084960
427 Ga0496118_0003752
428 Ga0496118_0101746
429 Ga0496119_0009020
430 Ga0496119_0034980
431 Ga0496120_0005208
432 Ga0496121_0010432
433 Ga0496121_0023664
434 Ga0496121_0032835
435 Ga0496121_0040127
436 Ga0496121_0067639
437 Ga0496121_0069270
438 Ga0496121_0139880
439 Ga0496122_0000179
440 Ga0496122_0005406
441 Ga0496123_0000054
442 Ga0496123_0000305
443 Ga0496123_0005003
444 Ga0496124_0016810
445 Ga0496124_0031077
446 Ga0496124_0160630
447 Ga0496125_0007868
448 Ga0496125_0013498
449 Ga0496125_0075236
450 Ga0501032_0030962
451 Ga0501034_0262072
452 Ga0501036_0897114
453 Ga0501043_0136895
454 Ga0501043_0232750
455 Ga0501046_0235315
456 Ga0501047_0511385
457 Ga0501067_0045444
458 Ga0501068_0023557
459 Ga0501069_0022345
460 Ga0501069_0065526
461 Ga0501071_0235613
462 Ga0501073_0012907
463 Ga0501073_0056611
464 Ga0501073_0445305
465 Ga0501079_0290338
466 Ga0501080_0292255
467 Ga0501080_0382376
468 Ga0501083_0034289
469 Ga0501083_0056600
470 Ga0501241_014252
471 Ga0501035_0219241
472 Ga0501044_0663579
473 nmdc:mga06z11_345401_c1
474 nmdc:mga0sz30_31580_c1
475 Ga0500595_082356
476 Ga0500618_011557
477 Ga0500618_025027
478 Ga0500658_0036300
479 Ga0500568_0002073
480 Ga0500568_0035494
481 Ga0500604_0126430
482 Ga0500616_0000677
483 Ga0500622_0001436
484 Ga0500633_0004275
485 Ga0500636_0067880
486 Ga0501084_0189055
487 Ga0501082_0207328
488 2511136026
489 2511171478
490 2511184551
491 2511193466
492 2524460968
493 2585227395
494 2585274444
495 2585282887
496 2585322348
497 2585335035
498 2585537325
499 2585550807
500 2585557591
501 2585560896
502 2585824647
503 2585903311
504 2585997032
505 2586001633
506 2587981570
507 2616307553
508 2616555105
509 2617384271
510 2738948828
511 2778176163
512 2819644073
513 2819685553
514 2842298897
515 2842359235
516 2842510914
517 2844534518
518 2852391431
519 2854900353
520 2854920185
521 2857534514
522 2869249185
523 2913313760
524 2919102084
525 2919173278
526 3005450511
527 8005682042
528 8024492919
529 8046773976
530 8057578575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

43

272

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.8978 5 241
4u2f-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-1 variant (q35h, f38l, y64h, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.80 a resolution 0.8972 5 240
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.896 5 241
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.8948 5 241
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.8947 5 241
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9613 3 240 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9495 3 240 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9036 15 244 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8997 2 244 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8978 5 241 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A444KMS9-F1-model_v4 Dienelactone hydrolase family protein 0.9913 141 245 GO:0016787
AF-A0A1B3EAV5-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.989 129 243 GO:0016787
AF-A0A1C3UCY3-F1-model_v4 Carboxymethylenebutenolidase 0.9877 1 245 GO:0016787
AF-A0A526RRU4-F1-model_v4 Dienelactone hydrolase family protein 0.9877 50 245 GO:0016787
AF-A0A330GXW7-F1-model_v4 Dienelactone hydrolase family protein 0.9872 1 245 GO:0016787

Map