F373504

General Info

Members Datasets Scaffolds Average Seq Length
265 130 265 256

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0074455|Ga0453683_0074455_1160_2065
Length 301
Sequence MMRVVETVDVRQRVLDAVGRAIGRFSMLAPGDRVAVGVSGGKDSWCLLHALVAYRRRAPFPYDVVAVTIEQGKFKSAIGALESRIRELGVEWIVRADPSTLGLVAGGVAHGCDVCSRHRRRTLYRVAAERGCTVLALGHTADDCAESLLRNILFNGRIASLPPVARSRKGGLRLIRPLAFVTEDQTTAYAQALGLPTIGCVCGDRDGVRRELRAFLAGLRERHAGIPESIAAALGNVNPYTLHLRGGLDRSTSGSTPRPDRAELADHGDEPEDRCSPEERHEDDEKEALRIAKRLRARPVR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010405 3300003203 Bacteria 4130
2 Ga0070670_100518305 3300005331 Unclassified 1061
3 Ga0070666_10023445 3300005335 Bacteria 4018
4 Ga0068868_100024652 3300005338 Bacteria 4568
5 Ga0070689_100005584 3300005340 Bacteria 8605
6 Ga0070661_100015584 3300005344 Bacteria 5365
7 Ga0070675_100013995 3300005354 Bacteria 6316
8 Ga0070675_100014717 3300005354 Bacteria 6172
9 Ga0070671_100257622 3300005355 Unclassified 1482
10 Ga0070673_100001825 3300005364 Bacteria 12719
11 Ga0070673_100087081 3300005364 Bacteria 2545
12 Ga0070667_100030719 3300005367 Bacteria 4480
13 Ga0070700_100474632 3300005441 Bacteria 957
14 Ga0070708_100014096 3300005445 Bacteria 6571
15 Ga0070708_100014628 3300005445 Bacteria 6463
16 Ga0070708_100305345 3300005445 Bacteria 1498
17 Ga0070678_100591047 3300005456 Bacteria 990
18 Ga0070678_100607040 3300005456 Bacteria 977
19 Ga0068867_100239191 3300005459 Bacteria 1471
20 Ga0068867_100504917 3300005459 Bacteria 1040
21 Ga0070706_100019756 3300005467 Bacteria 6214
22 Ga0070706_100034830 3300005467 Bacteria 4649
23 Ga0070706_100181896 3300005467 Bacteria 1963
24 Ga0070707_100000453 3300005468 Bacteria 40597
25 Ga0070707_100007895 3300005468 Bacteria 9879
26 Ga0070707_100309467 3300005468 Bacteria 1535
27 Ga0070699_100016859 3300005518 Bacteria 6271
28 Ga0070699_100073783 3300005518 Bacteria 2968
29 Ga0070699_100263072 3300005518 Unclassified 1543
30 Ga0070699_100343271 3300005518 Bacteria 1344
31 Ga0070699_100545982 3300005518 Bacteria 1055
32 Ga0070697_100065496 3300005536 Bacteria 2969
33 Ga0070695_100009356 3300005545 Bacteria 5829
34 Ga0070696_100152560 3300005546 Bacteria 1697
35 Ga0070696_100218094 3300005546 Bacteria 1430
36 Ga0070704_100013642 3300005549 Bacteria 5052
37 Ga0070704_100029643 3300005549 Bacteria 3657
38 Ga0070664_100000508 3300005564 Bacteria 29520
39 Ga0068859_100000468 3300005617 Bacteria 39887
40 Ga0068859_100006868 3300005617 Bacteria 11557
41 Ga0068859_100159736 3300005617 Bacteria 2333
42 Ga0068859_100541024 3300005617 Bacteria 1259
43 Ga0068864_100029316 3300005618 Bacteria 4659
44 Ga0068864_100364951 3300005618 Unclassified 1365
45 Ga0068863_100000307 3300005841 Bacteria 50304
46 Ga0068863_100263541 3300005841 Bacteria 1666
47 Ga0068863_100352936 3300005841 Bacteria 1432
48 Ga0068863_100443153 3300005841 Bacteria 1274
49 Ga0068858_100043188 3300005842 Bacteria 4179
50 Ga0068858_100735310 3300005842 Bacteria 961
51 Ga0068860_100008532 3300005843 Bacteria 10210
52 Ga0068862_100265296 3300005844 Bacteria 1569
53 Ga0081455_10150750 3300005937 Bacteria 1793
54 Ga0081539_10000083 3300005985 Bacteria 218881
55 Ga0097621_100227903 3300006237 Bacteria 1626
56 Ga0075428_100008504 3300006844 Bacteria 11384
57 Ga0075428_100024419 3300006844 Bacteria 6689
58 Ga0075428_100033642 3300006844 Bacteria 5658
59 Ga0075428_100073392 3300006844 Bacteria 3737
60 Ga0075430_100006569 3300006846 Bacteria 9809
61 Ga0075430_100017389 3300006846 Bacteria 6125
62 Ga0075430_100106148 3300006846 Bacteria 2343
63 Ga0075430_100326632 3300006846 Bacteria 1268
64 Ga0075431_100000637 3300006847 Bacteria 29659
65 Ga0075431_100008529 3300006847 Bacteria 10263
66 Ga0075431_100013139 3300006847 Bacteria 8366
67 Ga0075431_100022702 3300006847 Bacteria 6413
68 Ga0075431_100023502 3300006847 Bacteria 6307
69 Ga0075431_100253770 3300006847 Bacteria 1786
70 Ga0075431_100261522 3300006847 Bacteria 1756
71 Ga0075431_100290278 3300006847 Bacteria 1655
72 Ga0075433_10018149 3300006852 Bacteria 5843
73 Ga0075433_10257459 3300006852 Bacteria 1548
74 Ga0075433_10460593 3300006852 Bacteria 1120
75 Ga0075434_100299790 3300006871 Bacteria 1628
76 Ga0075434_100377726 3300006871 Bacteria 1438
77 Ga0075434_100409169 3300006871 Bacteria 1378
78 Ga0075429_100005160 3300006880 Bacteria 11233
79 Ga0075429_100009543 3300006880 Bacteria 8418
80 Ga0075429_100048285 3300006880 Bacteria 3701
81 Ga0075429_100059901 3300006880 Bacteria 3317
82 Ga0068865_100225536 3300006881 Bacteria 1467
83 Ga0075436_100000874 3300006914 Bacteria 20002
84 Ga0075436_100269323 3300006914 Bacteria 1216
85 Ga0097620_100000468 3300006931 Bacteria 39887
86 Ga0097620_100006868 3300006931 Bacteria 11557
87 Ga0097620_100159743 3300006931 Bacteria 2333
88 Ga0097620_100541026 3300006931 Bacteria 1259
89 Ga0075435_100054276 3300007076 Bacteria 3234
90 Ga0075435_100177119 3300007076 Unclassified 1801
91 Ga0075435_100217535 3300007076 Bacteria 1622
92 Ga0099794_10014090 3300007265 Bacteria 3496
93 Ga0111539_10083078 3300009094 Bacteria 3767
94 Ga0111539_10129683 3300009094 Bacteria 2953
95 Ga0111539_10662142 3300009094 Bacteria 1216
96 Ga0105247_10041650 3300009101 Bacteria 2811
97 Ga0114129_10001255 3300009147 Bacteria 33858
98 Ga0114129_10002729 3300009147 Bacteria 24610
99 Ga0114129_10003560 3300009147 Bacteria 21926
100 Ga0114129_10006857 3300009147 Bacteria 16191
101 Ga0114129_10023640 3300009147 Bacteria 8710
102 Ga0114129_10044132 3300009147 Bacteria 6271
103 Ga0114129_10044219 3300009147 Bacteria 6265
104 Ga0114129_10060229 3300009147 Bacteria 5308
105 Ga0114129_10082506 3300009147 Bacteria 4467
106 Ga0114129_10334465 3300009147 Unclassified 2010
107 Ga0105243_10250004 3300009148 Bacteria 1582
108 Ga0105241_10429217 3300009174 Bacteria 1165
109 Ga0105242_10227751 3300009176 Unclassified 1669
110 Ga0105248_10000090 3300009177 Bacteria 101891
111 Ga0105248_10001944 3300009177 Bacteria 22950
112 Ga0157378_10087855 3300013297 Bacteria 2820
113 Ga0157378_10250342 3300013297 Bacteria 1696
114 Ga0163162_10006636 3300013306 Bacteria 11216
115 Ga0163162_10024873 3300013306 Bacteria 5914
116 Ga0163162_10414730 3300013306 Bacteria 1479
117 Ga0157375_10000860 3300013308 Bacteria 26402
118 Ga0157375_10056962 3300013308 Bacteria 3862
119 Ga0163163_10006058 3300014325 Bacteria 10519
120 Ga0163163_10300237 3300014325 Bacteria 1658
121 Ga0163163_10305588 3300014325 Bacteria 1643
122 Ga0157380_10179184 3300014326 Bacteria 1860
123 Ga0157380_10252419 3300014326 Bacteria 1597
124 Ga0157377_10057349 3300014745 Bacteria 2214
125 Ga0157379_10000365 3300014968 Bacteria 36359
126 Ga0157376_10118136 3300014969 Bacteria 2346
127 Ga0157376_10635558 3300014969 Bacteria 1066
128 Ga0207653_10026939 3300025885 Bacteria 1844
129 Ga0207710_10128255 3300025900 Bacteria 1217
130 Ga0207680_10020783 3300025903 Bacteria 3542
131 Ga0207684_10005590 3300025910 Bacteria 11573
132 Ga0207646_10000948 3300025922 Bacteria 37329
133 Ga0207646_10117365 3300025922 Unclassified 2390
134 Ga0207646_10157065 3300025922 Bacteria 2052
135 Ga0207681_10197543 3300025923 Bacteria 1543
136 Ga0207681_10651720 3300025923 Bacteria 873
137 Ga0207659_10010446 3300025926 Bacteria 5836
138 Ga0207659_10027525 3300025926 Bacteria 3850
139 Ga0207659_10310751 3300025926 Bacteria 1298
140 Ga0207659_10545230 3300025926 Bacteria 985
141 Ga0207644_10055005 3300025931 Bacteria 2868
142 Ga0207670_10047543 3300025936 Bacteria 2859
143 Ga0207670_10157762 3300025936 Bacteria 1690
144 Ga0207704_10628425 3300025938 Unclassified 882
145 Ga0207711_10053293 3300025941 Bacteria 3469
146 Ga0207679_10018186 3300025945 Bacteria 4704
147 Ga0207651_10011976 3300025960 Bacteria 4882
148 Ga0207651_10302830 3300025960 Unclassified 1330
149 Ga0207658_10034565 3300025986 Bacteria 3613
150 Ga0207658_10098268 3300025986 Bacteria 2287
151 Ga0207703_10007529 3300026035 Bacteria 8639
152 Ga0207703_10109644 3300026035 Bacteria 2353
153 Ga0207648_10184663 3300026089 Unclassified 1847
154 Ga0207648_10773138 3300026089 Unclassified 893
155 Ga0207676_10134495 3300026095 Bacteria 2107
156 Ga0207675_100012956 3300026118 Bacteria 7787
157 Ga0207675_100211980 3300026118 Bacteria 1863
158 Ga0209983_1053835 3300027665 Bacteria 883
159 Ga0268264_10006064 3300028381 Bacteria 10213
160 Ga0307408_100039345 3300031548 Unclassified 3342
161 Ga0307416_100828863 3300032002 Unclassified 1022
162 Ga0307415_100366693 3300032126 Bacteria 1218
163 Ga0373952_0053617 3300035092 Bacteria 968
164 Ga0373947_0401446 3300035725 Bacteria 925
165 Ga0373937_0008123 3300036401 Bacteria 9110
166 Ga0373937_0069353 3300036401 Bacteria 3251
167 Ga0373937_0364337 3300036401 Bacteria 1370
168 Ga0373937_0390860 3300036401 Bacteria 1319
169 Ga0395901_0550134 3300038443 Bacteria 1170
170 Ga0453683_0074455 3300044673 Bacteria 2126
171 Ga0495592_0144854 3300046454 Bacteria 1648
172 Ga0495664_0178215 3300046477 Bacteria 1289
173 Ga0495608_0197265 3300046511 Bacteria 1269
174 Ga0495618_0113124 3300046514 Unclassified 1738
175 Ga0495630_0328254 3300046517 Bacteria 1170
176 Ga0495667_0004456 3300046559 Bacteria 9444
177 Ga0495657_0006819 3300046675 Bacteria 8890
178 Ga0495599_0087243 3300046678 Bacteria 1948
179 Ga0495613_0431471 3300046689 Bacteria 895
180 Ga0495674_0519734 3300047319 Unclassified 950
181 Ga0495684_0403316 3300047471 Bacteria 959
182 Ga0501031_0159648 3300049568 Bacteria 1474
183 Ga0501036_0454413 3300049572 Unclassified 1067
184 Ga0501038_0198173 3300049574 Bacteria 1613
185 Ga0501040_0009726 3300049576 Bacteria 6275
186 Ga0501040_0009788 3300049576 Bacteria 6257
187 Ga0501041_0019183 3300049577 Bacteria 4080
188 Ga0501041_0317463 3300049577 Unclassified 983
189 Ga0501042_0021117 3300049578 Bacteria 4534
190 Ga0501042_0148843 3300049578 Bacteria 1688
191 Ga0501043_0204094 3300049579 Bacteria 1533
192 Ga0501046_0181995 3300049580 Bacteria 1571
193 Ga0501067_0005840 3300049583 Bacteria 6826
194 Ga0501068_0289729 3300049584 Unclassified 1047
195 Ga0501069_0014057 3300049585 Bacteria 4276
196 Ga0501071_0101056 3300049587 Bacteria 2126
197 Ga0501072_0015142 3300049588 Bacteria 5915
198 Ga0501074_0167404 3300049590 Bacteria 1569
199 Ga0501075_0000871 3300049591 Bacteria 19094
200 Ga0501076_0013399 3300049592 Bacteria 6148
201 Ga0501076_0194000 3300049592 Bacteria 1658
202 Ga0501076_0200857 3300049592 Bacteria 1628
203 Ga0501077_0181454 3300049593 Bacteria 1338
204 Ga0501079_0062622 3300049741 Bacteria 2869
205 Ga0501079_0176869 3300049741 Bacteria 1664
206 Ga0501080_0125153 3300049742 Bacteria 2381
207 Ga0501080_0491907 3300049742 Unclassified 1097
208 Ga0501081_0007836 3300049743 Bacteria 6925
209 Ga0501081_0021805 3300049743 Bacteria 4279
210 Ga0501081_0038075 3300049743 Bacteria 3284
211 Ga0501081_0295902 3300049743 Bacteria 1187
212 Ga0501083_0099232 3300049744 Bacteria 1921
213 Ga0501045_0015501 3300049824 Bacteria 5407
214 Ga0501045_0303053 3300049824 Bacteria 1189
215 nmdc:mga05p37_1115_c1 3300050507 Bacteria 30862
216 nmdc:mga05p37_131777_c1 3300050507 Bacteria 3067
217 nmdc:mga05p37_158932_c1 3300050507 Bacteria 2761
218 nmdc:mga05p37_277392_c1 3300050507 Bacteria 2001
219 nmdc:mga05p37_29365_c1 3300050507 Bacteria 6711
220 nmdc:mga05p37_31077_c1 3300050507 Bacteria 6521
221 nmdc:mga05p37_3527_c1 3300050507 Bacteria 18262
222 nmdc:mga05p37_71147_c1 3300050507 Bacteria 4279
223 nmdc:mga05p37_8809_c1 3300050507 Bacteria 10240
224 nmdc:mga09592_101726_c1 3300050508 Unclassified 2462
225 nmdc:mga09592_3942_c1 3300050508 Bacteria 11955
226 nmdc:mga09592_49643_c1 3300050508 Bacteria 3538
227 nmdc:mga09592_55486_c1 3300050508 Bacteria 3348
228 nmdc:mga09592_73303_c1 3300050508 Bacteria 2909
229 nmdc:mga09592_80135_c1 3300050508 Bacteria 2780
230 nmdc:mga0qj67_172186_c1 3300050509 Unclassified 1758
231 nmdc:mga0qj67_300269_c1 3300050509 Bacteria 1301
232 nmdc:mga0qj67_3993_c1 3300050509 Bacteria 10680
233 nmdc:mga0qj67_46131_c1 3300050509 Bacteria 3440
234 nmdc:mga06r32_11246_c1 3300050510 Bacteria 8062
235 nmdc:mga06r32_155710_c1 3300050510 Bacteria 2266
236 nmdc:mga06r32_264102_c1 3300050510 Bacteria 1709
237 nmdc:mga06r32_36139_c2 3300050510 Bacteria 4072
238 nmdc:mga06r32_389354_c1 3300050510 Bacteria 1376
239 nmdc:mga06r32_419399_c1 3300050510 Bacteria 1320
240 nmdc:mga06r32_42370_c1 3300050510 Bacteria 4328
241 nmdc:mga06r32_45976_c1 3300050510 Bacteria 4164
242 nmdc:mga06r32_496348_c1 3300050510 Bacteria 1198
243 nmdc:mga06r32_553925_c1 3300050510 Bacteria 1124
244 nmdc:mga06r32_65954_c1 3300050510 Bacteria 3493
245 nmdc:mga08y16_5632_c1 3300050511 Bacteria 13120
246 nmdc:mga0n895_1025_c1 3300050512 Bacteria 5779
247 nmdc:mga0n895_40316_c1 3300050512 Bacteria 4535
248 nmdc:mga0n895_64605_c1 3300050512 Bacteria 3620
249 nmdc:mga0n895_66985_c1 3300050512 Unclassified 3555
250 nmdc:mga0rr50_238133_c1 3300050513 Bacteria 1508
251 nmdc:mga0rr50_330135_c1 3300050513 Unclassified 1280
252 nmdc:mga0rr50_35253_c1 3300050513 Bacteria 3592
253 nmdc:mga08x19_76943_c1 3300050514 Bacteria 2185
254 nmdc:mga0a205_14506_c1 3300050515 Bacteria 7352
255 nmdc:mga0a205_337505_c1 3300050515 Unclassified 1376
256 nmdc:mga0a205_44366_c1 3300050515 Bacteria 4285
257 nmdc:mga0a205_71686_c1 3300050515 Bacteria 3347
258 Ga0501084_0016194 3300054114 Bacteria 6192
259 Ga0501084_0534201 3300054114 Unclassified 991
260 Ga0501082_0009386 3300060353 Bacteria 8423
261 Ga0501082_0011354 3300060353 Bacteria 7659
262 Ga0501082_0358314 3300060353 Bacteria 1272
263 Ga0501082_0470670 3300060353 Bacteria 1098
264 Ga0530510_0071024 3300061734 Bacteria 2527
265 Ga0530510_0366616 3300061734 Unclassified 1083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10041650 Ga0105247_100416501 234
2 3300009174 Ga0105241_10429217 Ga0105241_104292171 234
3 3300014326 Ga0157380_10179184 Ga0157380_101791841 234
4 3300005459 Ga0068867_100239191 Ga0068867_1002391912 235
5 3300049578 Ga0501042_0021117 Ga0501042_0021117_3229_3957 239
6 3300049574 Ga0501038_0198173 Ga0501038_0198173_555_1334 243
7 3300049576 Ga0501040_0009788 Ga0501040_0009788_2273_3052 243
8 3300049577 Ga0501041_0317463 Ga0501041_0317463_30_809 243
9 3300049578 Ga0501042_0148843 Ga0501042_0148843_329_1108 243
10 3300036401 Ga0373937_0364337 Ga0373937_0364337_234_986 244
11 3300005331 Ga0070670_100518305 Ga0070670_1005183051 245
12 3300005335 Ga0070666_10023445 Ga0070666_100234453 245
13 3300005338 Ga0068868_100024652 Ga0068868_1000246523 245
14 3300005340 Ga0070689_100005584 Ga0070689_1000055849 245
15 3300005344 Ga0070661_100015584 Ga0070661_1000155843 245
16 3300005354 Ga0070675_100013995 Ga0070675_1000139954 245
17 3300005355 Ga0070671_100257622 Ga0070671_1002576222 245
18 3300005364 Ga0070673_100001825 Ga0070673_1000018259 245
19 3300005364 Ga0070673_100087081 Ga0070673_1000870812 245
20 3300005367 Ga0070667_100030719 Ga0070667_1000307191 245
21 3300005456 Ga0070678_100591047 Ga0070678_1005910471 245
22 3300005456 Ga0070678_100607040 Ga0070678_1006070401 245
23 3300005459 Ga0068867_100504917 Ga0068867_1005049171 245
24 3300005518 Ga0070699_100343271 Ga0070699_1003432712 245
25 3300005564 Ga0070664_100000508 Ga0070664_1000005087 245
26 3300005617 Ga0068859_100000468 Ga0068859_10000046824 245
27 3300005617 Ga0068859_100006868 Ga0068859_1000068684 245
28 3300005618 Ga0068864_100029316 Ga0068864_1000293162 245
29 3300005618 Ga0068864_100364951 Ga0068864_1003649512 245
30 3300005841 Ga0068863_100000307 Ga0068863_10000030742 245
31 3300005841 Ga0068863_100352936 Ga0068863_1003529362 245
32 3300005841 Ga0068863_100443153 Ga0068863_1004431532 245
33 3300005842 Ga0068858_100043188 Ga0068858_1000431885 245
34 3300005842 Ga0068858_100735310 Ga0068858_1007353101 245
35 3300005843 Ga0068860_100008532 Ga0068860_1000085328 245
36 3300006237 Ga0097621_100227903 Ga0097621_1002279032 245
37 3300006871 Ga0075434_100299790 Ga0075434_1002997901 245
38 3300006881 Ga0068865_100225536 Ga0068865_1002255362 245
39 3300006931 Ga0097620_100000468 Ga0097620_10000046814 245
40 3300006931 Ga0097620_100006868 Ga0097620_1000068689 245
41 3300009147 Ga0114129_10001255 Ga0114129_1000125528 245
42 3300009177 Ga0105248_10001944 Ga0105248_100019445 245
43 3300013306 Ga0163162_10006636 Ga0163162_1000663610 245
44 3300013308 Ga0157375_10056962 Ga0157375_100569624 245
45 3300014325 Ga0163163_10006058 Ga0163163_100060584 245
46 3300014325 Ga0163163_10300237 Ga0163163_103002372 245
47 3300014326 Ga0157380_10252419 Ga0157380_102524191 245
48 3300014969 Ga0157376_10118136 Ga0157376_101181362 245
49 3300014969 Ga0157376_10635558 Ga0157376_106355581 245
50 3300025903 Ga0207680_10020783 Ga0207680_100207833 245
51 3300025923 Ga0207681_10197543 Ga0207681_101975431 245
52 3300025923 Ga0207681_10651720 Ga0207681_106517201 245
53 3300025926 Ga0207659_10027525 Ga0207659_100275253 245
54 3300025926 Ga0207659_10310751 Ga0207659_103107511 245
55 3300025931 Ga0207644_10055005 Ga0207644_100550053 245
56 3300025936 Ga0207670_10047543 Ga0207670_100475432 245
57 3300025938 Ga0207704_10628425 Ga0207704_106284252 245
58 3300025941 Ga0207711_10053293 Ga0207711_100532934 245
59 3300025945 Ga0207679_10018186 Ga0207679_100181863 245
60 3300025960 Ga0207651_10011976 Ga0207651_100119761 245
61 3300025960 Ga0207651_10302830 Ga0207651_103028301 245
62 3300025986 Ga0207658_10034565 Ga0207658_100345652 245
63 3300025986 Ga0207658_10098268 Ga0207658_100982681 245
64 3300026035 Ga0207703_10007529 Ga0207703_100075292 245
65 3300026035 Ga0207703_10109644 Ga0207703_101096443 245
66 3300026089 Ga0207648_10184663 Ga0207648_101846632 245
67 3300026089 Ga0207648_10773138 Ga0207648_107731381 245
68 3300026095 Ga0207676_10134495 Ga0207676_101344952 245
69 3300026118 Ga0207675_100211980 Ga0207675_1002119801 245
70 3300028381 Ga0268264_10006064 Ga0268264_100060646 245
71 3300035725 Ga0373947_0401446 Ga0373947_0401446_81_836 245
72 3300036401 Ga0373937_0008123 Ga0373937_0008123_6909_7667 245
73 3300036401 Ga0373937_0069353 Ga0373937_0069353_96_854 245
74 3300036401 Ga0373937_0390860 Ga0373937_0390860_148_906 245
75 3300046454 Ga0495592_0144854 Ga0495592_0144854_649_1407 245
76 3300046477 Ga0495664_0178215 Ga0495664_0178215_41_799 245
77 3300046511 Ga0495608_0197265 Ga0495608_0197265_309_1067 245
78 3300046514 Ga0495618_0113124 Ga0495618_0113124_340_1098 245
79 3300046517 Ga0495630_0328254 Ga0495630_0328254_17_775 245
80 3300046559 Ga0495667_0004456 Ga0495667_0004456_8489_9247 245
81 3300046675 Ga0495657_0006819 Ga0495657_0006819_7852_8610 245
82 3300046678 Ga0495599_0087243 Ga0495599_0087243_719_1477 245
83 3300046689 Ga0495613_0431471 Ga0495613_0431471_127_885 245
84 3300047319 Ga0495674_0519734 Ga0495674_0519734_147_905 245
85 3300047471 Ga0495684_0403316 Ga0495684_0403316_150_908 245
86 3300050507 nmdc:mga05p37_8809_c1 nmdc:mga05p37_8809_c1_8992_9807 245
87 3300050511 nmdc:mga08y16_5632_c1 nmdc:mga08y16_5632_c1_3852_4601 245
88 3300050512 nmdc:mga0n895_40316_c1 nmdc:mga0n895_40316_c1_708_1523 245
89 3300050515 nmdc:mga0a205_14506_c1 nmdc:mga0a205_14506_c1_5571_6386 245
90 3300005354 Ga0070675_100014717 Ga0070675_1000147175 246
91 3300009176 Ga0105242_10227751 Ga0105242_102277511 246
92 3300009177 Ga0105248_10000090 Ga0105248_1000009021 246
93 3300013297 Ga0157378_10087855 Ga0157378_100878553 246
94 3300013297 Ga0157378_10250342 Ga0157378_102503422 246
95 3300013306 Ga0163162_10024873 Ga0163162_100248735 246
96 3300013308 Ga0157375_10000860 Ga0157375_100008606 246
97 3300014745 Ga0157377_10057349 Ga0157377_100573492 246
98 3300014968 Ga0157379_10000365 Ga0157379_1000036521 246
99 3300025926 Ga0207659_10010446 Ga0207659_100104462 246
100 3300005468 Ga0070707_100000453 Ga0070707_1000004533 247
101 3300005518 Ga0070699_100545982 Ga0070699_1005459822 247
102 3300005546 Ga0070696_100152560 Ga0070696_1001525602 247
103 3300025922 Ga0207646_10117365 Ga0207646_101173652 247
104 3300049572 Ga0501036_0454413 Ga0501036_0454413_56_811 247
105 3300061734 Ga0530510_0366616 Ga0530510_0366616_108_860 247
106 3300006847 Ga0075431_100022702 Ga0075431_1000227026 248
107 3300006852 Ga0075433_10257459 Ga0075433_102574592 248
108 3300006852 Ga0075433_10460593 Ga0075433_104605932 248
109 3300006871 Ga0075434_100377726 Ga0075434_1003777261 248
110 3300006914 Ga0075436_100269323 Ga0075436_1002693232 248
111 3300007076 Ga0075435_100217535 Ga0075435_1002175352 248
112 3300009094 Ga0111539_10083078 Ga0111539_100830784 248
113 3300009094 Ga0111539_10662142 Ga0111539_106621421 248
114 3300009147 Ga0114129_10023640 Ga0114129_100236406 248
115 3300009147 Ga0114129_10060229 Ga0114129_100602293 248
116 3300009147 Ga0114129_10082506 Ga0114129_100825064 248
117 3300014325 Ga0163163_10305588 Ga0163163_103055881 248
118 3300025926 Ga0207659_10545230 Ga0207659_105452301 248
119 3300049592 Ga0501076_0194000 Ga0501076_0194000_145_903 248
120 3300049743 Ga0501081_0021805 Ga0501081_0021805_329_1180 248
121 3300050507 nmdc:mga05p37_277392_c1 nmdc:mga05p37_277392_c1_876_1622 248
122 3300050507 nmdc:mga05p37_31077_c1 nmdc:mga05p37_31077_c1_2303_3070 248
123 3300050508 nmdc:mga09592_101726_c1 nmdc:mga09592_101726_c1_717_1484 248
124 3300050508 nmdc:mga09592_80135_c1 nmdc:mga09592_80135_c1_124_870 248
125 3300050510 nmdc:mga06r32_42370_c1 nmdc:mga06r32_42370_c1_1896_2642 248
126 3300050512 nmdc:mga0n895_64605_c1 nmdc:mga0n895_64605_c1_1232_2023 248
127 3300050512 nmdc:mga0n895_66985_c1 nmdc:mga0n895_66985_c1_2601_3368 248
128 3300050513 nmdc:mga0rr50_238133_c1 nmdc:mga0rr50_238133_c1_327_1094 248
129 3300050515 nmdc:mga0a205_44366_c1 nmdc:mga0a205_44366_c1_2733_3479 248
130 3300006847 Ga0075431_100290278 Ga0075431_1002902782 249
131 3300035092 Ga0373952_0053617 Ga0373952_0053617_132_914 249
132 3300050507 nmdc:mga05p37_131777_c1 nmdc:mga05p37_131777_c1_34_843 249
133 3300050510 nmdc:mga06r32_389354_c1 nmdc:mga06r32_389354_c1_215_985 249
134 3300050510 nmdc:mga06r32_496348_c1 nmdc:mga06r32_496348_c1_33_791 249
135 3300005445 Ga0070708_100014096 Ga0070708_1000140964 250
136 3300005467 Ga0070706_100019756 Ga0070706_1000197566 250
137 3300005549 Ga0070704_100029643 Ga0070704_1000296432 250
138 3300007076 Ga0075435_100177119 Ga0075435_1001771192 250
139 3300009147 Ga0114129_10334465 Ga0114129_103344652 250
140 3300025922 Ga0207646_10157065 Ga0207646_101570653 250
141 3300050510 nmdc:mga06r32_553925_c1 nmdc:mga06r32_553925_c1_254_1024 250
142 3300050513 nmdc:mga0rr50_330135_c1 nmdc:mga0rr50_330135_c1_202_1020 250
143 3300013306 Ga0163162_10414730 Ga0163162_104147301 251
144 3300005545 Ga0070695_100009356 Ga0070695_1000093563 252
145 3300009148 Ga0105243_10250004 Ga0105243_102500042 252
146 3300025885 Ga0207653_10026939 Ga0207653_100269393 252
147 3300032126 Ga0307415_100366693 Ga0307415_1003666931 252
148 3300005445 Ga0070708_100014628 Ga0070708_1000146284 253
149 3300005445 Ga0070708_100305345 Ga0070708_1003053452 253
150 3300005467 Ga0070706_100034830 Ga0070706_1000348303 253
151 3300005467 Ga0070706_100181896 Ga0070706_1001818962 253
152 3300005468 Ga0070707_100007895 Ga0070707_1000078958 253
153 3300005468 Ga0070707_100309467 Ga0070707_1003094672 253
154 3300005518 Ga0070699_100016859 Ga0070699_1000168595 253
155 3300005518 Ga0070699_100073783 Ga0070699_1000737832 253
156 3300005518 Ga0070699_100263072 Ga0070699_1002630724 253
157 3300005536 Ga0070697_100065496 Ga0070697_1000654962 253
158 3300006844 Ga0075428_100024419 Ga0075428_1000244194 253
159 3300006846 Ga0075430_100326632 Ga0075430_1003266322 253
160 3300006847 Ga0075431_100008529 Ga0075431_1000085296 253
161 3300006871 Ga0075434_100409169 Ga0075434_1004091692 253
162 3300006880 Ga0075429_100048285 Ga0075429_1000482852 253
163 3300007265 Ga0099794_10014090 Ga0099794_100140902 253
164 3300009147 Ga0114129_10006857 Ga0114129_100068575 253
165 3300009147 Ga0114129_10044132 Ga0114129_100441326 253
166 3300025910 Ga0207684_10005590 Ga0207684_100055906 253
167 3300025922 Ga0207646_10000948 Ga0207646_100009483 253
168 3300038443 Ga0395901_0550134 Ga0395901_0550134_45_875 253
169 3300049580 Ga0501046_0181995 Ga0501046_0181995_688_1464 253
170 3300049593 Ga0501077_0181454 Ga0501077_0181454_401_1174 253
171 3300050507 nmdc:mga05p37_29365_c1 nmdc:mga05p37_29365_c1_4905_5666 253
172 3300050508 nmdc:mga09592_73303_c1 nmdc:mga09592_73303_c1_1015_1776 253
173 3300050509 nmdc:mga0qj67_300269_c1 nmdc:mga0qj67_300269_c1_88_849 253
174 3300050510 nmdc:mga06r32_45976_c1 nmdc:mga06r32_45976_c1_936_1697 253
175 3300003203 JGI25406J46586_10010405 JGI25406J46586_100104053 254
176 3300005441 Ga0070700_100474632 Ga0070700_1004746321 254
177 3300005546 Ga0070696_100218094 Ga0070696_1002180942 254
178 3300005549 Ga0070704_100013642 Ga0070704_1000136429 254
179 3300005617 Ga0068859_100159736 Ga0068859_1001597364 254
180 3300005617 Ga0068859_100541024 Ga0068859_1005410242 254
181 3300005841 Ga0068863_100263541 Ga0068863_1002635412 254
182 3300005844 Ga0068862_100265296 Ga0068862_1002652962 254
183 3300005937 Ga0081455_10150750 Ga0081455_101507502 254
184 3300005985 Ga0081539_10000083 Ga0081539_1000008377 254
185 3300006844 Ga0075428_100008504 Ga0075428_1000085047 254
186 3300006844 Ga0075428_100033642 Ga0075428_1000336424 254
187 3300006844 Ga0075428_100073392 Ga0075428_1000733924 254
188 3300006846 Ga0075430_100006569 Ga0075430_1000065691 254
189 3300006846 Ga0075430_100017389 Ga0075430_1000173897 254
190 3300006846 Ga0075430_100106148 Ga0075430_1001061482 254
191 3300006847 Ga0075431_100000637 Ga0075431_10000063715 254
192 3300006847 Ga0075431_100013139 Ga0075431_1000131396 254
193 3300006847 Ga0075431_100023502 Ga0075431_1000235024 254
194 3300006847 Ga0075431_100253770 Ga0075431_1002537702 254
195 3300006847 Ga0075431_100261522 Ga0075431_1002615223 254
196 3300006852 Ga0075433_10018149 Ga0075433_100181492 254
197 3300006880 Ga0075429_100005160 Ga0075429_1000051604 254
198 3300006880 Ga0075429_100009543 Ga0075429_1000095432 254
199 3300006880 Ga0075429_100059901 Ga0075429_1000599014 254
200 3300006914 Ga0075436_100000874 Ga0075436_10000087420 254
201 3300006931 Ga0097620_100159743 Ga0097620_1001597431 254
202 3300006931 Ga0097620_100541026 Ga0097620_1005410262 254
203 3300007076 Ga0075435_100054276 Ga0075435_1000542763 254
204 3300009094 Ga0111539_10129683 Ga0111539_101296834 254
205 3300009147 Ga0114129_10002729 Ga0114129_100027298 254
206 3300009147 Ga0114129_10003560 Ga0114129_1000356020 254
207 3300009147 Ga0114129_10044219 Ga0114129_100442197 254
208 3300025900 Ga0207710_10128255 Ga0207710_101282552 254
209 3300025936 Ga0207670_10157762 Ga0207670_101577621 254
210 3300026118 Ga0207675_100012956 Ga0207675_1000129563 254
211 3300027665 Ga0209983_1053835 Ga0209983_10538351 254
212 3300031548 Ga0307408_100039345 Ga0307408_1000393452 254
213 3300032002 Ga0307416_100828863 Ga0307416_1008288632 254
214 3300044673 Ga0453683_0074455 Ga0453683_0074455_1160_2065 254
215 3300049568 Ga0501031_0159648 Ga0501031_0159648_553_1323 254
216 3300049576 Ga0501040_0009726 Ga0501040_0009726_5358_6128 254
217 3300049577 Ga0501041_0019183 Ga0501041_0019183_108_878 254
218 3300049579 Ga0501043_0204094 Ga0501043_0204094_649_1419 254
219 3300049583 Ga0501067_0005840 Ga0501067_0005840_1292_2065 254
220 3300049584 Ga0501068_0289729 Ga0501068_0289729_242_1015 254
221 3300049585 Ga0501069_0014057 Ga0501069_0014057_1653_2426 254
222 3300049587 Ga0501071_0101056 Ga0501071_0101056_720_1493 254
223 3300049588 Ga0501072_0015142 Ga0501072_0015142_2975_3748 254
224 3300049590 Ga0501074_0167404 Ga0501074_0167404_702_1472 254
225 3300049591 Ga0501075_0000871 Ga0501075_0000871_4163_4933 254
226 3300049592 Ga0501076_0013399 Ga0501076_0013399_3085_3855 254
227 3300049592 Ga0501076_0200857 Ga0501076_0200857_262_1032 254
228 3300049741 Ga0501079_0062622 Ga0501079_0062622_2039_2809 254
229 3300049741 Ga0501079_0176869 Ga0501079_0176869_723_1496 254
230 3300049742 Ga0501080_0125153 Ga0501080_0125153_625_1398 254
231 3300049742 Ga0501080_0491907 Ga0501080_0491907_187_957 254
232 3300049743 Ga0501081_0007836 Ga0501081_0007836_3332_4105 254
233 3300049743 Ga0501081_0038075 Ga0501081_0038075_2398_3168 254
234 3300049743 Ga0501081_0295902 Ga0501081_0295902_244_1023 254
235 3300049744 Ga0501083_0099232 Ga0501083_0099232_56_829 254
236 3300049824 Ga0501045_0015501 Ga0501045_0015501_2330_3100 254
237 3300049824 Ga0501045_0303053 Ga0501045_0303053_77_856 254
238 3300050507 nmdc:mga05p37_1115_c1 nmdc:mga05p37_1115_c1_8686_9450 254
239 3300050507 nmdc:mga05p37_158932_c1 nmdc:mga05p37_158932_c1_212_976 254
240 3300050507 nmdc:mga05p37_3527_c1 nmdc:mga05p37_3527_c1_5634_6401 254
241 3300050507 nmdc:mga05p37_71147_c1 nmdc:mga05p37_71147_c1_2368_3138 254
242 3300050508 nmdc:mga09592_3942_c1 nmdc:mga09592_3942_c1_2702_3469 254
243 3300050508 nmdc:mga09592_49643_c1 nmdc:mga09592_49643_c1_1764_2528 254
244 3300050508 nmdc:mga09592_55486_c1 nmdc:mga09592_55486_c1_2533_3300 254
245 3300050509 nmdc:mga0qj67_172186_c1 nmdc:mga0qj67_172186_c1_526_1290 254
246 3300050509 nmdc:mga0qj67_3993_c1 nmdc:mga0qj67_3993_c1_9028_9795 254
247 3300050509 nmdc:mga0qj67_46131_c1 nmdc:mga0qj67_46131_c1_617_1384 254
248 3300050510 nmdc:mga06r32_11246_c1 nmdc:mga06r32_11246_c1_38_805 254
249 3300050510 nmdc:mga06r32_155710_c1 nmdc:mga06r32_155710_c1_653_1423 254
250 3300050510 nmdc:mga06r32_264102_c1 nmdc:mga06r32_264102_c1_468_1247 254
251 3300050510 nmdc:mga06r32_36139_c2 nmdc:mga06r32_36139_c2_684_1451 254
252 3300050510 nmdc:mga06r32_419399_c1 nmdc:mga06r32_419399_c1_79_861 254
253 3300050510 nmdc:mga06r32_65954_c1 nmdc:mga06r32_65954_c1_1640_2404 254
254 3300050512 nmdc:mga0n895_1025_c1 nmdc:mga0n895_1025_c1_3346_4110 254
255 3300050513 nmdc:mga0rr50_35253_c1 nmdc:mga0rr50_35253_c1_1159_1923 254
256 3300050514 nmdc:mga08x19_76943_c1 nmdc:mga08x19_76943_c1_30_794 254
257 3300050515 nmdc:mga0a205_337505_c1 nmdc:mga0a205_337505_c1_258_1031 254
258 3300050515 nmdc:mga0a205_71686_c1 nmdc:mga0a205_71686_c1_1656_2420 254
259 3300054114 Ga0501084_0016194 Ga0501084_0016194_3352_4125 254
260 3300054114 Ga0501084_0534201 Ga0501084_0534201_189_959 254
261 3300060353 Ga0501082_0009386 Ga0501082_0009386_5291_6061 254
262 3300060353 Ga0501082_0011354 Ga0501082_0011354_317_1090 254
263 3300060353 Ga0501082_0358314 Ga0501082_0358314_189_959 254
264 3300060353 Ga0501082_0470670 Ga0501082_0470670_171_950 254
265 3300061734 Ga0530510_0071024 Ga0530510_0071024_1606_2385 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01171

ATP_bind_3

PP-loop family

33

198

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6scy-assembly1.cif.gz_B u34-trna thiolase ncsa from methanococcus maripaludis with its [4fe-4s] cluster 0.821 6 231
5ztb-assembly1.cif.gz_B structure of sulfurtransferase 0.8146 4 224
5gha-assembly2.cif.gz_D sulfur transferase ttua in complex with sulfur carrier ttub 0.7934 4 224
5ztb-assembly3.cif.gz_C structure of sulfurtransferase 0.7891 4 219
5b4e-assembly1.cif.gz_A-2 sulfur transferase ttua in complex with iron sulfur cluster and atp derivative 0.7889 4 230
ID Description Score Start End Superfamily
af_A0A1P8ASI0_13_327_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8521 4 228 3.40.50.620
af_Q5AML2_30_291_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8507 4 226 3.40.50.620
af_A0A1D6HL54_20_239_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8388 7 185 3.40.50.620
af_P76055_2_264_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8327 4 243 3.40.50.620
af_Q99J10_5_327_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8324 4 230 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V6U884-F1-model_v4 tRNA(Ile)-lysidine/2-thiocytidine synthase N-terminal domain-containing protein 0.9652 3 216 GO:0003723
GO:0005737
GO:0006400
GO:0046872
AF-A0A2V7E4F4-F1-model_v4 PP-loop domain-containing protein 0.9359 1 113 GO:0003723
GO:0005737
GO:0046872
AF-A0A847QAB0-F1-model_v4 tRNA 2-thiocytidine(32) synthetase TtcA 0.9128 4 230 GO:0003723
GO:0005737
GO:0006400
GO:0046872
AF-A0A3R6IW90-F1-model_v4 deleted 0.9123 6 224
AF-R5V433-F1-model_v4 PP-loop family protein 0.9122 4 232 GO:0003723
GO:0005737
GO:0006400
GO:0046872

Feature Viewer

pLDDT pTM Quality
78.95 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map