F373120

General Info

Members Datasets Scaffolds Average Seq Length
265 178 530 131

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100017618|Ga0070669_1000176185
Length 142
Sequence MTTSHNPDTVKHVRITLTSVLVDGQDKALTFYTEVLGFAPKHDVPMGKHRWITVVSPENPDGAELVLEPGDHPAVKPFQDALVADGIPFTAFAVDDVRAEFERMRGLGVRFTQEPTEMGPVTIAVLDDTCGNLIQIQQVNAA

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
105 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
106 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
107 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 2506783011 Frankia datiscae Dg1 Isolate Nodule
171 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
172 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
173 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
174 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
175 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
176 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
177 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
178 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0.38
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0.75
Rhizoplane 13.21
Rhizosphere 77.36
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100017618 3300005353 Bacteria 5095
2 JGI25405J52794_10036091 3300003911 Bacteria 1036
3 Ga0070658_10062307 3300005327 Bacteria 3039
4 Ga0070676_10149635 3300005328 Bacteria 1493
5 Ga0070683_100051548 3300005329 Bacteria 3811
6 Ga0070670_100024997 3300005331 Bacteria 5139
7 Ga0068868_100176215 3300005338 Bacteria 1772
8 Ga0070691_10245204 3300005341 Bacteria 959
9 Ga0070687_100518378 3300005343 Bacteria 806
10 Ga0070692_10013910 3300005345 Bacteria 3762
11 Ga0070668_100043841 3300005347 Bacteria 3430
12 Ga0070671_100281996 3300005355 Bacteria 1413
13 Ga0070671_100323233 3300005355 Bacteria 1315
14 Ga0070667_100000878 3300005367 Bacteria 27777
15 Ga0070703_10185139 3300005406 Bacteria 807
16 Ga0070694_100078698 3300005444 Bacteria 2287
17 Ga0070678_100185942 3300005456 Bacteria 1705
18 Ga0070662_100004020 3300005457 Bacteria 9226
19 Ga0070685_10636982 3300005466 Bacteria 771
20 Ga0070706_100180148 3300005467 Bacteria 1973
21 Ga0070707_100294323 3300005468 Bacteria 1577
22 Ga0070698_101053554 3300005471 Bacteria 761
23 Ga0070699_100018363 3300005518 Bacteria 6008
24 Ga0070679_101045240 3300005530 Bacteria 761
25 Ga0070684_100037349 3300005535 Bacteria 4166
26 Ga0070697_100049352 3300005536 Bacteria 3416
27 Ga0068853_101447240 3300005539 Bacteria 665
28 Ga0070695_100264078 3300005545 Bacteria 1258
29 Ga0070665_100001679 3300005548 Bacteria 25511
30 Ga0070665_100017154 3300005548 Bacteria 7265
31 Ga0070704_100183053 3300005549 Bacteria 1677
32 Ga0070704_100383557 3300005549 Unclassified 1195
33 Ga0068855_100232451 3300005563 Bacteria 2064
34 Ga0068855_100370424 3300005563 Bacteria 1575
35 Ga0070664_100175090 3300005564 Bacteria 1905
36 Ga0070664_100441365 3300005564 Bacteria 1194
37 Ga0068857_100617313 3300005577 Bacteria 1026
38 Ga0068854_101036031 3300005578 Bacteria 728
39 Ga0068852_100431186 3300005616 Bacteria 1302
40 Ga0068852_100569900 3300005616 Bacteria 1134
41 Ga0068859_100000077 3300005617 Bacteria 91522
42 Ga0068859_100574334 3300005617 Bacteria 1221
43 Ga0068864_100677994 3300005618 Bacteria 1005
44 Ga0068861_100103474 3300005719 Bacteria 2269
45 Ga0068861_100618068 3300005719 Bacteria 997
46 Ga0068861_100797871 3300005719 Bacteria 886
47 Ga0068863_100011696 3300005841 Bacteria 8486
48 Ga0068863_100012013 3300005841 Bacteria 8367
49 Ga0068863_100057682 3300005841 Bacteria 3674
50 Ga0068863_100971601 3300005841 Bacteria 851
51 Ga0068858_100077511 3300005842 Bacteria 3088
52 Ga0068858_101144261 3300005842 Bacteria 764
53 Ga0068860_100000025 3300005843 Bacteria 271553
54 Ga0068860_100025692 3300005843 Bacteria 5680
55 Ga0068860_101279561 3300005843 Unclassified 754
56 Ga0068862_100000003 3300005844 Bacteria 369793
57 Ga0068862_100169488 3300005844 Bacteria 1954
58 Ga0081455_10000491 3300005937 Bacteria 51415
59 Ga0081455_10081631 3300005937 Bacteria 2647
60 Ga0070717_10244741 3300006028 Bacteria 1583
61 Ga0075367_10557360 3300006178 Bacteria 728
62 Ga0097621_100671672 3300006237 Bacteria 952
63 Ga0075370_10091101 3300006353 Bacteria 1759
64 Ga0075431_101571593 3300006847 Bacteria 616
65 Ga0075433_10102885 3300006852 Bacteria 2530
66 Ga0075433_10501031 3300006852 Bacteria 1069
67 Ga0075434_100575762 3300006871 Bacteria 1145
68 Ga0075434_102436652 3300006871 Unclassified 525
69 Ga0075429_101062113 3300006880 Bacteria 707
70 Ga0097620_100000077 3300006931 Bacteria 91522
71 Ga0097620_100574395 3300006931 Bacteria 1221
72 Ga0075435_100333784 3300007076 Bacteria 1299
73 Ga0105250_10431695 3300009092 Bacteria 589
74 Ga0105245_10024032 3300009098 Bacteria 5350
75 Ga0105245_10065889 3300009098 Bacteria 3277
76 Ga0105245_12342606 3300009098 Bacteria 588
77 Ga0105247_10000010 3300009101 Bacteria 302475
78 Ga0105247_10185146 3300009101 Bacteria 1392
79 Ga0105247_10242369 3300009101 Bacteria 1229
80 Ga0114129_10764430 3300009147 Bacteria 1236
81 Ga0105243_12132644 3300009148 Unclassified 596
82 Ga0105241_10344777 3300009174 Bacteria 1292
83 Ga0105242_10615873 3300009176 Bacteria 1051
84 Ga0105248_10000078 3300009177 Bacteria 111935
85 Ga0105248_10809586 3300009177 Bacteria 1057
86 Ga0105238_11016700 3300009551 Bacteria 850
87 Ga0105249_10000010 3300009553 Bacteria 306939
88 Ga0105249_10037382 3300009553 Bacteria 4406
89 Ga0105249_10060051 3300009553 Bacteria 3488
90 Ga0105249_10599292 3300009553 Bacteria 1156
91 Ga0105239_10151981 3300010375 Bacteria 2584
92 Ga0105239_10160780 3300010375 Bacteria 2509
93 Ga0105239_10219186 3300010375 Bacteria 2134
94 Ga0105239_10502312 3300010375 Bacteria 1379
95 Ga0157378_10161464 3300013297 Unclassified 2096
96 Ga0157378_10494877 3300013297 Bacteria 1220
97 Ga0163162_10122786 3300013306 Bacteria 2702
98 Ga0163162_10170065 3300013306 Bacteria 2304
99 Ga0157372_10495908 3300013307 Bacteria 1424
100 Ga0163163_10010995 3300014325 Bacteria 8183
101 Ga0163163_10292910 3300014325 Bacteria 1680
102 Ga0163163_11966279 3300014325 Bacteria 645
103 Ga0157380_10297240 3300014326 Bacteria 1485
104 Ga0157377_11592055 3300014745 Bacteria 523
105 Ga0157379_10049795 3300014968 Bacteria 3741
106 Ga0157379_10307947 3300014968 Bacteria 1444
107 Ga0163161_10635023 3300017792 Bacteria 883
108 Ga0206353_11927377 3300020082 Bacteria 994
109 Ga0207710_10000028 3300025900 Bacteria 304525
110 Ga0207688_10049879 3300025901 Bacteria 2341
111 Ga0207688_10356606 3300025901 Bacteria 902
112 Ga0207645_10136131 3300025907 Bacteria 1600
113 Ga0207654_10506154 3300025911 Bacteria 853
114 Ga0207646_10152758 3300025922 Bacteria 2082
115 Ga0207681_10000465 3300025923 Bacteria 28446
116 Ga0207650_10214056 3300025925 Bacteria 1548
117 Ga0207687_10156798 3300025927 Bacteria 1743
118 Ga0207687_10356948 3300025927 Bacteria 1192
119 Ga0207644_10162510 3300025931 Bacteria 1737
120 Ga0207644_10436293 3300025931 Unclassified 1075
121 Ga0207690_10265894 3300025932 Bacteria 1330
122 Ga0207706_10006550 3300025933 Bacteria 10788
123 Ga0207665_10186037 3300025939 Bacteria 1507
124 Ga0207711_10000069 3300025941 Bacteria 115038
125 Ga0207711_10707533 3300025941 Bacteria 940
126 Ga0207661_10003203 3300025944 Bacteria 11342
127 Ga0207661_10511828 3300025944 Bacteria 1097
128 Ga0207679_10381211 3300025945 Bacteria 1236
129 Ga0207667_10187049 3300025949 Bacteria 2126
130 Ga0207667_10235536 3300025949 Bacteria 1874
131 Ga0207712_10000016 3300025961 Bacteria 343014
132 Ga0207712_10047092 3300025961 Bacteria 2992
133 Ga0207712_10622518 3300025961 Bacteria 936
134 Ga0207668_10079188 3300025972 Bacteria 2376
135 Ga0207658_10000937 3300025986 Bacteria 24071
136 Ga0207677_10324482 3300026023 Bacteria 1281
137 Ga0207703_10653849 3300026035 Bacteria 997
138 Ga0207708_10405362 3300026075 Bacteria 1128
139 Ga0207641_10000862 3300026088 Bacteria 31969
140 Ga0207641_10024767 3300026088 Bacteria 4947
141 Ga0207641_10453639 3300026088 Bacteria 1239
142 Ga0207676_10048453 3300026095 Bacteria 3299
143 Ga0207676_10140358 3300026095 Bacteria 2068
144 Ga0207674_10627285 3300026116 Bacteria 1038
145 Ga0207675_100004577 3300026118 Bacteria 13336
146 Ga0207675_100758050 3300026118 Bacteria 982
147 Ga0207683_10288279 3300026121 Bacteria 1501
148 Ga0207698_10599525 3300026142 Bacteria 1086
149 Ga0268266_10005758 3300028379 Bacteria 11470
150 Ga0268266_10179471 3300028379 Bacteria 1927
151 Ga0268265_10000010 3300028380 Bacteria 370129
152 Ga0268265_10131590 3300028380 Bacteria 2080
153 Ga0268265_10347016 3300028380 Bacteria 1354
154 Ga0268264_10000053 3300028381 Bacteria 320368
155 Ga0268264_10811760 3300028381 Bacteria 935
156 Ga0268264_11244974 3300028381 Unclassified 754
157 Ga0316176_1130098 3300030732 Bacteria 1453
158 Ga0314311_1022187 3300030733 Bacteria 1148
159 Ga0316180_1020708 3300030736 Bacteria 1252
160 Ga0316181_1050906 3300030744 Bacteria 924
161 Ga0307408_101980313 3300031548 Bacteria 560
162 Ga0307413_10775711 3300031824 Bacteria 803
163 Ga0307409_100037002 3300031995 Bacteria 3594
164 Ga0307409_100667212 3300031995 Bacteria 1035
165 Ga0307416_100250344 3300032002 Bacteria 1724
166 Ga0307416_101575641 3300032002 Bacteria 762
167 Ga0307416_102172299 3300032002 Bacteria 657
168 Ga0307416_102231034 3300032002 Bacteria 648
169 Ga0307415_100380191 3300032126 Bacteria 1199
170 Ga0307415_100405382 3300032126 Bacteria 1165
171 Ga0307415_101338108 3300032126 Bacteria 680
172 Ga0373947_0651615 3300035725 Bacteria 718
173 Ga0373925_0208099 3300037068 Bacteria 1558
174 Ga0395899_0461336 3300037312 Bacteria 830
175 Ga0395899_0652803 3300037312 Bacteria 665
176 Ga0395900_1901517 3300037418 Bacteria 506
177 Ga0395898_0000388 3300037466 Bacteria 96035
178 Ga0395898_0316272 3300037466 Bacteria 1489
179 Ga0395898_1215412 3300037466 Bacteria 685
180 Ga0395898_1719143 3300037466 Bacteria 550
181 Ga0395905_0147536 3300037471 Bacteria 2213
182 Ga0395905_0793968 3300037471 Bacteria 850
183 Ga0395905_0968882 3300037471 Bacteria 754
184 Ga0395901_0393358 3300038443 Bacteria 1425
185 Ga0439442_023987 3300042002 Bacteria 1268
186 Ga0451577_0897644 3300042876 Bacteria 798
187 Ga0466965_0192299 3300044683 Bacteria 1080
188 Ga0466966_0155673 3300044684 Bacteria 1392
189 Ga0466966_0901082 3300044684 Bacteria 533
190 Ga0453684_0003458 3300044712 Bacteria 35504
191 Ga0466970_0013475 3300044765 Bacteria 4191
192 Ga0495582_0202371 3300046473 Bacteria 1134
193 Ga0495594_0125242 3300046499 Bacteria 1454
194 Ga0495618_0702119 3300046514 Bacteria 595
195 Ga0495630_0038470 3300046517 Bacteria 3578
196 Ga0495586_0069931 3300046535 Bacteria 1916
197 Ga0495658_0067382 3300046683 Bacteria 2070
198 Ga0495613_0013915 3300046689 Bacteria 5970
199 Ga0495676_0534731 3300047321 Bacteria 767
200 Ga0496100_0004370 3300048903 Bacteria 7485
201 Ga0496100_0017942 3300048903 Bacteria 4188
202 Ga0496101_0010700 3300048904 Bacteria 6064
203 Ga0496101_1019438 3300048904 Unclassified 651
204 Ga0496102_0023051 3300048905 Bacteria 5524
205 Ga0496102_0197449 3300048905 Bacteria 1896
206 Ga0496102_0776493 3300048905 Bacteria 881
207 Ga0496102_1110890 3300048905 Bacteria 710
208 Ga0496103_0000342 3300048906 Bacteria 42444
209 Ga0496103_0462113 3300048906 Bacteria 814
210 Ga0496104_0512838 3300048907 Bacteria 1110
211 Ga0496105_0220753 3300048908 Bacteria 1543
212 Ga0496106_0019911 3300048909 Bacteria 4976
213 Ga0496106_0096390 3300048909 Bacteria 2289
214 Ga0496106_0170540 3300048909 Bacteria 1725
215 Ga0496107_0006464 3300048910 Bacteria 8058
216 Ga0496107_0076269 3300048910 Bacteria 2441
217 Ga0496108_0118560 3300048911 Bacteria 2268
218 Ga0496108_0151553 3300048911 Bacteria 2001
219 Ga0496109_0073869 3300048912 Bacteria 3134
220 Ga0496109_0299459 3300048912 Bacteria 1516
221 Ga0496110_0040176 3300048913 Bacteria 4077
222 Ga0496110_0049585 3300048913 Bacteria 3684
223 Ga0496110_0673685 3300048913 Bacteria 935
224 Ga0496111_0034800 3300048914 Bacteria 3598
225 Ga0496111_0373263 3300048914 Bacteria 1055
226 Ga0496112_0011514 3300048915 Bacteria 8081
227 Ga0496112_0054461 3300048915 Bacteria 3930
228 Ga0496112_0149104 3300048915 Bacteria 2306
229 Ga0496112_0759224 3300048915 Bacteria 896
230 Ga0496113_0180942 3300048916 Bacteria 1671
231 Ga0496113_0419809 3300048916 Unclassified 1074
232 Ga0496115_0330597 3300048918 Bacteria 1245
233 Ga0496115_0574279 3300048918 Bacteria 899
234 Ga0496115_1281995 3300048918 Bacteria 547
235 Ga0496116_0006159 3300048919 Bacteria 10966
236 Ga0496117_0000233 3300048920 Bacteria 105282
237 Ga0496118_0004748 3300048921 Bacteria 15901
238 Ga0496119_0005919 3300048922 Bacteria 11524
239 Ga0496120_0020570 3300048923 Bacteria 4189
240 Ga0496125_0014823 3300048928 Bacteria 7570
241 Ga0496126_0011692 3300048929 Bacteria 9051
242 nmdc:mga03683_431415_c1 3300050489 Bacteria 632
243 nmdc:mga00v17_8860_c1 3300050491 Bacteria 5424
244 nmdc:mga0yw44_49442_c1 3300050492 Bacteria 2538
245 nmdc:mga06z11_121697_c1 3300050494 Bacteria 1456
246 nmdc:mga07m45_135550_c1 3300050496 Bacteria 1425
247 nmdc:mga0n895_229511_c1 3300050512 Bacteria 1884
248 nmdc:mga0rr50_212179_c1 3300050513 Bacteria 1246
249 nmdc:mga0a205_285128_c1 3300050515 Unclassified 1526
250 nmdc:mga0a205_466177_c1 3300050515 Bacteria 1122
251 Ga0495619_0338165 3300053085 Bacteria 1042
252 Ga0500578_0104390 3300053086 Bacteria 1791
253 Ga0500646_0045071 3300053090 Bacteria 1254
254 Ga0500621_176257 3300053126 Bacteria 779
255 Ga0500568_0068342 3300053139 Bacteria 1364
256 Ga0500616_0296999 3300053153 Unclassified 672
257 2506865089 2506783011 Bacteria 5323186
258 2676481015 2675903059 Bacteria 8644972
259 2729907192 2728369276 Bacteria 5610032
260 2784592593 2784132148 Bacteria 8627943
261 2929216010 2929212328 Bacteria 7708288
262 3002999556 3002998708 Bacteria 11715108
263 3006497544 3006493962 Bacteria 8825450
264 8025533651 8025530807 Bacteria 8495698
265 8055162026 8055157932 Bacteria 6429399
266 Ga0070669_100017618
267 JGI25405J52794_10036091
268 Ga0070658_10062307
269 Ga0070676_10149635
270 Ga0070683_100051548
271 Ga0070670_100024997
272 Ga0068868_100176215
273 Ga0070691_10245204
274 Ga0070687_100518378
275 Ga0070692_10013910
276 Ga0070668_100043841
277 Ga0070671_100281996
278 Ga0070671_100323233
279 Ga0070667_100000878
280 Ga0070703_10185139
281 Ga0070694_100078698
282 Ga0070678_100185942
283 Ga0070662_100004020
284 Ga0070685_10636982
285 Ga0070706_100180148
286 Ga0070707_100294323
287 Ga0070698_101053554
288 Ga0070699_100018363
289 Ga0070679_101045240
290 Ga0070684_100037349
291 Ga0070697_100049352
292 Ga0068853_101447240
293 Ga0070695_100264078
294 Ga0070665_100001679
295 Ga0070665_100017154
296 Ga0070704_100183053
297 Ga0070704_100383557
298 Ga0068855_100232451
299 Ga0068855_100370424
300 Ga0070664_100175090
301 Ga0070664_100441365
302 Ga0068857_100617313
303 Ga0068854_101036031
304 Ga0068852_100431186
305 Ga0068852_100569900
306 Ga0068859_100000077
307 Ga0068859_100574334
308 Ga0068864_100677994
309 Ga0068861_100103474
310 Ga0068861_100618068
311 Ga0068861_100797871
312 Ga0068863_100011696
313 Ga0068863_100012013
314 Ga0068863_100057682
315 Ga0068863_100971601
316 Ga0068858_100077511
317 Ga0068858_101144261
318 Ga0068860_100000025
319 Ga0068860_100025692
320 Ga0068860_101279561
321 Ga0068862_100000003
322 Ga0068862_100169488
323 Ga0081455_10000491
324 Ga0081455_10081631
325 Ga0070717_10244741
326 Ga0075367_10557360
327 Ga0097621_100671672
328 Ga0075370_10091101
329 Ga0075431_101571593
330 Ga0075433_10102885
331 Ga0075433_10501031
332 Ga0075434_100575762
333 Ga0075434_102436652
334 Ga0075429_101062113
335 Ga0097620_100000077
336 Ga0097620_100574395
337 Ga0075435_100333784
338 Ga0105250_10431695
339 Ga0105245_10024032
340 Ga0105245_10065889
341 Ga0105245_12342606
342 Ga0105247_10000010
343 Ga0105247_10185146
344 Ga0105247_10242369
345 Ga0114129_10764430
346 Ga0105243_12132644
347 Ga0105241_10344777
348 Ga0105242_10615873
349 Ga0105248_10000078
350 Ga0105248_10809586
351 Ga0105238_11016700
352 Ga0105249_10000010
353 Ga0105249_10037382
354 Ga0105249_10060051
355 Ga0105249_10599292
356 Ga0105239_10151981
357 Ga0105239_10160780
358 Ga0105239_10219186
359 Ga0105239_10502312
360 Ga0157378_10161464
361 Ga0157378_10494877
362 Ga0163162_10122786
363 Ga0163162_10170065
364 Ga0157372_10495908
365 Ga0163163_10010995
366 Ga0163163_10292910
367 Ga0163163_11966279
368 Ga0157380_10297240
369 Ga0157377_11592055
370 Ga0157379_10049795
371 Ga0157379_10307947
372 Ga0163161_10635023
373 Ga0206353_11927377
374 Ga0207710_10000028
375 Ga0207688_10049879
376 Ga0207688_10356606
377 Ga0207645_10136131
378 Ga0207654_10506154
379 Ga0207646_10152758
380 Ga0207681_10000465
381 Ga0207650_10214056
382 Ga0207687_10156798
383 Ga0207687_10356948
384 Ga0207644_10162510
385 Ga0207644_10436293
386 Ga0207690_10265894
387 Ga0207706_10006550
388 Ga0207665_10186037
389 Ga0207711_10000069
390 Ga0207711_10707533
391 Ga0207661_10003203
392 Ga0207661_10511828
393 Ga0207679_10381211
394 Ga0207667_10187049
395 Ga0207667_10235536
396 Ga0207712_10000016
397 Ga0207712_10047092
398 Ga0207712_10622518
399 Ga0207668_10079188
400 Ga0207658_10000937
401 Ga0207677_10324482
402 Ga0207703_10653849
403 Ga0207708_10405362
404 Ga0207641_10000862
405 Ga0207641_10024767
406 Ga0207641_10453639
407 Ga0207676_10048453
408 Ga0207676_10140358
409 Ga0207674_10627285
410 Ga0207675_100004577
411 Ga0207675_100758050
412 Ga0207683_10288279
413 Ga0207698_10599525
414 Ga0268266_10005758
415 Ga0268266_10179471
416 Ga0268265_10000010
417 Ga0268265_10131590
418 Ga0268265_10347016
419 Ga0268264_10000053
420 Ga0268264_10811760
421 Ga0268264_11244974
422 Ga0316176_1130098
423 Ga0314311_1022187
424 Ga0316180_1020708
425 Ga0316181_1050906
426 Ga0307408_101980313
427 Ga0307413_10775711
428 Ga0307409_100037002
429 Ga0307409_100667212
430 Ga0307416_100250344
431 Ga0307416_101575641
432 Ga0307416_102172299
433 Ga0307416_102231034
434 Ga0307415_100380191
435 Ga0307415_100405382
436 Ga0307415_101338108
437 Ga0373947_0651615
438 Ga0373925_0208099
439 Ga0395899_0461336
440 Ga0395899_0652803
441 Ga0395900_1901517
442 Ga0395898_0000388
443 Ga0395898_0316272
444 Ga0395898_1215412
445 Ga0395898_1719143
446 Ga0395905_0147536
447 Ga0395905_0793968
448 Ga0395905_0968882
449 Ga0395901_0393358
450 Ga0439442_023987
451 Ga0451577_0897644
452 Ga0466965_0192299
453 Ga0466966_0155673
454 Ga0466966_0901082
455 Ga0453684_0003458
456 Ga0466970_0013475
457 Ga0495582_0202371
458 Ga0495594_0125242
459 Ga0495618_0702119
460 Ga0495630_0038470
461 Ga0495586_0069931
462 Ga0495658_0067382
463 Ga0495613_0013915
464 Ga0495676_0534731
465 Ga0496100_0004370
466 Ga0496100_0017942
467 Ga0496101_0010700
468 Ga0496101_1019438
469 Ga0496102_0023051
470 Ga0496102_0197449
471 Ga0496102_0776493
472 Ga0496102_1110890
473 Ga0496103_0000342
474 Ga0496103_0462113
475 Ga0496104_0512838
476 Ga0496105_0220753
477 Ga0496106_0019911
478 Ga0496106_0096390
479 Ga0496106_0170540
480 Ga0496107_0006464
481 Ga0496107_0076269
482 Ga0496108_0118560
483 Ga0496108_0151553
484 Ga0496109_0073869
485 Ga0496109_0299459
486 Ga0496110_0040176
487 Ga0496110_0049585
488 Ga0496110_0673685
489 Ga0496111_0034800
490 Ga0496111_0373263
491 Ga0496112_0011514
492 Ga0496112_0054461
493 Ga0496112_0149104
494 Ga0496112_0759224
495 Ga0496113_0180942
496 Ga0496113_0419809
497 Ga0496115_0330597
498 Ga0496115_0574279
499 Ga0496115_1281995
500 Ga0496116_0006159
501 Ga0496117_0000233
502 Ga0496118_0004748
503 Ga0496119_0005919
504 Ga0496120_0020570
505 Ga0496125_0014823
506 Ga0496126_0011692
507 nmdc:mga03683_431415_c1
508 nmdc:mga00v17_8860_c1
509 nmdc:mga0yw44_49442_c1
510 nmdc:mga06z11_121697_c1
511 nmdc:mga07m45_135550_c1
512 nmdc:mga0n895_229511_c1
513 nmdc:mga0rr50_212179_c1
514 nmdc:mga0a205_285128_c1
515 nmdc:mga0a205_466177_c1
516 Ga0495619_0338165
517 Ga0500578_0104390
518 Ga0500646_0045071
519 Ga0500621_176257
520 Ga0500568_0068342
521 Ga0500616_0296999
522 2506865089
523 2676481015
524 2729907192
525 2784592593
526 2929216010
527 3002999556
528 3006497544
529 8025533651
530 8055162026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9956 1 126
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9725 1 126
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.867 1 125
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8648 1 127
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8524 1 127
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.993 1 124 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9619 1 124 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9238 79 124 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9052 78 128 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8583 78 128 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2T5L776-F1-model_v4 deleted 1.003 1 127
AF-A0A5E9G346-F1-model_v4 Catechol 2,3-dioxygenase 1.002 1 128 GO:0051213
AF-A0A1I5UIJ4-F1-model_v4 Catechol 2,3-dioxygenase 1.002 1 126 GO:0051213
AF-A0A249LWD3-F1-model_v4 deleted 1.002 1 128
AF-A0A1G6REG1-F1-model_v4 Catechol 2,3-dioxygenase 1.001 1 128 GO:0051213

Map