F373187

General Info

Members Datasets Scaffolds Average Seq Length
265 180 530 346

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100572201|Ga0068859_1005722011
Length 369
Sequence MAWFKVGVTTPTYFGDQAMEGSIQLWASERKTLLDVVKTGHNHEQRLRAHLLLLLADGFSWSTIAGVLFTSSSTINRWRQRFVAGGLAAVIDAAGRRRPSRLSLLWIGVIFRWITTQTPIDYGFVRSRWTCGTVVMLLKEDFGVQVGRETVRRWLHQKDLVYRRPRPVLGPKDPQRPYKLRKIRALLRHLPANEIAVFQDEVDVNTNPKIGSMWMRRGQQAEVVTPGTNTKRYLAGSLNWRTGELILTEGAQRNADLFLAHLDDLRRRYRRYRVIHVICDNGAFHKPDRCRKVKQYLEKWGCRVKLHFLPTYAPETNPIERVWWHLHEEITRNHRCKNIDELLDLVFDWLDAGSSFPIENSVYDSAKAA

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
7 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 6.04
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 32.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100572201 3300005617 Bacteria 1224
2 JGI24739J22299_10061766 3300001989 Unclassified 1183
3 JGI24751J29686_10025641 3300002459 Bacteria 1224
4 JGI25406J46586_10044722 3300003203 Bacteria 1531
5 JGI25406J46586_10050108 3300003203 Bacteria 1404
6 JGI25406J46586_10056132 3300003203 Bacteria 1294
7 JGI26145J50221_1003825 3300003371 Unclassified 1208
8 JGI26131J50246_100614 3300003400 Unclassified 1188
9 JGI26141J51220_1001987 3300003503 Unclassified 1245
10 Ga0070683_100246936 3300005329 Bacteria 1697
11 Ga0070683_100422229 3300005329 Unclassified 1272
12 Ga0070670_100167004 3300005331 Bacteria 1908
13 Ga0070680_100353899 3300005336 Bacteria 1249
14 Ga0070682_100280458 3300005337 Unclassified 1214
15 Ga0068868_100239452 3300005338 Bacteria 1524
16 Ga0070689_100329696 3300005340 Bacteria 1276
17 Ga0070689_100424818 3300005340 Bacteria 1127
18 Ga0070661_100217826 3300005344 Unclassified 1463
19 Ga0070671_100436615 3300005355 Unclassified 1122
20 Ga0070694_100158883 3300005444 Bacteria 1657
21 Ga0070681_10345089 3300005458 Bacteria 1399
22 Ga0070681_10437838 3300005458 Unclassified 1219
23 Ga0070698_100299158 3300005471 Unclassified 1540
24 Ga0070679_100389265 3300005530 Unclassified 1340
25 Ga0070684_100056474 3300005535 Bacteria 3427
26 Ga0070684_100206356 3300005535 Bacteria 1791
27 Ga0070684_100233915 3300005535 Unclassified 1678
28 Ga0068853_100329844 3300005539 Unclassified 1416
29 Ga0068855_100437393 3300005563 Unclassified 1429
30 Ga0068857_100433997 3300005577 Unclassified 1226
31 Ga0068854_100257783 3300005578 Bacteria 1395
32 Ga0068854_100281887 3300005578 Unclassified 1338
33 Ga0068856_100419705 3300005614 Unclassified 1358
34 Ga0068852_100385758 3300005616 Unclassified 1375
35 Ga0068852_100452541 3300005616 Unclassified 1271
36 Ga0068852_100532363 3300005616 Bacteria 1173
37 Ga0068858_100313509 3300005842 Bacteria 1498
38 Ga0081538_10022706 3300005981 Plasmid 4537
39 Ga0081539_10046066 3300005985 Bacteria 2502
40 Ga0081539_10063948 3300005985 Bacteria 2004
41 Ga0081539_10085420 3300005985 Unclassified 1646
42 Ga0081539_10104153 3300005985 Bacteria 1441
43 Ga0070717_10150869 3300006028 Bacteria 2011
44 Ga0075363_100069113 3300006048 Bacteria 1916
45 Ga0097621_100235939 3300006237 Bacteria 1598
46 Ga0068871_100259743 3300006358 Bacteria 1515
47 Ga0075428_100083118 3300006844 Bacteria 3493
48 Ga0075428_100344539 3300006844 Unclassified 1600
49 Ga0075428_100463324 3300006844 Unclassified 1357
50 Ga0075430_100284926 3300006846 Unclassified 1367
51 Ga0075431_100466273 3300006847 Unclassified 1257
52 Ga0075433_10185657 3300006852 Bacteria 1850
53 Ga0075433_10231449 3300006852 Bacteria 1641
54 Ga0075433_10258882 3300006852 Bacteria 1543
55 Ga0075434_100093476 3300006871 Plasmid 3011
56 Ga0075434_100390245 3300006871 Bacteria 1413
57 Ga0075434_100478154 3300006871 Bacteria 1267
58 Ga0075429_100339499 3300006880 Unclassified 1315
59 Ga0097620_100572194 3300006931 Bacteria 1224
60 Ga0075435_100409398 3300007076 Bacteria 1167
61 Ga0105245_10446418 3300009098 Bacteria 1301
62 Ga0114129_10308084 3300009147 Bacteria 2109
63 Ga0105241_10348294 3300009174 Unclassified 1285
64 Ga0105242_10464493 3300009176 Bacteria 1196
65 Ga0105237_10140061 3300009545 Bacteria 2413
66 Ga0105237_10270586 3300009545 Unclassified 1702
67 Ga0105249_10342839 3300009553 Bacteria 1511
68 Ga0105239_10345963 3300010375 Unclassified 1678
69 Ga0105239_10470029 3300010375 Unclassified 1428
70 Ga0105239_10541383 3300010375 Bacteria 1326
71 Ga0157370_10246036 3300013104 Unclassified 1654
72 Ga0157369_10473585 3300013105 Unclassified 1296
73 Ga0163162_10578409 3300013306 Bacteria 1250
74 Ga0157372_10623279 3300013307 Unclassified 1257
75 Ga0157380_10286616 3300014326 Unclassified 1510
76 Ga0157379_10289357 3300014968 Bacteria 1492
77 Ga0157376_10222018 3300014969 Bacteria 1751
78 Ga0213873_10012123 3300021358 Unclassified 1863
79 Ga0213873_10030145 3300021358 Bacteria 1341
80 Ga0213873_10032809 3300021358 Bacteria 1299
81 Ga0213872_10064907 3300021361 Bacteria 1648
82 Ga0213872_10081285 3300021361 Bacteria 1456
83 Ga0213872_10115632 3300021361 Bacteria 1188
84 Ga0213876_10113702 3300021384 Unclassified 1436
85 Ga0213871_10029959 3300021441 Bacteria 1413
86 Ga0213871_10032980 3300021441 Bacteria 1360
87 Ga0213871_10045484 3300021441 Bacteria 1189
88 Ga0213871_10047705 3300021441 Bacteria 1165
89 Ga0224571_102246 3300022734 Unclassified 1227
90 Ga0207707_10222642 3300025912 Unclassified 1642
91 Ga0207707_10380639 3300025912 Bacteria 1213
92 Ga0207671_10207330 3300025914 Bacteria 1532
93 Ga0207671_10316736 3300025914 Unclassified 1234
94 Ga0207660_10346087 3300025917 Bacteria 1191
95 Ga0207650_10283598 3300025925 Bacteria 1349
96 Ga0207686_10300038 3300025934 Bacteria 1193
97 Ga0207661_10212406 3300025944 Bacteria 1706
98 Ga0207661_10233287 3300025944 Bacteria 1630
99 Ga0207667_10208743 3300025949 Unclassified 2002
100 Ga0207667_10519425 3300025949 Unclassified 1206
101 Ga0207712_10175563 3300025961 Bacteria 1678
102 Ga0207712_10315863 3300025961 Bacteria 1287
103 Ga0207677_10368908 3300026023 Bacteria 1208
104 Ga0207703_10354713 3300026035 Bacteria 1351
105 Ga0207639_10414634 3300026041 Unclassified 1216
106 Ga0207674_10104918 3300026116 Bacteria 2804
107 Ga0207675_100201094 3300026118 Bacteria 1914
108 Ga0207698_10315429 3300026142 Bacteria 1462
109 Ga0207698_10466718 3300026142 Unclassified 1222
110 Ga0207698_10551417 3300026142 Bacteria 1130
111 Ga0209969_1009286 3300027360 Unclassified 1400
112 Ga0209967_1011763 3300027364 Bacteria 1231
113 Ga0209981_1011491 3300027378 Bacteria 1221
114 Ga0209984_1008372 3300027424 Unclassified 1301
115 Ga0210000_1014227 3300027462 Unclassified 1191
116 Ga0209995_1012461 3300027471 Bacteria 1388
117 Ga0209968_1010907 3300027526 Unclassified 1401
118 Ga0209999_1017638 3300027543 Unclassified 1302
119 Ga0209982_1008681 3300027552 Bacteria 1493
120 Ga0209970_1012951 3300027614 Unclassified 1379
121 Ga0209983_1017754 3300027665 Unclassified 1474
122 Ga0209971_1023302 3300027682 Unclassified 1476
123 Ga0209971_1034471 3300027682 Bacteria 1216
124 Ga0209974_10013864 3300027876 Bacteria 2686
125 Ga0265313_10124503 3300031595 Bacteria 1122
126 Ga0265314_10204187 3300031711 Bacteria 1166
127 Ga0373926_0050194 3300035083 Bacteria 1503
128 Ga0373944_0038044 3300035089 Bacteria 1476
129 Ga0373949_0025255 3300035090 Unclassified 1385
130 Ga0373932_0042420 3300035112 Bacteria 1319
131 Ga0373941_0095400 3300035115 Bacteria 1027
132 Ga0373943_0092221 3300035170 Bacteria 1570
133 Ga0373946_0044585 3300035171 Bacteria 1831
134 Ga0373931_0189248 3300035691 Bacteria 1223
135 Ga0373935_0108790 3300035692 Bacteria 1837
136 Ga0373927_0141216 3300035695 Bacteria 1575
137 Ga0373927_0196646 3300035695 Unclassified 1323
138 Ga0373947_0108749 3300035725 Bacteria 1749
139 Ga0373947_0145420 3300035725 Unclassified 1524
140 Ga0373937_0311530 3300036401 Bacteria 1489
141 Ga0373925_0154074 3300037068 Bacteria 1806
142 Ga0373925_0385203 3300037068 Unclassified 1142
143 Ga0436365_0232783 3300039437 Bacteria 1334
144 Ga0436365_1311455 3300039437 Unclassified 2031
145 Ga0436360_0265047 3300039438 Unclassified 1398
146 Ga0436360_0832817 3300039438 Bacteria 3359
147 Ga0436360_0857607 3300039438 Bacteria 1690
148 Ga0436360_1264241 3300039438 Bacteria 1349
149 Ga0436361_0301208 3300039447 Bacteria 1365
150 Ga0436361_0707306 3300039447 Bacteria 3555
151 Ga0436361_0911048 3300039447 Unclassified 3356
152 Ga0436361_0919079 3300039447 Bacteria 3823
153 Ga0436361_1161323 3300039447 Bacteria 1677
154 Ga0436363_0507073 3300039450 Bacteria 1144
155 Ga0436362_0619357 3300039453 Bacteria 1500
156 Ga0436362_0926871 3300039453 Bacteria 1576
157 Ga0436362_0979919 3300039453 Bacteria 2569
158 Ga0436362_1048617 3300039453 Unclassified 1220
159 Ga0436362_1055725 3300039453 Bacteria 1252
160 Ga0466964_0120453 3300044706 Unclassified 1182
161 Ga0466967_0212968 3300045976 Unclassified 1833
162 Ga0495629_0098933 3300046459 Bacteria 2035
163 Ga0495641_0082422 3300046461 Bacteria 1440
164 Ga0495580_0187003 3300046472 Bacteria 1429
165 Ga0495582_0055454 3300046473 Bacteria 2184
166 Ga0495639_0104717 3300046475 Bacteria 1338
167 Ga0495662_0081675 3300046476 Bacteria 1572
168 Ga0495628_0277346 3300046516 Bacteria 1246
169 Ga0495666_0130305 3300046526 Bacteria 1175
170 Ga0495642_0135598 3300046528 Unclassified 1061
171 Ga0495652_0274610 3300046529 Unclassified 1237
172 Ga0495665_0080579 3300046531 Bacteria 1712
173 Ga0495640_0158006 3300046533 Bacteria 1454
174 Ga0495621_0070065 3300046539 Bacteria 1290
175 Ga0495647_0059315 3300046681 Bacteria 1506
176 Ga0495658_0157724 3300046683 Bacteria 1397
177 Ga0495613_0226631 3300046689 Bacteria 1310
178 Ga0495624_0180285 3300046690 Bacteria 1287
179 Ga0495589_0111384 3300046794 Unclassified 1321
180 Ga0495581_0123449 3300047315 Bacteria 1507
181 Ga0495676_0150001 3300047321 Bacteria 1660
182 Ga0495593_0099140 3300047673 Bacteria 1495
183 Ga0495614_0087196 3300048089 Bacteria 1355
184 Ga0496100_0166400 3300048903 Bacteria 1584
185 Ga0496101_0080000 3300048904 Bacteria 2413
186 Ga0496102_0158645 3300048905 Bacteria 2127
187 Ga0496103_0221969 3300048906 Bacteria 1215
188 Ga0496104_0414362 3300048907 Bacteria 1259
189 Ga0496106_0213835 3300048909 Bacteria 1536
190 Ga0496107_0274580 3300048910 Bacteria 1254
191 Ga0496108_0126955 3300048911 Bacteria 2190
192 Ga0496109_0384141 3300048912 Bacteria 1326
193 Ga0496110_0058637 3300048913 Bacteria 3390
194 Ga0496110_0265487 3300048913 Bacteria 1562
195 Ga0496111_0035290 3300048914 Bacteria 3573
196 Ga0496111_0262083 3300048914 Bacteria 1282
197 Ga0496114_0319553 3300048917 Bacteria 1371
198 Ga0496115_0231441 3300048918 Bacteria 1524
199 Ga0496115_0299205 3300048918 Bacteria 1318
200 Ga0496126_0171803 3300048929 Bacteria 1846
201 Ga0501032_0203626 3300049569 Bacteria 1291
202 Ga0501036_0286092 3300049572 Bacteria 1379
203 Ga0501037_0229109 3300049573 Unclassified 1305
204 Ga0501038_0272766 3300049574 Bacteria 1333
205 Ga0501038_0466681 3300049574 Bacteria 969
206 Ga0501040_0209367 3300049576 Unclassified 1386
207 Ga0501040_0219797 3300049576 Unclassified 1351
208 Ga0501040_0291951 3300049576 Bacteria 1165
209 Ga0501042_0213309 3300049578 Bacteria 1392
210 Ga0501046_0212488 3300049580 Bacteria 1435
211 Ga0501048_0174833 3300049582 Bacteria 1522
212 Ga0501048_0199731 3300049582 Bacteria 1417
213 Ga0501070_0072385 3300049586 Bacteria 2853
214 Ga0501070_0311872 3300049586 Bacteria 1280
215 Ga0501071_0127513 3300049587 Bacteria 1889
216 Ga0501071_0205937 3300049587 Unclassified 1478
217 Ga0501071_0349870 3300049587 Bacteria 1124
218 Ga0501072_0086265 3300049588 Bacteria 2491
219 Ga0501072_0202769 3300049588 Bacteria 1581
220 Ga0501072_0273467 3300049588 Bacteria 1344
221 Ga0501072_0306558 3300049588 Bacteria 1262
222 Ga0501073_0252398 3300049589 Unclassified 1217
223 Ga0501073_0283112 3300049589 Unclassified 1144
224 Ga0501074_0190464 3300049590 Unclassified 1462
225 Ga0501075_0245424 3300049591 Bacteria 1365
226 Ga0501075_0289722 3300049591 Unclassified 1247
227 Ga0501076_0185064 3300049592 Bacteria 1698
228 Ga0501076_0322846 3300049592 Unclassified 1266
229 Ga0501076_0325292 3300049592 Bacteria 1261
230 Ga0501076_0353792 3300049592 Bacteria 1206
231 Ga0501077_0131838 3300049593 Unclassified 1584
232 Ga0501080_0316945 3300049742 Bacteria 1412
233 Ga0501080_0345806 3300049742 Unclassified 1343
234 Ga0501081_0162672 3300049743 Bacteria 1609
235 Ga0501083_0102557 3300049744 Bacteria 1886
236 Ga0501083_0110295 3300049744 Unclassified 1809
237 Ga0501083_0154075 3300049744 Unclassified 1504
238 Ga0501035_0250463 3300049822 Bacteria 1504
239 Ga0501035_0364913 3300049822 Unclassified 1206
240 nmdc:mga03n38_46579_c1 3300050490 Bacteria 1915
241 nmdc:mga05p37_326949_c1 3300050507 Bacteria 1813
242 nmdc:mga09592_332822_c1 3300050508 Unclassified 1315
243 nmdc:mga0qj67_322293_c1 3300050509 Unclassified 1251
244 nmdc:mga06r32_301796_c1 3300050510 Bacteria 1587
245 nmdc:mga06r32_493927_c1 3300050510 Unclassified 1201
246 nmdc:mga0n895_264209_c1 3300050512 Bacteria 1746
247 nmdc:mga0rr50_237003_c1 3300050513 Bacteria 1511
248 nmdc:mga0a205_245254_c1 3300050515 Bacteria 1672
249 nmdc:mga0a205_296640_c1 3300050515 Bacteria 1490
250 nmdc:mga0a205_355102_c1 3300050515 Bacteria 1333
251 nmdc:mga0a205_373902_c1 3300050515 Unclassified 1291
252 Ga0495601_0148812 3300053077 Bacteria 1528
253 Ga0500610_0122368 3300053079 Unclassified 1329
254 Ga0495595_0076691 3300053084 Bacteria 1587
255 Ga0495619_0187054 3300053085 Unclassified 1433
256 Ga0501084_0044366 3300054114 Plasmid 3722
257 Ga0501084_0271617 3300054114 Bacteria 1431
258 Ga0501084_0283420 3300054114 Bacteria 1399
259 Ga0501084_0344606 3300054114 Unclassified 1258
260 Ga0501082_0108366 3300060353 Unclassified 2404
261 Ga0501082_0370966 3300060353 Bacteria 1248
262 Ga0501082_0384005 3300060353 Unclassified 1225
263 Ga0501082_0409577 3300060353 Bacteria 1183
264 Ga0530510_0123004 3300061734 Bacteria 1906
265 Ga0530510_0357507 3300061734 Bacteria 1097
266 Ga0068859_100572201
267 JGI24739J22299_10061766
268 JGI24751J29686_10025641
269 JGI25406J46586_10044722
270 JGI25406J46586_10050108
271 JGI25406J46586_10056132
272 JGI26145J50221_1003825
273 JGI26131J50246_100614
274 JGI26141J51220_1001987
275 Ga0070683_100246936
276 Ga0070683_100422229
277 Ga0070670_100167004
278 Ga0070680_100353899
279 Ga0070682_100280458
280 Ga0068868_100239452
281 Ga0070689_100329696
282 Ga0070689_100424818
283 Ga0070661_100217826
284 Ga0070671_100436615
285 Ga0070694_100158883
286 Ga0070681_10345089
287 Ga0070681_10437838
288 Ga0070698_100299158
289 Ga0070679_100389265
290 Ga0070684_100056474
291 Ga0070684_100206356
292 Ga0070684_100233915
293 Ga0068853_100329844
294 Ga0068855_100437393
295 Ga0068857_100433997
296 Ga0068854_100257783
297 Ga0068854_100281887
298 Ga0068856_100419705
299 Ga0068852_100385758
300 Ga0068852_100452541
301 Ga0068852_100532363
302 Ga0068858_100313509
303 Ga0081538_10022706
304 Ga0081539_10046066
305 Ga0081539_10063948
306 Ga0081539_10085420
307 Ga0081539_10104153
308 Ga0070717_10150869
309 Ga0075363_100069113
310 Ga0097621_100235939
311 Ga0068871_100259743
312 Ga0075428_100083118
313 Ga0075428_100344539
314 Ga0075428_100463324
315 Ga0075430_100284926
316 Ga0075431_100466273
317 Ga0075433_10185657
318 Ga0075433_10231449
319 Ga0075433_10258882
320 Ga0075434_100093476
321 Ga0075434_100390245
322 Ga0075434_100478154
323 Ga0075429_100339499
324 Ga0097620_100572194
325 Ga0075435_100409398
326 Ga0105245_10446418
327 Ga0114129_10308084
328 Ga0105241_10348294
329 Ga0105242_10464493
330 Ga0105237_10140061
331 Ga0105237_10270586
332 Ga0105249_10342839
333 Ga0105239_10345963
334 Ga0105239_10470029
335 Ga0105239_10541383
336 Ga0157370_10246036
337 Ga0157369_10473585
338 Ga0163162_10578409
339 Ga0157372_10623279
340 Ga0157380_10286616
341 Ga0157379_10289357
342 Ga0157376_10222018
343 Ga0213873_10012123
344 Ga0213873_10030145
345 Ga0213873_10032809
346 Ga0213872_10064907
347 Ga0213872_10081285
348 Ga0213872_10115632
349 Ga0213876_10113702
350 Ga0213871_10029959
351 Ga0213871_10032980
352 Ga0213871_10045484
353 Ga0213871_10047705
354 Ga0224571_102246
355 Ga0207707_10222642
356 Ga0207707_10380639
357 Ga0207671_10207330
358 Ga0207671_10316736
359 Ga0207660_10346087
360 Ga0207650_10283598
361 Ga0207686_10300038
362 Ga0207661_10212406
363 Ga0207661_10233287
364 Ga0207667_10208743
365 Ga0207667_10519425
366 Ga0207712_10175563
367 Ga0207712_10315863
368 Ga0207677_10368908
369 Ga0207703_10354713
370 Ga0207639_10414634
371 Ga0207674_10104918
372 Ga0207675_100201094
373 Ga0207698_10315429
374 Ga0207698_10466718
375 Ga0207698_10551417
376 Ga0209969_1009286
377 Ga0209967_1011763
378 Ga0209981_1011491
379 Ga0209984_1008372
380 Ga0210000_1014227
381 Ga0209995_1012461
382 Ga0209968_1010907
383 Ga0209999_1017638
384 Ga0209982_1008681
385 Ga0209970_1012951
386 Ga0209983_1017754
387 Ga0209971_1023302
388 Ga0209971_1034471
389 Ga0209974_10013864
390 Ga0265313_10124503
391 Ga0265314_10204187
392 Ga0373926_0050194
393 Ga0373944_0038044
394 Ga0373949_0025255
395 Ga0373932_0042420
396 Ga0373941_0095400
397 Ga0373943_0092221
398 Ga0373946_0044585
399 Ga0373931_0189248
400 Ga0373935_0108790
401 Ga0373927_0141216
402 Ga0373927_0196646
403 Ga0373947_0108749
404 Ga0373947_0145420
405 Ga0373937_0311530
406 Ga0373925_0154074
407 Ga0373925_0385203
408 Ga0436365_0232783
409 Ga0436365_1311455
410 Ga0436360_0265047
411 Ga0436360_0832817
412 Ga0436360_0857607
413 Ga0436360_1264241
414 Ga0436361_0301208
415 Ga0436361_0707306
416 Ga0436361_0911048
417 Ga0436361_0919079
418 Ga0436361_1161323
419 Ga0436363_0507073
420 Ga0436362_0619357
421 Ga0436362_0926871
422 Ga0436362_0979919
423 Ga0436362_1048617
424 Ga0436362_1055725
425 Ga0466964_0120453
426 Ga0466967_0212968
427 Ga0495629_0098933
428 Ga0495641_0082422
429 Ga0495580_0187003
430 Ga0495582_0055454
431 Ga0495639_0104717
432 Ga0495662_0081675
433 Ga0495628_0277346
434 Ga0495666_0130305
435 Ga0495642_0135598
436 Ga0495652_0274610
437 Ga0495665_0080579
438 Ga0495640_0158006
439 Ga0495621_0070065
440 Ga0495647_0059315
441 Ga0495658_0157724
442 Ga0495613_0226631
443 Ga0495624_0180285
444 Ga0495589_0111384
445 Ga0495581_0123449
446 Ga0495676_0150001
447 Ga0495593_0099140
448 Ga0495614_0087196
449 Ga0496100_0166400
450 Ga0496101_0080000
451 Ga0496102_0158645
452 Ga0496103_0221969
453 Ga0496104_0414362
454 Ga0496106_0213835
455 Ga0496107_0274580
456 Ga0496108_0126955
457 Ga0496109_0384141
458 Ga0496110_0058637
459 Ga0496110_0265487
460 Ga0496111_0035290
461 Ga0496111_0262083
462 Ga0496114_0319553
463 Ga0496115_0231441
464 Ga0496115_0299205
465 Ga0496126_0171803
466 Ga0501032_0203626
467 Ga0501036_0286092
468 Ga0501037_0229109
469 Ga0501038_0272766
470 Ga0501038_0466681
471 Ga0501040_0209367
472 Ga0501040_0219797
473 Ga0501040_0291951
474 Ga0501042_0213309
475 Ga0501046_0212488
476 Ga0501048_0174833
477 Ga0501048_0199731
478 Ga0501070_0072385
479 Ga0501070_0311872
480 Ga0501071_0127513
481 Ga0501071_0205937
482 Ga0501071_0349870
483 Ga0501072_0086265
484 Ga0501072_0202769
485 Ga0501072_0273467
486 Ga0501072_0306558
487 Ga0501073_0252398
488 Ga0501073_0283112
489 Ga0501074_0190464
490 Ga0501075_0245424
491 Ga0501075_0289722
492 Ga0501076_0185064
493 Ga0501076_0322846
494 Ga0501076_0325292
495 Ga0501076_0353792
496 Ga0501077_0131838
497 Ga0501080_0316945
498 Ga0501080_0345806
499 Ga0501081_0162672
500 Ga0501083_0102557
501 Ga0501083_0110295
502 Ga0501083_0154075
503 Ga0501035_0250463
504 Ga0501035_0364913
505 nmdc:mga03n38_46579_c1
506 nmdc:mga05p37_326949_c1
507 nmdc:mga09592_332822_c1
508 nmdc:mga0qj67_322293_c1
509 nmdc:mga06r32_301796_c1
510 nmdc:mga06r32_493927_c1
511 nmdc:mga0n895_264209_c1
512 nmdc:mga0rr50_237003_c1
513 nmdc:mga0a205_245254_c1
514 nmdc:mga0a205_296640_c1
515 nmdc:mga0a205_355102_c1
516 nmdc:mga0a205_373902_c1
517 Ga0495601_0148812
518 Ga0500610_0122368
519 Ga0495595_0076691
520 Ga0495619_0187054
521 Ga0501084_0044366
522 Ga0501084_0271617
523 Ga0501084_0283420
524 Ga0501084_0344606
525 Ga0501082_0108366
526 Ga0501082_0370966
527 Ga0501082_0384005
528 Ga0501082_0409577
529 Ga0530510_0123004
530 Ga0530510_0357507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

196

343

0.97

PF13565

HTH_32

Homeodomain-like domain

74

155

0.96

PF13592

HTH_33

Winged helix-turn helix

126

176

0.95

PF13384

HTH_23

Homeodomain-like domain

42

91

0.94

PF13518

HTH_28

Helix-turn-helix domain

47

100

0.92

PF13551

HTH_29

Winged helix-turn helix

48

104

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k9j-assembly2.cif.gz_A transposase domain of metnase 0.7595 150 327
3f2k-assembly1.cif.gz_A structure of the transposase domain of human histone-lysine n-methyltransferase setmar 0.757 154 341
6u8q-assembly1.cif.gz_P cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome 0.7358 174 325
3f2k-assembly2.cif.gz_B structure of the transposase domain of human histone-lysine n-methyltransferase setmar 0.7341 151 341
7vwv-assembly2.cif.gz_B the crystal structure of african swine fever virus i73r 0.7311 107 149
ID Description Score Start End Superfamily
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.848 21 68 1.10.10.10
af_Q2FUX5_1_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7633 106 146 1.10.10.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7531 169 329 3.30.420.10
af_A0A2R8Q1B5_1_125_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.742 236 330 3.30.420.10
3f2kB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7227 154 341 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7V3JI94-F1-model_v4 IS630 family transposase 0.9443 210 347 GO:0003676
AF-A0A520K9M5-F1-model_v4 Helix-turn-helix domain-containing protein 0.9342 1 72
AF-A0A1I4BNH8-F1-model_v4 Winged helix-turn helix 0.9229 1 72
AF-A0A4R0D7L1-F1-model_v4 Helix-turn-helix domain-containing protein 0.9145 3 72
AF-A0A7V3JI94-F1-model_v4 IS630 family transposase 0.9115 210 347 GO:0003676

Map