F373310

General Info

Members Datasets Scaffolds Average Seq Length
265 162 530 316

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000442|Ga0157369_1000044228
Length 351
Sequence VPATLKPAPLRRGDTVVIVAPASNIKHELLERGAAALRDGFGYRVVFAQSIFERDLYFAGDLDRRVREFHAAFESEDVRAIVCARGGYGCNYLLEHVDLDLVRRHPKILVGSSDITSLLTYLHDATGLVTFHGPMAAAGFATDPGAKWAGSPEGVHPAAWECAVGGWFGYDAAEEDVTTLVPGEAEGKLYGGCLSMLAASLGTPFEVQPRDTILFLEDVNTKPYQVDRMLMQLALAGKLDGVRGFVFGEMLDCVQPGGQDYTLQDVIVRLLGERCPGVPVVFGFRSGHVSRHNITLPIGVRARLQAAPGDVRLTIVESAVEPAGTNAGELIAKVQGAQRPVRFDGNGRSVQ

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 6.42
Rhizosphere 87.92
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10000442 3300013105 Bacteria 55048
2 LJNas_1000684 3300000546 Bacteria 5718
3 Ga0070658_10358896 3300005327 Bacteria 1248
4 Ga0070683_100081646 3300005329 Bacteria 3027
5 Ga0070683_100253935 3300005329 Bacteria 1672
6 Ga0070683_100297784 3300005329 Bacteria 1534
7 Ga0070670_100021939 3300005331 Bacteria 5494
8 Ga0070680_100082456 3300005336 Unclassified 2654
9 Ga0068868_100000948 3300005338 Bacteria 19729
10 Ga0068868_100017827 3300005338 Bacteria 5296
11 Ga0070660_100159586 3300005339 Bacteria 1816
12 Ga0070660_100183992 3300005339 Bacteria 1691
13 Ga0070689_100096012 3300005340 Bacteria 2342
14 Ga0070661_100004819 3300005344 Bacteria 9288
15 Ga0070661_100048894 3300005344 Unclassified 3096
16 Ga0070661_100246218 3300005344 Bacteria 1378
17 Ga0070669_100248773 3300005353 Bacteria 1415
18 Ga0070709_10016024 3300005434 Bacteria 4272
19 Ga0070714_100001244 3300005435 Bacteria 18383
20 Ga0070714_100646991 3300005435 Bacteria 1017
21 Ga0070713_100005742 3300005436 Bacteria 8523
22 Ga0070713_100056414 3300005436 Bacteria 3268
23 Ga0070713_100242135 3300005436 Bacteria 1643
24 Ga0070713_100266509 3300005436 Bacteria 1567
25 Ga0070710_10044023 3300005437 Bacteria 2475
26 Ga0070711_100001945 3300005439 Bacteria 11581
27 Ga0070708_100001670 3300005445 Bacteria 17028
28 Ga0070708_100006061 3300005445 Bacteria 9615
29 Ga0070681_10000201 3300005458 Bacteria 46571
30 Ga0070681_10011383 3300005458 Bacteria 8802
31 Ga0070681_10074104 3300005458 Bacteria 3366
32 Ga0070681_10094704 3300005458 Bacteria 2934
33 Ga0068867_100028194 3300005459 Bacteria 4041
34 Ga0070706_100008356 3300005467 Bacteria 9646
35 Ga0070706_100013738 3300005467 Bacteria 7487
36 Ga0070707_100003256 3300005468 Bacteria 15391
37 Ga0070707_100008252 3300005468 Bacteria 9666
38 Ga0070707_100087974 3300005468 Bacteria 3005
39 Ga0070698_100007842 3300005471 Bacteria 11559
40 Ga0070698_100046230 3300005471 Bacteria 4451
41 Ga0070699_100000976 3300005518 Bacteria 26672
42 Ga0070679_100130387 3300005530 Unclassified 2495
43 Ga0070679_100203311 3300005530 Bacteria 1946
44 Ga0070697_100000337 3300005536 Bacteria 36991
45 Ga0070697_100040580 3300005536 Bacteria 3767
46 Ga0068853_100013973 3300005539 Bacteria 6568
47 Ga0068853_100158019 3300005539 Bacteria 2044
48 Ga0070695_100325171 3300005545 Bacteria 1144
49 Ga0070693_100008422 3300005547 Bacteria 5083
50 Ga0068855_100000282 3300005563 Bacteria 62654
51 Ga0068855_100006263 3300005563 Bacteria 14508
52 Ga0068855_100008514 3300005563 Bacteria 12401
53 Ga0068855_100045068 3300005563 Bacteria 5217
54 Ga0070664_100000302 3300005564 Bacteria 35799
55 Ga0068857_100036870 3300005577 Bacteria 4331
56 Ga0068857_100036989 3300005577 Bacteria 4324
57 Ga0068857_100050459 3300005577 Bacteria 3691
58 Ga0068857_100195500 3300005577 Bacteria 1843
59 Ga0068854_100018072 3300005578 Bacteria 4727
60 Ga0068856_100000026 3300005614 Bacteria 135674
61 Ga0068856_100000506 3300005614 Bacteria 43162
62 Ga0068856_100001494 3300005614 Bacteria 24459
63 Ga0068856_100032885 3300005614 Bacteria 5079
64 Ga0068856_100303225 3300005614 Bacteria 1615
65 Ga0068852_100074860 3300005616 Bacteria 2984
66 Ga0068859_100000193 3300005617 Bacteria 59184
67 Ga0068864_100000449 3300005618 Bacteria 35592
68 Ga0068864_100033853 3300005618 Bacteria 4344
69 Ga0068866_10002811 3300005718 Bacteria 7172
70 Ga0068861_100312423 3300005719 Unclassified 1366
71 Ga0068851_10064294 3300005834 Bacteria 1885
72 Ga0068851_10111289 3300005834 Unclassified 1462
73 Ga0068863_100122728 3300005841 Unclassified 2478
74 Ga0068858_100006271 3300005842 Bacteria 11589
75 Ga0068858_100007985 3300005842 Bacteria 10202
76 Ga0068860_100026246 3300005843 Bacteria 5616
77 Ga0070717_10026351 3300006028 Bacteria 4636
78 Ga0075365_10078244 3300006038 Bacteria 2235
79 Ga0075363_100019951 3300006048 Bacteria 3356
80 Ga0075364_10150212 3300006051 Bacteria 1570
81 Ga0075364_10181663 3300006051 Bacteria 1424
82 Ga0075367_10054484 3300006178 Bacteria 2372
83 Ga0097621_100000520 3300006237 Bacteria 26997
84 Ga0097621_100002293 3300006237 Bacteria 13104
85 Ga0097621_100007442 3300006237 Bacteria 7833
86 Ga0068871_100000211 3300006358 Bacteria 40563
87 Ga0068871_100002566 3300006358 Bacteria 12404
88 Ga0068871_100143983 3300006358 Unclassified 2028
89 Ga0075428_100009581 3300006844 Bacteria 10757
90 Ga0075428_100036314 3300006844 Bacteria 5428
91 Ga0075428_100039593 3300006844 Bacteria 5188
92 Ga0075428_100545471 3300006844 Unclassified 1240
93 Ga0075431_100035712 3300006847 Bacteria 5117
94 Ga0075433_10046434 3300006852 Bacteria 3777
95 Ga0075433_10067791 3300006852 Bacteria 3131
96 Ga0075434_100043323 3300006871 Bacteria 4464
97 Ga0075429_100003095 3300006880 Bacteria 14117
98 Ga0075436_100028834 3300006914 Bacteria 3818
99 Ga0097620_100000193 3300006931 Bacteria 59184
100 Ga0105240_10080816 3300009093 Unclassified 3996
101 Ga0111539_10006409 3300009094 Bacteria 15174
102 Ga0111539_10115149 3300009094 Bacteria 3153
103 Ga0105245_10020465 3300009098 Bacteria 5802
104 Ga0114129_10007504 3300009147 Bacteria 15532
105 Ga0114129_10008591 3300009147 Bacteria 14564
106 Ga0105243_10164484 3300009148 Bacteria 1916
107 Ga0105248_10003075 3300009177 Bacteria 18502
108 Ga0105237_10054798 3300009545 Bacteria 3995
109 Ga0105237_10255381 3300009545 Bacteria 1755
110 Ga0105237_10483969 3300009545 Bacteria 1244
111 Ga0105238_10005366 3300009551 Bacteria 12666
112 Ga0105238_10142629 3300009551 Bacteria 2372
113 Ga0105239_10024447 3300010375 Bacteria 6656
114 Ga0105239_10035721 3300010375 Bacteria 5456
115 Ga0105239_10131125 3300010375 Bacteria 2788
116 Ga0105246_10066700 3300011119 Bacteria 2520
117 Ga0157371_10023735 3300013102 Bacteria 4483
118 Ga0157371_10038585 3300013102 Bacteria 3417
119 Ga0157371_10081876 3300013102 Bacteria 2285
120 Ga0157369_10000229 3300013105 Bacteria 77507
121 Ga0157369_10058587 3300013105 Bacteria 4155
122 Ga0157369_10103665 3300013105 Bacteria 3030
123 Ga0157374_10000090 3300013296 Bacteria 88789
124 Ga0157374_10000750 3300013296 Bacteria 28316
125 Ga0157374_10001253 3300013296 Bacteria 21678
126 Ga0157378_10000070 3300013297 Bacteria 91609
127 Ga0157378_10000596 3300013297 Bacteria 33870
128 Ga0157378_10001219 3300013297 Bacteria 23313
129 Ga0157378_10382082 3300013297 Bacteria 1383
130 Ga0157372_10000100 3300013307 Bacteria 89828
131 Ga0157372_10000211 3300013307 Bacteria 65258
132 Ga0157372_10000948 3300013307 Bacteria 31645
133 Ga0157372_10015753 3300013307 Bacteria 8109
134 Ga0157372_10067231 3300013307 Bacteria 4027
135 Ga0182008_10007422 3300014497 Bacteria 6054
136 Ga0157377_10306156 3300014745 Bacteria 1050
137 Ga0157376_10005194 3300014969 Bacteria 9084
138 Ga0182007_10006898 3300015262 Bacteria 4828
139 Ga0207692_10018608 3300025898 Bacteria 3122
140 Ga0207642_10012143 3300025899 Bacteria 3100
141 Ga0207699_10015466 3300025906 Bacteria 3964
142 Ga0207684_10001148 3300025910 Bacteria 29555
143 Ga0207684_10068018 3300025910 Unclassified 3028
144 Ga0207654_10220465 3300025911 Bacteria 1258
145 Ga0207707_10003069 3300025912 Bacteria 14828
146 Ga0207707_10008706 3300025912 Bacteria 8806
147 Ga0207660_10207033 3300025917 Bacteria 1534
148 Ga0207657_10003001 3300025919 Bacteria 18081
149 Ga0207649_10005549 3300025920 Bacteria 6826
150 Ga0207649_10073528 3300025920 Bacteria 2190
151 Ga0207652_10130999 3300025921 Bacteria 2237
152 Ga0207652_10136066 3300025921 Bacteria 2194
153 Ga0207646_10000855 3300025922 Bacteria 39420
154 Ga0207646_10006871 3300025922 Bacteria 11686
155 Ga0207646_10127032 3300025922 Bacteria 2293
156 Ga0207694_10018480 3300025924 Bacteria 5269
157 Ga0207650_10009446 3300025925 Bacteria 6665
158 Ga0207700_10051950 3300025928 Bacteria 3062
159 Ga0207664_10031102 3300025929 Bacteria 4081
160 Ga0207664_10043803 3300025929 Bacteria 3503
161 Ga0207670_10078512 3300025936 Bacteria 2302
162 Ga0207704_10058895 3300025938 Bacteria 2368
163 Ga0207665_10220045 3300025939 Bacteria 1391
164 Ga0207661_10075924 3300025944 Unclassified 2759
165 Ga0207661_10090860 3300025944 Bacteria 2543
166 Ga0207679_10004874 3300025945 Bacteria 8363
167 Ga0207679_10092199 3300025945 Bacteria 2347
168 Ga0207667_10000170 3300025949 Bacteria 95740
169 Ga0207667_10008764 3300025949 Bacteria 11980
170 Ga0207667_10012711 3300025949 Bacteria 9672
171 Ga0207640_10009055 3300025981 Bacteria 5556
172 Ga0207677_10001452 3300026023 Bacteria 12553
173 Ga0207677_10021372 3300026023 Unclassified 3953
174 Ga0207639_10150597 3300026041 Bacteria 1948
175 Ga0207702_10000131 3300026078 Bacteria 89131
176 Ga0207702_10001252 3300026078 Bacteria 25632
177 Ga0207702_10008063 3300026078 Bacteria 8910
178 Ga0207702_10013286 3300026078 Bacteria 6848
179 Ga0207641_10056892 3300026088 Unclassified 3325
180 Ga0207648_10010603 3300026089 Bacteria 8716
181 Ga0207676_10001648 3300026095 Bacteria 16441
182 Ga0207676_10011169 3300026095 Bacteria 6412
183 Ga0207674_10001066 3300026116 Bacteria 35666
184 Ga0207674_10024079 3300026116 Bacteria 6511
185 Ga0207674_10056443 3300026116 Bacteria 3988
186 Ga0207698_10042956 3300026142 Bacteria 3383
187 Ga0265326_10004077 3300028558 Bacteria 4717
188 Ga0265338_10000009 3300028800 Bacteria 448611
189 Ga0265338_10000240 3300028800 Bacteria 101444
190 Ga0265338_10028135 3300028800 Bacteria 5616
191 Ga0265338_10117942 3300028800 Bacteria 2122
192 Ga0265324_10000693 3300029957 Bacteria 22492
193 Ga0265324_10024058 3300029957 Bacteria 2166
194 Ga0265760_10001034 3300031090 Bacteria 8094
195 Ga0265325_10012794 3300031241 Bacteria 4788
196 Ga0265340_10007519 3300031247 Bacteria 5914
197 Ga0265339_10085893 3300031249 Bacteria 1656
198 Ga0265313_10041690 3300031595 Bacteria 2259
199 Ga0265314_10151524 3300031711 Bacteria 1421
200 Ga0265342_10081237 3300031712 Bacteria 1872
201 Ga0307413_10119102 3300031824 Bacteria 1784
202 Ga0307410_10002274 3300031852 Bacteria 9207
203 Ga0307410_10057432 3300031852 Bacteria 2650
204 Ga0307406_10034952 3300031901 Bacteria 3087
205 Ga0307409_100057916 3300031995 Bacteria 3006
206 Ga0307414_10131162 3300032004 Bacteria 1946
207 Ga0307411_10284982 3300032005 Bacteria 1317
208 Ga0307415_100574076 3300032126 Bacteria 999
209 Ga0395898_0152880 3300037466 Unclassified 2208
210 Ga0436365_0676328 3300039437 Bacteria 5837
211 Ga0436365_1097751 3300039437 Bacteria 3593
212 Ga0436363_0707383 3300039450 Bacteria 7601
213 Ga0436363_0741830 3300039450 Bacteria 3053
214 Ga0436362_0287470 3300039453 Bacteria 4133
215 Ga0436362_0945821 3300039453 Bacteria 1484
216 Ga0466963_0017273 3300044694 Bacteria 4496
217 Ga0466963_0084309 3300044694 Bacteria 2156
218 Ga0466963_0261266 3300044694 Bacteria 1216
219 Ga0451576_0130285 3300045051 Bacteria 2622
220 Ga0466967_0001038 3300045976 Bacteria 15242
221 Ga0495580_0003297 3300046472 Bacteria 13795
222 Ga0495580_0004476 3300046472 Bacteria 11738
223 Ga0495580_0023514 3300046472 Unclassified 4524
224 Ga0495582_0212950 3300046473 Bacteria 1105
225 Ga0495594_0040150 3300046499 Bacteria 2560
226 Ga0495628_0203777 3300046516 Bacteria 1490
227 Ga0495625_0141923 3300046660 Unclassified 1620
228 Ga0495669_0003332 3300046684 Bacteria 6612
229 Ga0496100_0018545 3300048903 Bacteria 4130
230 Ga0496101_0331935 3300048904 Unclassified 1194
231 Ga0496102_0092459 3300048905 Unclassified 2801
232 Ga0496102_0212791 3300048905 Bacteria 1822
233 Ga0496103_0068177 3300048906 Unclassified 2223
234 Ga0496104_0393652 3300048907 Bacteria 1298
235 Ga0496104_0571052 3300048907 Bacteria 1041
236 Ga0496108_0045441 3300048911 Bacteria 3668
237 Ga0496109_0050037 3300048912 Bacteria 3806
238 Ga0496110_0074527 3300048913 Bacteria 3014
239 Ga0496111_0020199 3300048914 Bacteria 4635
240 Ga0496112_0002774 3300048915 Bacteria 14209
241 Ga0496112_0092911 3300048915 Bacteria 2987
242 Ga0496112_0173057 3300048915 Bacteria 2124
243 Ga0496112_0548464 3300048915 Unclassified 1090
244 Ga0496113_0059240 3300048916 Unclassified 2884
245 Ga0496115_0224243 3300048918 Unclassified 1551
246 Ga0496126_0003974 3300048929 Bacteria 18064
247 Ga0501299_028938 3300049522 Unclassified 1059
248 Ga0501033_0163241 3300049570 Bacteria 1603
249 Ga0501040_0323732 3300049576 Unclassified 1103
250 Ga0501074_0224344 3300049590 Unclassified 1338
251 Ga0501077_0247557 3300049593 Unclassified 1133
252 nmdc:mga03n38_35455_c1 3300050490 Bacteria 2137
253 nmdc:mga00v17_169804_c1 3300050491 Bacteria 1406
254 nmdc:mga00v17_172139_c1 3300050491 Bacteria 1396
255 nmdc:mga0yw44_65812_c1 3300050492 Bacteria 2235
256 nmdc:mga06z11_13539_c1 3300050494 Bacteria 3585
257 nmdc:mga05p37_2086_c1 3300050507 Bacteria 23329
258 nmdc:mga09592_159619_c1 3300050508 Bacteria 1947
259 nmdc:mga09592_7466_c1 3300050508 Bacteria 8885
260 nmdc:mga06r32_94409_c1 3300050510 Bacteria 2927
261 nmdc:mga08y16_272642_c1 3300050511 Bacteria 1746
262 nmdc:mga08y16_8945_c1 3300050511 Bacteria 10517
263 nmdc:mga0a205_31733_c1 3300050515 Bacteria 5063
264 nmdc:mga0a205_32147_c1 3300050515 Bacteria 5031
265 Ga0501084_0150534 3300054114 Bacteria 1961
266 Ga0157369_10000442
267 LJNas_1000684
268 Ga0070658_10358896
269 Ga0070683_100081646
270 Ga0070683_100253935
271 Ga0070683_100297784
272 Ga0070670_100021939
273 Ga0070680_100082456
274 Ga0068868_100000948
275 Ga0068868_100017827
276 Ga0070660_100159586
277 Ga0070660_100183992
278 Ga0070689_100096012
279 Ga0070661_100004819
280 Ga0070661_100048894
281 Ga0070661_100246218
282 Ga0070669_100248773
283 Ga0070709_10016024
284 Ga0070714_100001244
285 Ga0070714_100646991
286 Ga0070713_100005742
287 Ga0070713_100056414
288 Ga0070713_100242135
289 Ga0070713_100266509
290 Ga0070710_10044023
291 Ga0070711_100001945
292 Ga0070708_100001670
293 Ga0070708_100006061
294 Ga0070681_10000201
295 Ga0070681_10011383
296 Ga0070681_10074104
297 Ga0070681_10094704
298 Ga0068867_100028194
299 Ga0070706_100008356
300 Ga0070706_100013738
301 Ga0070707_100003256
302 Ga0070707_100008252
303 Ga0070707_100087974
304 Ga0070698_100007842
305 Ga0070698_100046230
306 Ga0070699_100000976
307 Ga0070679_100130387
308 Ga0070679_100203311
309 Ga0070697_100000337
310 Ga0070697_100040580
311 Ga0068853_100013973
312 Ga0068853_100158019
313 Ga0070695_100325171
314 Ga0070693_100008422
315 Ga0068855_100000282
316 Ga0068855_100006263
317 Ga0068855_100008514
318 Ga0068855_100045068
319 Ga0070664_100000302
320 Ga0068857_100036870
321 Ga0068857_100036989
322 Ga0068857_100050459
323 Ga0068857_100195500
324 Ga0068854_100018072
325 Ga0068856_100000026
326 Ga0068856_100000506
327 Ga0068856_100001494
328 Ga0068856_100032885
329 Ga0068856_100303225
330 Ga0068852_100074860
331 Ga0068859_100000193
332 Ga0068864_100000449
333 Ga0068864_100033853
334 Ga0068866_10002811
335 Ga0068861_100312423
336 Ga0068851_10064294
337 Ga0068851_10111289
338 Ga0068863_100122728
339 Ga0068858_100006271
340 Ga0068858_100007985
341 Ga0068860_100026246
342 Ga0070717_10026351
343 Ga0075365_10078244
344 Ga0075363_100019951
345 Ga0075364_10150212
346 Ga0075364_10181663
347 Ga0075367_10054484
348 Ga0097621_100000520
349 Ga0097621_100002293
350 Ga0097621_100007442
351 Ga0068871_100000211
352 Ga0068871_100002566
353 Ga0068871_100143983
354 Ga0075428_100009581
355 Ga0075428_100036314
356 Ga0075428_100039593
357 Ga0075428_100545471
358 Ga0075431_100035712
359 Ga0075433_10046434
360 Ga0075433_10067791
361 Ga0075434_100043323
362 Ga0075429_100003095
363 Ga0075436_100028834
364 Ga0097620_100000193
365 Ga0105240_10080816
366 Ga0111539_10006409
367 Ga0111539_10115149
368 Ga0105245_10020465
369 Ga0114129_10007504
370 Ga0114129_10008591
371 Ga0105243_10164484
372 Ga0105248_10003075
373 Ga0105237_10054798
374 Ga0105237_10255381
375 Ga0105237_10483969
376 Ga0105238_10005366
377 Ga0105238_10142629
378 Ga0105239_10024447
379 Ga0105239_10035721
380 Ga0105239_10131125
381 Ga0105246_10066700
382 Ga0157371_10023735
383 Ga0157371_10038585
384 Ga0157371_10081876
385 Ga0157369_10000229
386 Ga0157369_10058587
387 Ga0157369_10103665
388 Ga0157374_10000090
389 Ga0157374_10000750
390 Ga0157374_10001253
391 Ga0157378_10000070
392 Ga0157378_10000596
393 Ga0157378_10001219
394 Ga0157378_10382082
395 Ga0157372_10000100
396 Ga0157372_10000211
397 Ga0157372_10000948
398 Ga0157372_10015753
399 Ga0157372_10067231
400 Ga0182008_10007422
401 Ga0157377_10306156
402 Ga0157376_10005194
403 Ga0182007_10006898
404 Ga0207692_10018608
405 Ga0207642_10012143
406 Ga0207699_10015466
407 Ga0207684_10001148
408 Ga0207684_10068018
409 Ga0207654_10220465
410 Ga0207707_10003069
411 Ga0207707_10008706
412 Ga0207660_10207033
413 Ga0207657_10003001
414 Ga0207649_10005549
415 Ga0207649_10073528
416 Ga0207652_10130999
417 Ga0207652_10136066
418 Ga0207646_10000855
419 Ga0207646_10006871
420 Ga0207646_10127032
421 Ga0207694_10018480
422 Ga0207650_10009446
423 Ga0207700_10051950
424 Ga0207664_10031102
425 Ga0207664_10043803
426 Ga0207670_10078512
427 Ga0207704_10058895
428 Ga0207665_10220045
429 Ga0207661_10075924
430 Ga0207661_10090860
431 Ga0207679_10004874
432 Ga0207679_10092199
433 Ga0207667_10000170
434 Ga0207667_10008764
435 Ga0207667_10012711
436 Ga0207640_10009055
437 Ga0207677_10001452
438 Ga0207677_10021372
439 Ga0207639_10150597
440 Ga0207702_10000131
441 Ga0207702_10001252
442 Ga0207702_10008063
443 Ga0207702_10013286
444 Ga0207641_10056892
445 Ga0207648_10010603
446 Ga0207676_10001648
447 Ga0207676_10011169
448 Ga0207674_10001066
449 Ga0207674_10024079
450 Ga0207674_10056443
451 Ga0207698_10042956
452 Ga0265326_10004077
453 Ga0265338_10000009
454 Ga0265338_10000240
455 Ga0265338_10028135
456 Ga0265338_10117942
457 Ga0265324_10000693
458 Ga0265324_10024058
459 Ga0265760_10001034
460 Ga0265325_10012794
461 Ga0265340_10007519
462 Ga0265339_10085893
463 Ga0265313_10041690
464 Ga0265314_10151524
465 Ga0265342_10081237
466 Ga0307413_10119102
467 Ga0307410_10002274
468 Ga0307410_10057432
469 Ga0307406_10034952
470 Ga0307409_100057916
471 Ga0307414_10131162
472 Ga0307411_10284982
473 Ga0307415_100574076
474 Ga0395898_0152880
475 Ga0436365_0676328
476 Ga0436365_1097751
477 Ga0436363_0707383
478 Ga0436363_0741830
479 Ga0436362_0287470
480 Ga0436362_0945821
481 Ga0466963_0017273
482 Ga0466963_0084309
483 Ga0466963_0261266
484 Ga0451576_0130285
485 Ga0466967_0001038
486 Ga0495580_0003297
487 Ga0495580_0004476
488 Ga0495580_0023514
489 Ga0495582_0212950
490 Ga0495594_0040150
491 Ga0495628_0203777
492 Ga0495625_0141923
493 Ga0495669_0003332
494 Ga0496100_0018545
495 Ga0496101_0331935
496 Ga0496102_0092459
497 Ga0496102_0212791
498 Ga0496103_0068177
499 Ga0496104_0393652
500 Ga0496104_0571052
501 Ga0496108_0045441
502 Ga0496109_0050037
503 Ga0496110_0074527
504 Ga0496111_0020199
505 Ga0496112_0002774
506 Ga0496112_0092911
507 Ga0496112_0173057
508 Ga0496112_0548464
509 Ga0496113_0059240
510 Ga0496115_0224243
511 Ga0496126_0003974
512 Ga0501299_028938
513 Ga0501033_0163241
514 Ga0501040_0323732
515 Ga0501074_0224344
516 Ga0501077_0247557
517 nmdc:mga03n38_35455_c1
518 nmdc:mga00v17_169804_c1
519 nmdc:mga00v17_172139_c1
520 nmdc:mga0yw44_65812_c1
521 nmdc:mga06z11_13539_c1
522 nmdc:mga05p37_2086_c1
523 nmdc:mga09592_159619_c1
524 nmdc:mga09592_7466_c1
525 nmdc:mga06r32_94409_c1
526 nmdc:mga08y16_272642_c1
527 nmdc:mga08y16_8945_c1
528 nmdc:mga0a205_31733_c1
529 nmdc:mga0a205_32147_c1
530 Ga0501084_0150534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

16

133

0.95

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

186

304

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5usd-assembly2.cif.gz_C crystal structure of mccf-like protein (ba_5613) in the complex with aspartyl sulfamoyl adenylate 0.9046 1 298
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9036 8 299
4h1h-assembly1.cif.gz_A crystal structure of mccf homolog from listeria monocytogenes egd-e 0.9022 1 298
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.901 6 296
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8976 8 299
ID Description Score Start End Superfamily
4mjxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9396 1 133 3.40.50.10740
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.916 1 132 3.40.50.10740
af_P76008_4_153_3.40.50.10740 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9082 8 135 3.40.50.10740
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9077 1 134 3.40.50.10740
3sr3B02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8712 159 301 3.50.30.60
ID Description Score Start End GO Terms
AF-A0A1D2UFI3-F1-model_v4 LD-carboxypeptidase 0.9742 4 297 GO:0004180
GO:0006508
GO:0008236
AF-A0A7G8BCY5-F1-model_v4 LD-carboxypeptidase 0.9732 1 295 GO:0004180
GO:0006508
GO:0008236
AF-A0A321LRL8-F1-model_v4 LD-carboxypeptidase 0.9676 4 297 GO:0004180
GO:0006508
GO:0008236
AF-A0A2V9NZ59-F1-model_v4 LD-carboxypeptidase 0.9635 4 263 GO:0004180
GO:0006508
GO:0008236
AF-A0A7V9TH61-F1-model_v4 LD-carboxypeptidase 0.9608 4 128 GO:0004180

Map