F373449

General Info

Members Datasets Scaffolds Average Seq Length
265 156 530 233

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10449086|Ga0307411_104490862
Length 260
Sequence MRFLRFFAALQLLKVSFFFAAPQFPMNFIRAICFDLDNTLWDVWPVIIRAEQAVYSFLAERYPKAVENMTIEGMRDARARVSLDYPHMAHDFSFLRRQALLEHAAACGYEARMSEEAFEIFIAARNQVELYPDVAEALDQLHKHYRLFTASNGNADLKRIGLGHLFERMVAARDVGAMKPDPVVFQKVLEGTDLSPHEVLFVGDDPELDVEGSRRAGMHPVWVNRTEAVWPAHLELPVHSVTSLTELVQLLAVGASTQRT

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 3.02
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10449086 3300032005 Unclassified 1078
2 rootL2_10195662 3300003322 Bacteria 1777
3 Ga0070676_10072252 3300005328 Bacteria 2074
4 Ga0070676_10076862 3300005328 Bacteria 2017
5 Ga0070676_10166308 3300005328 Bacteria 1423
6 Ga0070670_100082341 3300005331 Bacteria 2765
7 Ga0070670_100167736 3300005331 Bacteria 1904
8 Ga0070670_100257833 3300005331 Unclassified 1520
9 Ga0070677_10000718 3300005333 Bacteria 11098
10 Ga0070677_10094054 3300005333 Bacteria 1309
11 Ga0068869_100038842 3300005334 Bacteria 3396
12 Ga0068869_100214319 3300005334 Bacteria 1524
13 Ga0070682_100070669 3300005337 Bacteria 2232
14 Ga0070682_100072510 3300005337 Bacteria 2207
15 Ga0070689_100001299 3300005340 Bacteria 15918
16 Ga0070689_100273663 3300005340 Bacteria 1399
17 Ga0070689_100874440 3300005340 Unclassified 794
18 Ga0070687_100485281 3300005343 Unclassified 829
19 Ga0070661_100059405 3300005344 Unclassified 2804
20 Ga0070668_100544411 3300005347 Bacteria 1010
21 Ga0070669_100069491 3300005353 Bacteria 2601
22 Ga0070669_100470500 3300005353 Bacteria 1038
23 Ga0070675_100022431 3300005354 Bacteria 5045
24 Ga0070675_100023308 3300005354 Bacteria 4948
25 Ga0070675_100046934 3300005354 Bacteria 3539
26 Ga0070674_100009055 3300005356 Bacteria 5950
27 Ga0070674_100548914 3300005356 Unclassified 969
28 Ga0070673_100022459 3300005364 Bacteria 4593
29 Ga0070673_100266613 3300005364 Bacteria 1498
30 Ga0070688_100006443 3300005365 Bacteria 6275
31 Ga0070701_10116595 3300005438 Bacteria 1499
32 Ga0070705_100014827 3300005440 Bacteria 4019
33 Ga0070700_100013338 3300005441 Bacteria 4616
34 Ga0070700_100034174 3300005441 Bacteria 3069
35 Ga0070700_100191034 3300005441 Unclassified 1432
36 Ga0070700_100327624 3300005441 Bacteria 1127
37 Ga0070700_100363672 3300005441 Bacteria 1076
38 Ga0070663_100134887 3300005455 Bacteria 1879
39 Ga0070678_100007158 3300005456 Bacteria 6597
40 Ga0068867_100052476 3300005459 Bacteria 3009
41 Ga0068867_100858887 3300005459 Bacteria 814
42 Ga0070685_10042024 3300005466 Bacteria 2606
43 Ga0070685_10207945 3300005466 Bacteria 1276
44 Ga0070699_100536803 3300005518 Bacteria 1064
45 Ga0070672_100098598 3300005543 Bacteria 2367
46 Ga0070672_100120222 3300005543 Unclassified 2149
47 Ga0070672_100657691 3300005543 Unclassified 915
48 Ga0070686_100083182 3300005544 Bacteria 2124
49 Ga0070686_100133778 3300005544 Bacteria 1718
50 Ga0070665_100002852 3300005548 Bacteria 18702
51 Ga0070665_100221442 3300005548 Bacteria 1893
52 Ga0070665_100398484 3300005548 Bacteria 1384
53 Ga0070664_100119356 3300005564 Bacteria 2308
54 Ga0070664_100894880 3300005564 Bacteria 832
55 Ga0068857_100132936 3300005577 Bacteria 2245
56 Ga0070702_100004717 3300005615 Bacteria 6258
57 Ga0070702_100025683 3300005615 Bacteria 3159
58 Ga0068859_100004602 3300005617 Bacteria 14073
59 Ga0068859_100658434 3300005617 Bacteria 1139
60 Ga0068864_100025680 3300005618 Bacteria 4964
61 Ga0068864_100673125 3300005618 Bacteria 1009
62 Ga0068861_100001105 3300005719 Bacteria 16725
63 Ga0068861_100004886 3300005719 Bacteria 9022
64 Ga0068861_100071454 3300005719 Bacteria 2690
65 Ga0068861_100171763 3300005719 Bacteria 1797
66 Ga0068861_100280574 3300005719 Unclassified 1434
67 Ga0068861_100884282 3300005719 Bacteria 845
68 Ga0068870_10001877 3300005840 Bacteria 8655
69 Ga0068870_10008078 3300005840 Bacteria 4715
70 Ga0068863_100013648 3300005841 Bacteria 7838
71 Ga0068863_100171049 3300005841 Bacteria 2084
72 Ga0068858_100152010 3300005842 Bacteria 2177
73 Ga0068860_100037875 3300005843 Bacteria 4616
74 Ga0068860_100318267 3300005843 Bacteria 1527
75 Ga0068862_100011634 3300005844 Bacteria 7260
76 Ga0068862_100052802 3300005844 Bacteria 3479
77 Ga0068862_100082577 3300005844 Bacteria 2789
78 Ga0081455_10004020 3300005937 Bacteria 16678
79 Ga0097621_100030553 3300006237 Bacteria 4266
80 Ga0068871_100045917 3300006358 Bacteria 3517
81 Ga0075430_100097111 3300006846 Bacteria 2462
82 Ga0075430_100560672 3300006846 Bacteria 942
83 Ga0068865_100201805 3300006881 Bacteria 1544
84 Ga0068865_100273839 3300006881 Bacteria 1341
85 Ga0097620_100004602 3300006931 Bacteria 14073
86 Ga0097620_100658489 3300006931 Bacteria 1139
87 Ga0111539_10031285 3300009094 Bacteria 6465
88 Ga0111539_10874850 3300009094 Bacteria 1045
89 Ga0105242_10089689 3300009176 Bacteria 2585
90 Ga0105242_10492678 3300009176 Bacteria 1164
91 Ga0105248_11366200 3300009177 Bacteria 801
92 Ga0105238_10324934 3300009551 Bacteria 1525
93 Ga0105249_10097139 3300009553 Bacteria 2765
94 Ga0157370_10402545 3300013104 Bacteria 1260
95 Ga0157374_10378056 3300013296 Bacteria 1411
96 Ga0163162_10170722 3300013306 Bacteria 2300
97 Ga0163162_11315891 3300013306 Unclassified 821
98 Ga0157375_10144719 3300013308 Bacteria 2507
99 Ga0163163_10016703 3300014325 Bacteria 6826
100 Ga0163163_10455294 3300014325 Bacteria 1340
101 Ga0163163_11151795 3300014325 Bacteria 838
102 Ga0157380_10016119 3300014326 Bacteria 5505
103 Ga0157380_10021009 3300014326 Bacteria 4891
104 Ga0157380_10034941 3300014326 Bacteria 3879
105 Ga0157380_10059073 3300014326 Bacteria 3059
106 Ga0157380_10116983 3300014326 Bacteria 2251
107 Ga0157380_10142041 3300014326 Bacteria 2064
108 Ga0157379_10184030 3300014968 Bacteria 1888
109 Ga0157376_10261024 3300014969 Bacteria 1623
110 Ga0157376_10699336 3300014969 Bacteria 1019
111 Ga0207682_10000739 3300025893 Bacteria 15144
112 Ga0207682_10120471 3300025893 Bacteria 1163
113 Ga0207642_10151930 3300025899 Unclassified 1234
114 Ga0207688_10029579 3300025901 Bacteria 3017
115 Ga0207645_10089009 3300025907 Bacteria 1985
116 Ga0207645_10301434 3300025907 Bacteria 1067
117 Ga0207643_10003134 3300025908 Bacteria 8901
118 Ga0207643_10080543 3300025908 Bacteria 1886
119 Ga0207643_10099115 3300025908 Bacteria 1707
120 Ga0207662_10209291 3300025918 Bacteria 1265
121 Ga0207681_10044565 3300025923 Bacteria 2974
122 Ga0207659_10010313 3300025926 Bacteria 5867
123 Ga0207659_10064221 3300025926 Bacteria 2656
124 Ga0207659_10133297 3300025926 Unclassified 1921
125 Ga0207670_10009224 3300025936 Bacteria 5615
126 Ga0207670_10683320 3300025936 Unclassified 849
127 Ga0207669_10290076 3300025937 Bacteria 1238
128 Ga0207691_10018853 3300025940 Bacteria 6535
129 Ga0207691_10033301 3300025940 Bacteria 4797
130 Ga0207691_10466132 3300025940 Bacteria 1074
131 Ga0207689_10050793 3300025942 Bacteria 3418
132 Ga0207689_10159836 3300025942 Bacteria 1857
133 Ga0207679_10103026 3300025945 Bacteria 2236
134 Ga0207679_10262322 3300025945 Bacteria 1474
135 Ga0207651_10006628 3300025960 Bacteria 6086
136 Ga0207651_10474589 3300025960 Bacteria 1077
137 Ga0207651_10615904 3300025960 Unclassified 950
138 Ga0207712_10432252 3300025961 Bacteria 1113
139 Ga0207668_10161984 3300025972 Bacteria 1744
140 Ga0207678_10115257 3300026067 Bacteria 2292
141 Ga0207678_10172645 3300026067 Bacteria 1846
142 Ga0207678_10576410 3300026067 Bacteria 985
143 Ga0207708_10010939 3300026075 Bacteria 6748
144 Ga0207708_10030167 3300026075 Bacteria 4112
145 Ga0207708_10121090 3300026075 Bacteria 2039
146 Ga0207708_10204779 3300026075 Bacteria 1575
147 Ga0207708_10248136 3300026075 Unclassified 1434
148 Ga0207641_10016258 3300026088 Bacteria 6094
149 Ga0207648_10052829 3300026089 Bacteria 3553
150 Ga0207648_10512427 3300026089 Unclassified 1098
151 Ga0207676_10120914 3300026095 Bacteria 2208
152 Ga0207676_10228998 3300026095 Bacteria 1660
153 Ga0207674_10138992 3300026116 Bacteria 2390
154 Ga0207675_100006119 3300026118 Bacteria 11437
155 Ga0207675_100006362 3300026118 Bacteria 11196
156 Ga0207675_100019857 3300026118 Bacteria 6271
157 Ga0207675_100034331 3300026118 Bacteria 4729
158 Ga0207675_100658289 3300026118 Unclassified 1054
159 Ga0207675_101356613 3300026118 Bacteria 732
160 Ga0207683_10008991 3300026121 Bacteria 8512
161 Ga0207683_10027488 3300026121 Bacteria 4916
162 Ga0268266_10027380 3300028379 Bacteria 4847
163 Ga0268266_10155506 3300028379 Bacteria 2065
164 Ga0268266_10485796 3300028379 Bacteria 1178
165 Ga0268265_10004387 3300028380 Bacteria 9802
166 Ga0268265_10333017 3300028380 Bacteria 1379
167 Ga0268265_10576416 3300028380 Unclassified 1072
168 Ga0268264_10166830 3300028381 Bacteria 1988
169 Ga0307511_10139845 3300030521 Bacteria 1427
170 Ga0307513_10004427 3300031456 Bacteria 18767
171 Ga0307513_10051362 3300031456 Bacteria 4449
172 Ga0307513_10179543 3300031456 Bacteria 1982
173 Ga0307513_10308206 3300031456 Bacteria 1346
174 Ga0307513_10442642 3300031456 Bacteria 1025
175 Ga0307509_10001255 3300031507 Bacteria 43009
176 Ga0307508_10332034 3300031616 Bacteria 1112
177 Ga0316575_10187611 3300031665 Bacteria 860
178 Ga0316576_10141673 3300031727 Bacteria 1810
179 Ga0316577_10206206 3300031733 Bacteria 1111
180 Ga0307413_10011987 3300031824 Bacteria 4293
181 Ga0307410_10076756 3300031852 Bacteria 2333
182 Ga0307406_10773474 3300031901 Unclassified 808
183 Ga0307407_10001931 3300031903 Bacteria 7851
184 Ga0307412_10583353 3300031911 Unclassified 944
185 Ga0307409_100000521 3300031995 Bacteria 16624
186 Ga0307416_100294126 3300032002 Bacteria 1610
187 Ga0307416_100594386 3300032002 Unclassified 1186
188 Ga0307416_101104704 3300032002 Unclassified 898
189 Ga0307411_10036883 3300032005 Bacteria 3068
190 Ga0307415_100576053 3300032126 Unclassified 998
191 Ga0307415_100692183 3300032126 Bacteria 919
192 Ga0316593_10002841 3300032168 Bacteria 4195
193 Ga0373943_0383089 3300035170 Unclassified 810
194 Ga0316574_0065927 3300035398 Bacteria 2280
195 Ga0373937_0692703 3300036401 Bacteria 965
196 Ga0436365_1910219 3300039437 Bacteria 3413
197 Ga0436360_0761517 3300039438 Bacteria 4024
198 Ga0451789_0025978 3300041443 Unclassified 1165
199 Ga0451797_0159889 3300041453 Bacteria 1472
200 Ga0451798_0964844 3300041458 Bacteria 3263
201 Ga0451802_0311116 3300041460 Bacteria 2160
202 Ga0451802_1527378 3300041460 Bacteria 945
203 Ga0451807_0047136 3300041486 Bacteria 1966
204 Ga0451807_0058471 3300041486 Bacteria 6879
205 Ga0451837_0018507 3300041494 Unclassified 3293
206 Ga0451849_0403662 3300041505 Unclassified 774
207 Ga0451853_2273489 3300041512 Bacteria 1067
208 Ga0451853_3704703 3300041512 Bacteria 1310
209 Ga0453684_0018455 3300044712 Bacteria 10706
210 Ga0495590_0051685 3300046457 Bacteria 1435
211 Ga0495638_0002457 3300046460 Bacteria 15106
212 Ga0495638_0050221 3300046460 Bacteria 2605
213 Ga0495596_0089551 3300046500 Bacteria 1194
214 Ga0495583_0193385 3300046506 Bacteria 829
215 Ga0495620_0100173 3300046515 Bacteria 1156
216 Ga0495632_0050144 3300046519 Bacteria 2060
217 Ga0495632_0070361 3300046519 Bacteria 1683
218 Ga0495621_0040831 3300046539 Unclassified 1627
219 Ga0495668_0068807 3300046616 Bacteria 1947
220 Ga0495668_0078408 3300046616 Bacteria 1814
221 Ga0495668_0153566 3300046616 Bacteria 1261
222 Ga0495668_0218252 3300046616 Bacteria 1044
223 Ga0495611_0102753 3300046648 Bacteria 1328
224 Ga0495625_0008184 3300046660 Bacteria 8955
225 Ga0495625_0058383 3300046660 Unclassified 2742
226 Ga0495649_0018620 3300046694 Bacteria 3904
227 Ga0495649_0381357 3300046694 Unclassified 709
228 Ga0495672_0025433 3300047320 Bacteria 3789
229 Ga0495672_0062617 3300047320 Bacteria 2139
230 Ga0495680_0360408 3300047322 Bacteria 1011
231 Ga0495686_0116135 3300047472 Bacteria 1600
232 Ga0496114_0127363 3300048917 Bacteria 2196
233 Ga0495682_0068902 3300049460 Bacteria 1274
234 Ga0501034_0471258 3300049571 Bacteria 1172
235 Ga0501036_0213568 3300049572 Bacteria 1621
236 Ga0501036_0858909 3300049572 Bacteria 746
237 Ga0501040_0180081 3300049576 Bacteria 1498
238 Ga0501040_0534073 3300049576 Bacteria 846
239 Ga0501042_0295254 3300049578 Bacteria 1171
240 Ga0501046_0106306 3300049580 Bacteria 2148
241 Ga0501047_0158237 3300049581 Bacteria 2138
242 Ga0501068_0001206 3300049584 Bacteria 13744
243 Ga0501070_0114158 3300049586 Bacteria 2231
244 Ga0501071_0003938 3300049587 Bacteria 9363
245 Ga0501073_0001141 3300049589 Bacteria 19332
246 Ga0501074_0000962 3300049590 Bacteria 18634
247 Ga0501076_0289749 3300049592 Bacteria 1341
248 Ga0501079_0000908 3300049741 Bacteria 20314
249 Ga0501080_0025462 3300049742 Bacteria 5491
250 Ga0501081_0086342 3300049743 Bacteria 2203
251 Ga0501083_0080719 3300049744 Bacteria 2156
252 nmdc:mga0qj67_140060_c1 3300050509 Bacteria 1961
253 nmdc:mga0qj67_551062_c1 3300050509 Bacteria 925
254 nmdc:mga08y16_64112_c1 3300050511 Bacteria 3837
255 nmdc:mga08y16_786453_c1 3300050511 Bacteria 945
256 Ga0500644_0005519 3300053088 Bacteria 3198
257 Ga0500642_0227079 3300053130 Bacteria 863
258 Ga0500568_0030671 3300053139 Bacteria 2224
259 Ga0500568_0081608 3300053139 Bacteria 1227
260 Ga0500588_0002323 3300053146 Bacteria 3842
261 Ga0500622_0001812 3300053156 Bacteria 16271
262 Ga0500622_0003311 3300053156 Bacteria 10889
263 Ga0500637_0001461 3300053178 Bacteria 10067
264 Ga0501084_0000562 3300054114 Bacteria 28420
265 Ga0501082_0034932 3300060353 Bacteria 4333
266 Ga0307411_10449086
267 rootL2_10195662
268 Ga0070676_10072252
269 Ga0070676_10076862
270 Ga0070676_10166308
271 Ga0070670_100082341
272 Ga0070670_100167736
273 Ga0070670_100257833
274 Ga0070677_10000718
275 Ga0070677_10094054
276 Ga0068869_100038842
277 Ga0068869_100214319
278 Ga0070682_100070669
279 Ga0070682_100072510
280 Ga0070689_100001299
281 Ga0070689_100273663
282 Ga0070689_100874440
283 Ga0070687_100485281
284 Ga0070661_100059405
285 Ga0070668_100544411
286 Ga0070669_100069491
287 Ga0070669_100470500
288 Ga0070675_100022431
289 Ga0070675_100023308
290 Ga0070675_100046934
291 Ga0070674_100009055
292 Ga0070674_100548914
293 Ga0070673_100022459
294 Ga0070673_100266613
295 Ga0070688_100006443
296 Ga0070701_10116595
297 Ga0070705_100014827
298 Ga0070700_100013338
299 Ga0070700_100034174
300 Ga0070700_100191034
301 Ga0070700_100327624
302 Ga0070700_100363672
303 Ga0070663_100134887
304 Ga0070678_100007158
305 Ga0068867_100052476
306 Ga0068867_100858887
307 Ga0070685_10042024
308 Ga0070685_10207945
309 Ga0070699_100536803
310 Ga0070672_100098598
311 Ga0070672_100120222
312 Ga0070672_100657691
313 Ga0070686_100083182
314 Ga0070686_100133778
315 Ga0070665_100002852
316 Ga0070665_100221442
317 Ga0070665_100398484
318 Ga0070664_100119356
319 Ga0070664_100894880
320 Ga0068857_100132936
321 Ga0070702_100004717
322 Ga0070702_100025683
323 Ga0068859_100004602
324 Ga0068859_100658434
325 Ga0068864_100025680
326 Ga0068864_100673125
327 Ga0068861_100001105
328 Ga0068861_100004886
329 Ga0068861_100071454
330 Ga0068861_100171763
331 Ga0068861_100280574
332 Ga0068861_100884282
333 Ga0068870_10001877
334 Ga0068870_10008078
335 Ga0068863_100013648
336 Ga0068863_100171049
337 Ga0068858_100152010
338 Ga0068860_100037875
339 Ga0068860_100318267
340 Ga0068862_100011634
341 Ga0068862_100052802
342 Ga0068862_100082577
343 Ga0081455_10004020
344 Ga0097621_100030553
345 Ga0068871_100045917
346 Ga0075430_100097111
347 Ga0075430_100560672
348 Ga0068865_100201805
349 Ga0068865_100273839
350 Ga0097620_100004602
351 Ga0097620_100658489
352 Ga0111539_10031285
353 Ga0111539_10874850
354 Ga0105242_10089689
355 Ga0105242_10492678
356 Ga0105248_11366200
357 Ga0105238_10324934
358 Ga0105249_10097139
359 Ga0157370_10402545
360 Ga0157374_10378056
361 Ga0163162_10170722
362 Ga0163162_11315891
363 Ga0157375_10144719
364 Ga0163163_10016703
365 Ga0163163_10455294
366 Ga0163163_11151795
367 Ga0157380_10016119
368 Ga0157380_10021009
369 Ga0157380_10034941
370 Ga0157380_10059073
371 Ga0157380_10116983
372 Ga0157380_10142041
373 Ga0157379_10184030
374 Ga0157376_10261024
375 Ga0157376_10699336
376 Ga0207682_10000739
377 Ga0207682_10120471
378 Ga0207642_10151930
379 Ga0207688_10029579
380 Ga0207645_10089009
381 Ga0207645_10301434
382 Ga0207643_10003134
383 Ga0207643_10080543
384 Ga0207643_10099115
385 Ga0207662_10209291
386 Ga0207681_10044565
387 Ga0207659_10010313
388 Ga0207659_10064221
389 Ga0207659_10133297
390 Ga0207670_10009224
391 Ga0207670_10683320
392 Ga0207669_10290076
393 Ga0207691_10018853
394 Ga0207691_10033301
395 Ga0207691_10466132
396 Ga0207689_10050793
397 Ga0207689_10159836
398 Ga0207679_10103026
399 Ga0207679_10262322
400 Ga0207651_10006628
401 Ga0207651_10474589
402 Ga0207651_10615904
403 Ga0207712_10432252
404 Ga0207668_10161984
405 Ga0207678_10115257
406 Ga0207678_10172645
407 Ga0207678_10576410
408 Ga0207708_10010939
409 Ga0207708_10030167
410 Ga0207708_10121090
411 Ga0207708_10204779
412 Ga0207708_10248136
413 Ga0207641_10016258
414 Ga0207648_10052829
415 Ga0207648_10512427
416 Ga0207676_10120914
417 Ga0207676_10228998
418 Ga0207674_10138992
419 Ga0207675_100006119
420 Ga0207675_100006362
421 Ga0207675_100019857
422 Ga0207675_100034331
423 Ga0207675_100658289
424 Ga0207675_101356613
425 Ga0207683_10008991
426 Ga0207683_10027488
427 Ga0268266_10027380
428 Ga0268266_10155506
429 Ga0268266_10485796
430 Ga0268265_10004387
431 Ga0268265_10333017
432 Ga0268265_10576416
433 Ga0268264_10166830
434 Ga0307511_10139845
435 Ga0307513_10004427
436 Ga0307513_10051362
437 Ga0307513_10179543
438 Ga0307513_10308206
439 Ga0307513_10442642
440 Ga0307509_10001255
441 Ga0307508_10332034
442 Ga0316575_10187611
443 Ga0316576_10141673
444 Ga0316577_10206206
445 Ga0307413_10011987
446 Ga0307410_10076756
447 Ga0307406_10773474
448 Ga0307407_10001931
449 Ga0307412_10583353
450 Ga0307409_100000521
451 Ga0307416_100294126
452 Ga0307416_100594386
453 Ga0307416_101104704
454 Ga0307411_10036883
455 Ga0307415_100576053
456 Ga0307415_100692183
457 Ga0316593_10002841
458 Ga0373943_0383089
459 Ga0316574_0065927
460 Ga0373937_0692703
461 Ga0436365_1910219
462 Ga0436360_0761517
463 Ga0451789_0025978
464 Ga0451797_0159889
465 Ga0451798_0964844
466 Ga0451802_0311116
467 Ga0451802_1527378
468 Ga0451807_0047136
469 Ga0451807_0058471
470 Ga0451837_0018507
471 Ga0451849_0403662
472 Ga0451853_2273489
473 Ga0451853_3704703
474 Ga0453684_0018455
475 Ga0495590_0051685
476 Ga0495638_0002457
477 Ga0495638_0050221
478 Ga0495596_0089551
479 Ga0495583_0193385
480 Ga0495620_0100173
481 Ga0495632_0050144
482 Ga0495632_0070361
483 Ga0495621_0040831
484 Ga0495668_0068807
485 Ga0495668_0078408
486 Ga0495668_0153566
487 Ga0495668_0218252
488 Ga0495611_0102753
489 Ga0495625_0008184
490 Ga0495625_0058383
491 Ga0495649_0018620
492 Ga0495649_0381357
493 Ga0495672_0025433
494 Ga0495672_0062617
495 Ga0495680_0360408
496 Ga0495686_0116135
497 Ga0496114_0127363
498 Ga0495682_0068902
499 Ga0501034_0471258
500 Ga0501036_0213568
501 Ga0501036_0858909
502 Ga0501040_0180081
503 Ga0501040_0534073
504 Ga0501042_0295254
505 Ga0501046_0106306
506 Ga0501047_0158237
507 Ga0501068_0001206
508 Ga0501070_0114158
509 Ga0501071_0003938
510 Ga0501073_0001141
511 Ga0501074_0000962
512 Ga0501076_0289749
513 Ga0501079_0000908
514 Ga0501080_0025462
515 Ga0501081_0086342
516 Ga0501083_0080719
517 nmdc:mga0qj67_140060_c1
518 nmdc:mga0qj67_551062_c1
519 nmdc:mga08y16_64112_c1
520 nmdc:mga08y16_786453_c1
521 Ga0500644_0005519
522 Ga0500642_0227079
523 Ga0500568_0030671
524 Ga0500568_0081608
525 Ga0500588_0002323
526 Ga0500622_0001812
527 Ga0500622_0003311
528 Ga0500637_0001461
529 Ga0501084_0000562
530 Ga0501082_0034932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

32

223

0.9

PF13242

Hydrolase_like

HAD-hyrolase-like

176

247

0.87

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

29

217

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vay-assembly1.cif.gz_B crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000 0.9605 6 232
3vay-assembly1.cif.gz_B crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000 0.9361 6 232
3ib6-assembly1.cif.gz_C crystal structure of an uncharacterized protein from listeria monocytogenes serotype 4b 0.8487 108 232
2pr7-assembly2.cif.gz_B crystal structure of uncharacterized protein (np_599989.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.44 a resolution 0.8395 117 205
2mu1-assembly1.cif.gz_A nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4 0.7745 117 231
ID Description Score Start End Superfamily
3vayB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9476 108 232 3.40.50.1000
3vayB02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9422 21 106 1.20.120.1600
3vayA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9383 21 106 1.20.120.1600
af_P0ADP0_119_238_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9245 117 231 3.40.50.1000
af_Q5M969_105_246_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9192 113 232 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3B1ABQ2-F1-model_v4 FMN hydrolase 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase (EC 3.1.3.-) 0.9849 1 232 GO:0009231
GO:0016791
AF-A0A3N5KQ58-F1-model_v4 HAD family hydrolase 0.9829 5 232 GO:0016791
GO:0044283
AF-A0A5Q4F2A9-F1-model_v4 HAD family hydrolase 0.9824 2 232 GO:0016787
AF-A0A2W4MFY3-F1-model_v4 HAD family hydrolase 0.9804 2 232 GO:0009231
GO:0016791
AF-A0A1V0B278-F1-model_v4 HAD family hydrolase 0.98 6 232 GO:0009231
GO:0016791

Map