F373210

General Info

Members Datasets Scaffolds Average Seq Length
265 170 530 407

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10004150|Ga0081539_1000415015
Length 448
Sequence MVAMPNGFPVVVVGAGQAGLAVSYELTARGIEHVVLEQAQVGQSWLGLWDSFRLVTPNWTMSLPGAAYTGDDPEGFVPRDEIVRYLQRYASSFGAPIREGVSVDSLEPGPSGGFLLRTSAGELRAAAVVVCTGAYQRPHRPMVAAGFPNDVLVIDARNYRNPAALPPGKVLVVGSGQTGCQLSEELHEAGRDVFLSCGRAPWLPRRPGGRDIVTWLKDTTFFDTPLSALPSPAARLGANLLVTGQRGGHDLHYRTLQAMGVQLLGHLAGVEGHRASFAADLADSVAFGDARYADIRKLLTEQLPAKGIAAPDLPDPPPFHADPPLELDLNGFGVAIFTSGFRPDYERWVRFPAFDAMGFPLTDNGASTVVPGLSFCGVHFLRKRKSSVLFGVGEDAAIVAQSVAHGAVNPVPAPTDRGGRWFSSCGRARRWPGSRRPGGRPGRRRRPW

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.04
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 8.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10004150 3300005985 Bacteria 16459
2 JGI25407J50210_10001859 3300003373 Bacteria 4887
3 JGI25407J50210_10006349 3300003373 Bacteria 2939
4 JGI25407J50210_10021873 3300003373 Bacteria 1662
5 Ga0070658_10015538 3300005327 Bacteria 6088
6 Ga0070683_100006078 3300005329 Bacteria 10122
7 Ga0070683_100032268 3300005329 Bacteria 4769
8 Ga0070683_100196211 3300005329 Bacteria 1917
9 Ga0070683_100243269 3300005329 Bacteria 1711
10 Ga0070680_100040412 3300005336 Bacteria 3776
11 Ga0070682_100004194 3300005337 Bacteria 7996
12 Ga0068868_100129120 3300005338 Bacteria 2067
13 Ga0070660_100003041 3300005339 Bacteria 11547
14 Ga0070661_100005619 3300005344 Bacteria 8639
15 Ga0070668_100086174 3300005347 Bacteria 2469
16 Ga0070659_100033657 3300005366 Unclassified 3982
17 Ga0070714_100000510 3300005435 Bacteria 28185
18 Ga0070711_100011827 3300005439 Bacteria 5430
19 Ga0070705_100093976 3300005440 Bacteria 1876
20 Ga0070708_100022981 3300005445 Bacteria 5296
21 Ga0070708_100201656 3300005445 Bacteria 1862
22 Ga0070708_100241791 3300005445 Bacteria 1695
23 Ga0070678_100146191 3300005456 Bacteria 1898
24 Ga0070662_100033775 3300005457 Bacteria 3604
25 Ga0070681_10060718 3300005458 Bacteria 3756
26 Ga0068867_100204646 3300005459 Bacteria 1582
27 Ga0070706_100000232 3300005467 Bacteria 68304
28 Ga0070706_100035925 3300005467 Unclassified 4576
29 Ga0070707_100074359 3300005468 Bacteria 3277
30 Ga0070698_100099047 3300005471 Bacteria 2888
31 Ga0070679_100013574 3300005530 Bacteria 7805
32 Ga0070684_100118189 3300005535 Bacteria 2383
33 Ga0070686_100076764 3300005544 Bacteria 2201
34 Ga0070695_100032003 3300005545 Bacteria 3286
35 Ga0070696_100227037 3300005546 Bacteria 1403
36 Ga0070665_100057845 3300005548 Bacteria 3887
37 Ga0068855_100019357 3300005563 Bacteria 8179
38 Ga0068855_100122683 3300005563 Bacteria 2973
39 Ga0068856_100036530 3300005614 Bacteria 4817
40 Ga0068852_100115548 3300005616 Bacteria 2447
41 Ga0068852_100122171 3300005616 Unclassified 2387
42 Ga0068864_100006054 3300005618 Bacteria 9930
43 Ga0068861_100051152 3300005719 Bacteria 3135
44 Ga0068858_100119848 3300005842 Bacteria 2460
45 Ga0068862_100109168 3300005844 Bacteria 2427
46 Ga0081455_10003669 3300005937 Bacteria 17566
47 Ga0081455_10044569 3300005937 Bacteria 3868
48 Ga0081455_10084125 3300005937 Bacteria 2597
49 Ga0081538_10000893 3300005981 Bacteria 32277
50 Ga0081538_10000921 3300005981 Bacteria 31717
51 Ga0081538_10002754 3300005981 Bacteria 16866
52 Ga0081538_10005158 3300005981 Bacteria 11838
53 Ga0081538_10006963 3300005981 Bacteria 9836
54 Ga0081538_10010586 3300005981 Bacteria 7552
55 Ga0081538_10050465 3300005981 Bacteria 2512
56 Ga0081538_10058524 3300005981 Bacteria 2234
57 Ga0081540_1001926 3300005983 Bacteria 17391
58 Ga0081540_1009279 3300005983 Bacteria 6785
59 Ga0081540_1013635 3300005983 Bacteria 5270
60 Ga0081539_10004245 3300005985 Bacteria 16093
61 Ga0081539_10013752 3300005985 Bacteria 6068
62 Ga0070717_10001622 3300006028 Bacteria 15595
63 Ga0070712_100014899 3300006175 Bacteria 4997
64 Ga0075428_100111058 3300006844 Bacteria 2987
65 Ga0075431_100029607 3300006847 Bacteria 5638
66 Ga0075433_10010529 3300006852 Bacteria 7429
67 Ga0075434_100336308 3300006871 Bacteria 1530
68 Ga0075435_100155383 3300007076 Bacteria 1924
69 Ga0111539_10075870 3300009094 Bacteria 3960
70 Ga0111539_10149897 3300009094 Bacteria 2730
71 Ga0111539_10543311 3300009094 Bacteria 1354
72 Ga0105245_10005884 3300009098 Bacteria 10773
73 Ga0105245_10048406 3300009098 Bacteria 3803
74 Ga0114129_10064313 3300009147 Bacteria 5119
75 Ga0114129_10236884 3300009147 Bacteria 2455
76 Ga0114129_10439857 3300009147 Bacteria 1712
77 Ga0105248_10446910 3300009177 Bacteria 1456
78 Ga0105237_10049150 3300009545 Bacteria 4241
79 Ga0105238_10060467 3300009551 Bacteria 3793
80 Ga0105239_10028434 3300010375 Bacteria 6149
81 Ga0105239_10069539 3300010375 Bacteria 3868
82 Ga0105246_10001099 3300011119 Bacteria 15688
83 Ga0157370_10098879 3300013104 Unclassified 2735
84 Ga0157369_10036759 3300013105 Bacteria 5364
85 Ga0157369_10127432 3300013105 Bacteria 2698
86 Ga0157374_10048779 3300013296 Bacteria 3930
87 Ga0163162_10045280 3300013306 Bacteria 4408
88 Ga0163162_10212195 3300013306 Bacteria 2066
89 Ga0157372_10002574 3300013307 Bacteria 19643
90 Ga0157372_10087841 3300013307 Bacteria 3529
91 Ga0157375_10030901 3300013308 Bacteria 5056
92 Ga0163163_10041596 3300014325 Bacteria 4495
93 Ga0157379_10024705 3300014968 Bacteria 5333
94 Ga0207688_10006991 3300025901 Bacteria 6138
95 Ga0207647_10011449 3300025904 Bacteria 6220
96 Ga0207705_10177471 3300025909 Bacteria 1606
97 Ga0207684_10000107 3300025910 Bacteria 157396
98 Ga0207684_10294529 3300025910 Bacteria 1399
99 Ga0207707_10010968 3300025912 Bacteria 7882
100 Ga0207671_10104283 3300025914 Bacteria 2151
101 Ga0207693_10015316 3300025915 Bacteria 6154
102 Ga0207660_10055669 3300025917 Bacteria 2828
103 Ga0207662_10030600 3300025918 Bacteria 3125
104 Ga0207657_10003206 3300025919 Bacteria 17507
105 Ga0207657_10004052 3300025919 Bacteria 15563
106 Ga0207652_10090003 3300025921 Bacteria 2695
107 Ga0207646_10002994 3300025922 Bacteria 19517
108 Ga0207694_10063388 3300025924 Bacteria 2879
109 Ga0207664_10001753 3300025929 Bacteria 14292
110 Ga0207706_10015517 3300025933 Bacteria 6883
111 Ga0207661_10251341 3300025944 Bacteria 1571
112 Ga0207667_10067406 3300025949 Bacteria 3728
113 Ga0207667_10085159 3300025949 Bacteria 3272
114 Ga0207712_10025492 3300025961 Bacteria 3929
115 Ga0207703_10038938 3300026035 Bacteria 3797
116 Ga0207639_10293764 3300026041 Bacteria 1434
117 Ga0207702_10061885 3300026078 Bacteria 3194
118 Ga0207674_10021797 3300026116 Bacteria 6895
119 Ga0207675_100011872 3300026118 Bacteria 8139
120 Ga0207683_10104610 3300026121 Bacteria 2530
121 Ga0207698_10258749 3300026142 Bacteria 1598
122 Ga0207428_10027510 3300027907 Bacteria 4734
123 Ga0207428_10048101 3300027907 Bacteria 3423
124 Ga0268266_10023394 3300028379 Bacteria 5262
125 Ga0307405_10011015 3300031731 Bacteria 4717
126 Ga0307405_10030307 3300031731 Bacteria 3171
127 Ga0307405_10071913 3300031731 Bacteria 2227
128 Ga0307413_10000886 3300031824 Bacteria 10573
129 Ga0307413_10056152 3300031824 Bacteria 2400
130 Ga0307410_10000856 3300031852 Bacteria 12953
131 Ga0307410_10010886 3300031852 Bacteria 5178
132 Ga0307406_10001936 3300031901 Bacteria 11293
133 Ga0307406_10073812 3300031901 Unclassified 2244
134 Ga0307406_10117223 3300031901 Bacteria 1844
135 Ga0307407_10005207 3300031903 Bacteria 5612
136 Ga0307407_10020816 3300031903 Bacteria 3368
137 Ga0307412_10136470 3300031911 Bacteria 1790
138 Ga0307409_100000388 3300031995 Bacteria 18624
139 Ga0307409_100000730 3300031995 Bacteria 14720
140 Ga0307409_100005628 3300031995 Bacteria 7247
141 Ga0307416_100000220 3300032002 Bacteria 30200
142 Ga0307416_100000921 3300032002 Bacteria 15558
143 Ga0307416_100001931 3300032002 Bacteria 11579
144 Ga0307414_10345000 3300032004 Bacteria 1276
145 Ga0307411_10044472 3300032005 Bacteria 2849
146 Ga0307411_10191247 3300032005 Bacteria 1563
147 Ga0307415_100000053 3300032126 Bacteria 49897
148 Ga0307415_100000603 3300032126 Bacteria 15699
149 Ga0307415_100000978 3300032126 Bacteria 13137
150 Ga0307415_100007922 3300032126 Bacteria 5847
151 Ga0307415_100133852 3300032126 Unclassified 1881
152 Ga0373925_0153286 3300037068 Unclassified 1811
153 Ga0395898_0118240 3300037466 Bacteria 2539
154 Ga0395905_0062903 3300037471 Bacteria 3471
155 Ga0395901_0454400 3300038443 Unclassified 1310
156 Ga0436363_1411509 3300039450 Bacteria 4623
157 Ga0439460_0012651 3300042461 Unclassified 2194
158 Ga0466966_0004854 3300044684 Bacteria 8846
159 Ga0466961_0012737 3300044693 Bacteria 5385
160 Ga0466964_0001111 3300044706 Bacteria 9042
161 Ga0451576_0041367 3300045051 Bacteria 4874
162 Ga0466958_0102511 3300045836 Unclassified 1781
163 Ga0466967_0078681 3300045976 Bacteria 2971
164 Ga0495629_0009750 3300046459 Bacteria 7008
165 Ga0495641_0011838 3300046461 Bacteria 4933
166 Ga0495580_0149776 3300046472 Unclassified 1616
167 Ga0495582_0000067 3300046473 Bacteria 53779
168 Ga0495639_0011157 3300046475 Bacteria 3870
169 Ga0495584_0015409 3300046491 Bacteria 3895
170 Ga0495630_0023391 3300046517 Bacteria 4568
171 Ga0495609_0049986 3300046538 Unclassified 1865
172 Ga0495647_0035545 3300046681 Unclassified 1871
173 Ga0495658_0000617 3300046683 Bacteria 19370
174 Ga0495613_0053119 3300046689 Unclassified 2982
175 Ga0495593_0111869 3300047673 Unclassified 1394
176 Ga0496101_0021507 3300048904 Bacteria 4432
177 Ga0496102_0015139 3300048905 Bacteria 6716
178 Ga0496104_0178898 3300048907 Unclassified 2031
179 Ga0496105_0180439 3300048908 Unclassified 1729
180 Ga0496108_0090372 3300048911 Unclassified 2603
181 Ga0496109_0033579 3300048912 Bacteria 4616
182 Ga0496109_0203016 3300048912 Unclassified 1864
183 Ga0496110_0001997 3300048913 Bacteria 15178
184 Ga0496110_0043359 3300048913 Bacteria 3928
185 Ga0496110_0126694 3300048913 Bacteria 2304
186 Ga0496110_0296712 3300048913 Bacteria 1472
187 Ga0496111_0000829 3300048914 Bacteria 16659
188 Ga0496111_0137470 3300048914 Unclassified 1810
189 Ga0496113_0070935 3300048916 Bacteria 2649
190 Ga0496114_0103480 3300048917 Bacteria 2434
191 Ga0496115_0021359 3300048918 Bacteria 5001
192 Ga0501031_0001508 3300049568 Bacteria 14507
193 Ga0501031_0015941 3300049568 Bacteria 4878
194 Ga0501031_0017120 3300049568 Bacteria 4708
195 Ga0501032_0009823 3300049569 Bacteria 6921
196 Ga0501033_0019844 3300049570 Bacteria 5081
197 Ga0501036_0004012 3300049572 Bacteria 11841
198 Ga0501036_0004851 3300049572 Bacteria 10870
199 Ga0501037_0003358 3300049573 Bacteria 11632
200 Ga0501038_0024411 3300049574 Bacteria 5394
201 Ga0501038_0093323 3300049574 Bacteria 2518
202 Ga0501039_0001691 3300049575 Bacteria 16266
203 Ga0501039_0004237 3300049575 Bacteria 10798
204 Ga0501039_0006985 3300049575 Bacteria 8597
205 Ga0501040_0000106 3300049576 Bacteria 42802
206 Ga0501040_0001465 3300049576 Bacteria 14961
207 Ga0501040_0064918 3300049576 Bacteria 2514
208 Ga0501040_0065247 3300049576 Bacteria 2507
209 Ga0501041_0000277 3300049577 Bacteria 24447
210 Ga0501041_0001357 3300049577 Bacteria 13493
211 Ga0501041_0047567 3300049577 Bacteria 2611
212 Ga0501042_0029042 3300049578 Bacteria 3900
213 Ga0501042_0038976 3300049578 Bacteria 3375
214 Ga0501043_0013537 3300049579 Bacteria 6383
215 Ga0501046_0000281 3300049580 Bacteria 51692
216 Ga0501046_0132321 3300049580 Bacteria 1891
217 Ga0501048_0000577 3300049582 Bacteria 26099
218 Ga0501048_0064356 3300049582 Bacteria 2593
219 Ga0501048_0085510 3300049582 Bacteria 2224
220 Ga0501068_0053562 3300049584 Unclassified 2443
221 Ga0501069_0000848 3300049585 Bacteria 14466
222 Ga0501070_0007384 3300049586 Bacteria 9335
223 Ga0501071_0000459 3300049587 Bacteria 20559
224 Ga0501071_0000743 3300049587 Bacteria 17223
225 Ga0501072_0105340 3300049588 Bacteria 2242
226 Ga0501072_0170725 3300049588 Bacteria 1735
227 Ga0501074_0001401 3300049590 Bacteria 16044
228 Ga0501074_0001509 3300049590 Bacteria 15709
229 Ga0501074_0035127 3300049590 Bacteria 3632
230 Ga0501075_0001319 3300049591 Bacteria 16095
231 Ga0501075_0004115 3300049591 Bacteria 9825
232 Ga0501076_0001376 3300049592 Bacteria 16285
233 Ga0501076_0002100 3300049592 Bacteria 13661
234 Ga0501076_0096079 3300049592 Bacteria 2386
235 Ga0501076_0156903 3300049592 Unclassified 1853
236 Ga0501077_0013385 3300049593 Bacteria 5145
237 Ga0501079_0000545 3300049741 Bacteria 24552
238 Ga0501079_0103037 3300049741 Bacteria 2213
239 Ga0501080_0005300 3300049742 Bacteria 11488
240 Ga0501080_0067845 3300049742 Bacteria 3318
241 Ga0501080_0086023 3300049742 Bacteria 2921
242 Ga0501081_0000109 3300049743 Bacteria 35087
243 Ga0501081_0038392 3300049743 Bacteria 3271
244 Ga0501081_0208862 3300049743 Bacteria 1417
245 Ga0501035_0009240 3300049822 Bacteria 9166
246 Ga0501035_0042540 3300049822 Bacteria 4097
247 Ga0501045_0000173 3300049824 Bacteria 35351
248 Ga0501045_0000883 3300049824 Bacteria 19490
249 Ga0501045_0023571 3300049824 Bacteria 4414
250 nmdc:mga05p37_417416_c1 3300050507 Bacteria 1562
251 nmdc:mga06r32_4737_c1 3300050510 Bacteria 12228
252 nmdc:mga08y16_419945_c1 3300050511 Bacteria 1367
253 nmdc:mga08y16_89014_c1 3300050511 Bacteria 3217
254 nmdc:mga0n895_41882_c1 3300050512 Bacteria 4454
255 nmdc:mga0a205_2375_c1 3300050515 Bacteria 16597
256 Ga0501084_0003588 3300054114 Bacteria 12599
257 Ga0501084_0008171 3300054114 Bacteria 8630
258 Ga0501084_0103217 3300054114 Bacteria 2394
259 Ga0501084_0172616 3300054114 Bacteria 1825
260 Ga0590077_016739 3300059426 Bacteria 1539
261 Ga0501082_0001310 3300060353 Bacteria 21805
262 Ga0501082_0021379 3300060353 Bacteria 5581
263 Ga0501082_0026488 3300060353 Bacteria 4997
264 Ga0530510_0001222 3300061734 Bacteria 17159
265 Ga0530510_0034665 3300061734 Bacteria 3636
266 Ga0081539_10004150
267 JGI25407J50210_10001859
268 JGI25407J50210_10006349
269 JGI25407J50210_10021873
270 Ga0070658_10015538
271 Ga0070683_100006078
272 Ga0070683_100032268
273 Ga0070683_100196211
274 Ga0070683_100243269
275 Ga0070680_100040412
276 Ga0070682_100004194
277 Ga0068868_100129120
278 Ga0070660_100003041
279 Ga0070661_100005619
280 Ga0070668_100086174
281 Ga0070659_100033657
282 Ga0070714_100000510
283 Ga0070711_100011827
284 Ga0070705_100093976
285 Ga0070708_100022981
286 Ga0070708_100201656
287 Ga0070708_100241791
288 Ga0070678_100146191
289 Ga0070662_100033775
290 Ga0070681_10060718
291 Ga0068867_100204646
292 Ga0070706_100000232
293 Ga0070706_100035925
294 Ga0070707_100074359
295 Ga0070698_100099047
296 Ga0070679_100013574
297 Ga0070684_100118189
298 Ga0070686_100076764
299 Ga0070695_100032003
300 Ga0070696_100227037
301 Ga0070665_100057845
302 Ga0068855_100019357
303 Ga0068855_100122683
304 Ga0068856_100036530
305 Ga0068852_100115548
306 Ga0068852_100122171
307 Ga0068864_100006054
308 Ga0068861_100051152
309 Ga0068858_100119848
310 Ga0068862_100109168
311 Ga0081455_10003669
312 Ga0081455_10044569
313 Ga0081455_10084125
314 Ga0081538_10000893
315 Ga0081538_10000921
316 Ga0081538_10002754
317 Ga0081538_10005158
318 Ga0081538_10006963
319 Ga0081538_10010586
320 Ga0081538_10050465
321 Ga0081538_10058524
322 Ga0081540_1001926
323 Ga0081540_1009279
324 Ga0081540_1013635
325 Ga0081539_10004245
326 Ga0081539_10013752
327 Ga0070717_10001622
328 Ga0070712_100014899
329 Ga0075428_100111058
330 Ga0075431_100029607
331 Ga0075433_10010529
332 Ga0075434_100336308
333 Ga0075435_100155383
334 Ga0111539_10075870
335 Ga0111539_10149897
336 Ga0111539_10543311
337 Ga0105245_10005884
338 Ga0105245_10048406
339 Ga0114129_10064313
340 Ga0114129_10236884
341 Ga0114129_10439857
342 Ga0105248_10446910
343 Ga0105237_10049150
344 Ga0105238_10060467
345 Ga0105239_10028434
346 Ga0105239_10069539
347 Ga0105246_10001099
348 Ga0157370_10098879
349 Ga0157369_10036759
350 Ga0157369_10127432
351 Ga0157374_10048779
352 Ga0163162_10045280
353 Ga0163162_10212195
354 Ga0157372_10002574
355 Ga0157372_10087841
356 Ga0157375_10030901
357 Ga0163163_10041596
358 Ga0157379_10024705
359 Ga0207688_10006991
360 Ga0207647_10011449
361 Ga0207705_10177471
362 Ga0207684_10000107
363 Ga0207684_10294529
364 Ga0207707_10010968
365 Ga0207671_10104283
366 Ga0207693_10015316
367 Ga0207660_10055669
368 Ga0207662_10030600
369 Ga0207657_10003206
370 Ga0207657_10004052
371 Ga0207652_10090003
372 Ga0207646_10002994
373 Ga0207694_10063388
374 Ga0207664_10001753
375 Ga0207706_10015517
376 Ga0207661_10251341
377 Ga0207667_10067406
378 Ga0207667_10085159
379 Ga0207712_10025492
380 Ga0207703_10038938
381 Ga0207639_10293764
382 Ga0207702_10061885
383 Ga0207674_10021797
384 Ga0207675_100011872
385 Ga0207683_10104610
386 Ga0207698_10258749
387 Ga0207428_10027510
388 Ga0207428_10048101
389 Ga0268266_10023394
390 Ga0307405_10011015
391 Ga0307405_10030307
392 Ga0307405_10071913
393 Ga0307413_10000886
394 Ga0307413_10056152
395 Ga0307410_10000856
396 Ga0307410_10010886
397 Ga0307406_10001936
398 Ga0307406_10073812
399 Ga0307406_10117223
400 Ga0307407_10005207
401 Ga0307407_10020816
402 Ga0307412_10136470
403 Ga0307409_100000388
404 Ga0307409_100000730
405 Ga0307409_100005628
406 Ga0307416_100000220
407 Ga0307416_100000921
408 Ga0307416_100001931
409 Ga0307414_10345000
410 Ga0307411_10044472
411 Ga0307411_10191247
412 Ga0307415_100000053
413 Ga0307415_100000603
414 Ga0307415_100000978
415 Ga0307415_100007922
416 Ga0307415_100133852
417 Ga0373925_0153286
418 Ga0395898_0118240
419 Ga0395905_0062903
420 Ga0395901_0454400
421 Ga0436363_1411509
422 Ga0439460_0012651
423 Ga0466966_0004854
424 Ga0466961_0012737
425 Ga0466964_0001111
426 Ga0451576_0041367
427 Ga0466958_0102511
428 Ga0466967_0078681
429 Ga0495629_0009750
430 Ga0495641_0011838
431 Ga0495580_0149776
432 Ga0495582_0000067
433 Ga0495639_0011157
434 Ga0495584_0015409
435 Ga0495630_0023391
436 Ga0495609_0049986
437 Ga0495647_0035545
438 Ga0495658_0000617
439 Ga0495613_0053119
440 Ga0495593_0111869
441 Ga0496101_0021507
442 Ga0496102_0015139
443 Ga0496104_0178898
444 Ga0496105_0180439
445 Ga0496108_0090372
446 Ga0496109_0033579
447 Ga0496109_0203016
448 Ga0496110_0001997
449 Ga0496110_0043359
450 Ga0496110_0126694
451 Ga0496110_0296712
452 Ga0496111_0000829
453 Ga0496111_0137470
454 Ga0496113_0070935
455 Ga0496114_0103480
456 Ga0496115_0021359
457 Ga0501031_0001508
458 Ga0501031_0015941
459 Ga0501031_0017120
460 Ga0501032_0009823
461 Ga0501033_0019844
462 Ga0501036_0004012
463 Ga0501036_0004851
464 Ga0501037_0003358
465 Ga0501038_0024411
466 Ga0501038_0093323
467 Ga0501039_0001691
468 Ga0501039_0004237
469 Ga0501039_0006985
470 Ga0501040_0000106
471 Ga0501040_0001465
472 Ga0501040_0064918
473 Ga0501040_0065247
474 Ga0501041_0000277
475 Ga0501041_0001357
476 Ga0501041_0047567
477 Ga0501042_0029042
478 Ga0501042_0038976
479 Ga0501043_0013537
480 Ga0501046_0000281
481 Ga0501046_0132321
482 Ga0501048_0000577
483 Ga0501048_0064356
484 Ga0501048_0085510
485 Ga0501068_0053562
486 Ga0501069_0000848
487 Ga0501070_0007384
488 Ga0501071_0000459
489 Ga0501071_0000743
490 Ga0501072_0105340
491 Ga0501072_0170725
492 Ga0501074_0001401
493 Ga0501074_0001509
494 Ga0501074_0035127
495 Ga0501075_0001319
496 Ga0501075_0004115
497 Ga0501076_0001376
498 Ga0501076_0002100
499 Ga0501076_0096079
500 Ga0501076_0156903
501 Ga0501077_0013385
502 Ga0501079_0000545
503 Ga0501079_0103037
504 Ga0501080_0005300
505 Ga0501080_0067845
506 Ga0501080_0086023
507 Ga0501081_0000109
508 Ga0501081_0038392
509 Ga0501081_0208862
510 Ga0501035_0009240
511 Ga0501035_0042540
512 Ga0501045_0000173
513 Ga0501045_0000883
514 Ga0501045_0023571
515 nmdc:mga05p37_417416_c1
516 nmdc:mga06r32_4737_c1
517 nmdc:mga08y16_419945_c1
518 nmdc:mga08y16_89014_c1
519 nmdc:mga0n895_41882_c1
520 nmdc:mga0a205_2375_c1
521 Ga0501084_0003588
522 Ga0501084_0008171
523 Ga0501084_0103217
524 Ga0501084_0172616
525 Ga0590077_016739
526 Ga0501082_0001310
527 Ga0501082_0021379
528 Ga0501082_0026488
529 Ga0530510_0001222
530 Ga0530510_0034665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00743

FMO-like

Flavin-binding monooxygenase-like

116

213

0.89

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

72

205

0.88

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

11

221

0.88

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

8

218

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eef-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to octopamine 0.9927 8 38
3hdq-assembly1.cif.gz_A crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate 0.9335 7 38
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.925 7 38
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9166 7 39
4mo2-assembly1.cif.gz_B-2 crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni 0.9046 7 39
ID Description Score Start End Superfamily
af_Q9VHN8_37_550_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9451 5 38 3.50.50.60
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 8 37 3.40.50.720
2d5cB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9142 161 193 3.40.50.720
1eehA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9126 7 38 3.40.50.720
af_F1Q9R5_2_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9106 7 37 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535J3Z0-F1-model_v4 FAD-dependent oxidoreductase 0.9739 61 403 GO:0004497
GO:0050660
AF-W9G7R2-F1-model_v4 FAD-dependent oxidoreductase 0.9704 1 407 GO:0004497
GO:0050660
AF-A0A535Z7R0-F1-model_v4 FAD-dependent oxidoreductase 0.9694 4 325 GO:0004497
GO:0050660
AF-W9G7R2-F1-model_v4 FAD-dependent oxidoreductase 0.968 1 407 GO:0004497
GO:0050660
AF-A0A853CVT6-F1-model_v4 Putative flavoprotein involved in K+ transport 0.9667 7 404 GO:0004497
GO:0050660

Map