F373067

General Info

Members Datasets Scaffolds Average Seq Length
265 111 265 188

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10253366|Ga0065707_102533662
Length 202
Sequence MTNRTLRTILWVLVGIAALGGLLLALQGPSSSSSETALSTIGGPFTLTAGDGKPFPSSRLNGKPAAIFFGFTNCPDVCPTTLARLVKLRRQLGRGDQAQRDRAMSIVFITVDPERDGPAEVGSYAGLFNAPVIGLTGSTADIERVKKQFGAFSQRVEQPGGSYTVDHTASVFLMDRNGQFVATLSPEEGDAVALEKLGRLAA

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
77 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
108 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
109 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.38
Rhizosphere 99.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1009629 3300002076 Bacteria 1350
2 Ga0065715_10000622 3300005293 Bacteria 11008
3 Ga0065707_10253366 3300005295 Bacteria 1118
4 Ga0065707_10377187 3300005295 Bacteria 882
5 Ga0070676_10005027 3300005328 Bacteria 7009
6 Ga0070676_10238061 3300005328 Unclassified 1209
7 Ga0070670_100001305 3300005331 Bacteria 19868
8 Ga0070670_100018314 3300005331 Bacteria 6008
9 Ga0070670_100028191 3300005331 Bacteria 4833
10 Ga0070670_100050075 3300005331 Bacteria 3590
11 Ga0070670_100114160 3300005331 Bacteria 2329
12 Ga0070670_100202697 3300005331 Bacteria 1724
13 Ga0070670_100241358 3300005331 Bacteria 1573
14 Ga0070670_100531136 3300005331 Bacteria 1048
15 Ga0070666_10040830 3300005335 Bacteria 3098
16 Ga0070660_100333590 3300005339 Bacteria 1247
17 Ga0070660_100865853 3300005339 Bacteria 761
18 Ga0070689_100431078 3300005340 Bacteria 1119
19 Ga0070661_100023835 3300005344 Bacteria 4390
20 Ga0070668_100025999 3300005347 Bacteria 4439
21 Ga0070668_100029728 3300005347 Bacteria 4151
22 Ga0070669_100004398 3300005353 Bacteria 10171
23 Ga0070669_100035395 3300005353 Bacteria 3617
24 Ga0070669_100108558 3300005353 Bacteria 2103
25 Ga0070669_100444794 3300005353 Bacteria 1067
26 Ga0070675_100001540 3300005354 Bacteria 17065
27 Ga0070675_100002598 3300005354 Bacteria 13543
28 Ga0070675_100012508 3300005354 Bacteria 6652
29 Ga0070671_100002687 3300005355 Bacteria 13786
30 Ga0070671_100014139 3300005355 Bacteria 6445
31 Ga0070671_100071732 3300005355 Bacteria 2891
32 Ga0070674_100024195 3300005356 Bacteria 3939
33 Ga0070674_100059143 3300005356 Plasmid 2667
34 Ga0070673_100058811 3300005364 Bacteria 3041
35 Ga0070659_100050523 3300005366 Bacteria 3269
36 Ga0070659_100136298 3300005366 Bacteria 1996
37 Ga0070659_100949601 3300005366 Bacteria 753
38 Ga0070667_100010738 3300005367 Bacteria 7568
39 Ga0070667_100015297 3300005367 Bacteria 6343
40 Ga0070701_10090321 3300005438 Bacteria 1677
41 Ga0070663_100074126 3300005455 Bacteria 2484
42 Ga0070663_100323271 3300005455 Bacteria 1241
43 Ga0070678_100015876 3300005456 Bacteria 4799
44 Ga0070678_100139792 3300005456 Unclassified 1936
45 Ga0070678_100143792 3300005456 Bacteria 1912
46 Ga0070662_100002527 3300005457 Bacteria 11273
47 Ga0070662_100003089 3300005457 Bacteria 10335
48 Ga0070662_100015206 3300005457 Bacteria 5151
49 Ga0070662_100036111 3300005457 Bacteria 3494
50 Ga0070662_100046891 3300005457 Bacteria 3106
51 Ga0068867_100060475 3300005459 Bacteria 2810
52 Ga0068853_100037592 3300005539 Bacteria 4119
53 Ga0070672_100009738 3300005543 Bacteria 6635
54 Ga0070672_100059052 3300005543 Bacteria 3017
55 Ga0070665_100119182 3300005548 Bacteria 2641
56 Ga0070704_101212880 3300005549 Bacteria 688
57 Ga0070664_100001698 3300005564 Bacteria 17641
58 Ga0070664_100018455 3300005564 Bacteria 5731
59 Ga0070664_100028322 3300005564 Bacteria 4659
60 Ga0070664_100094041 3300005564 Bacteria 2599
61 Ga0070664_100233324 3300005564 Bacteria 1650
62 Ga0068854_100255658 3300005578 Bacteria 1401
63 Ga0068854_100288159 3300005578 Bacteria 1324
64 Ga0068864_100620947 3300005618 Bacteria 1050
65 Ga0068864_101342111 3300005618 Bacteria 716
66 Ga0068863_100269710 3300005841 Bacteria 1647
67 Ga0068860_100027547 3300005843 Bacteria 5472
68 Ga0068862_100024157 3300005844 Bacteria 5098
69 Ga0068862_100110271 3300005844 Bacteria 2415
70 Ga0068862_101081438 3300005844 Bacteria 796
71 Ga0075428_100077097 3300006844 Bacteria 3639
72 Ga0075431_100004646 3300006847 Bacteria 13486
73 Ga0111539_10277006 3300009094 Bacteria 1952
74 Ga0105243_10235355 3300009148 Bacteria 1627
75 Ga0105242_10348095 3300009176 Bacteria 1368
76 Ga0105248_10006399 3300009177 Bacteria 12919
77 Ga0105249_10012480 3300009553 Bacteria 7490
78 Ga0157375_10077791 3300013308 Plasmid 3349
79 Ga0163163_10367380 3300014325 Unclassified 1496
80 Ga0157380_10009215 3300014326 Bacteria 7064
81 Ga0157380_10011294 3300014326 Bacteria 6451
82 Ga0157380_10027848 3300014326 Bacteria 4302
83 Ga0163161_10006778 3300017792 Bacteria 7914
84 Ga0163161_10086444 3300017792 Unclassified 2314
85 Ga0207697_10001912 3300025315 Bacteria 11079
86 Ga0207682_10000432 3300025893 Bacteria 19371
87 Ga0207688_10012898 3300025901 Bacteria 4543
88 Ga0207645_10010141 3300025907 Bacteria 6479
89 Ga0207645_10086350 3300025907 Bacteria 2016
90 Ga0207645_10274932 3300025907 Unclassified 1117
91 Ga0207643_10227170 3300025908 Bacteria 1144
92 Ga0207705_10460586 3300025909 Unclassified 986
93 Ga0207657_10680253 3300025919 Unclassified 800
94 Ga0207649_10018435 3300025920 Bacteria 3970
95 Ga0207681_10018698 3300025923 Bacteria 4369
96 Ga0207681_10163491 3300025923 Bacteria 1680
97 Ga0207650_10025004 3300025925 Bacteria 4252
98 Ga0207650_10127169 3300025925 Bacteria 1990
99 Ga0207650_10331801 3300025925 Bacteria 1248
100 Ga0207650_10526601 3300025925 Bacteria 989
101 Ga0207659_10017704 3300025926 Bacteria 4657
102 Ga0207659_10068734 3300025926 Bacteria 2577
103 Ga0207659_10100899 3300025926 Bacteria 2175
104 Ga0207644_10003015 3300025931 Bacteria 10834
105 Ga0207690_10058088 3300025932 Bacteria 2615
106 Ga0207690_10798469 3300025932 Bacteria 780
107 Ga0207706_10000564 3300025933 Bacteria 39303
108 Ga0207706_10009223 3300025933 Bacteria 9066
109 Ga0207706_10044240 3300025933 Bacteria 3946
110 Ga0207706_10045263 3300025933 Bacteria 3900
111 Ga0207706_10228906 3300025933 Bacteria 1627
112 Ga0207669_10013375 3300025937 Bacteria 4072
113 Ga0207691_10000442 3300025940 Bacteria 41154
114 Ga0207691_10041450 3300025940 Unclassified 4251
115 Ga0207691_10268555 3300025940 Bacteria 1469
116 Ga0207691_10611480 3300025940 Bacteria 922
117 Ga0207711_10019482 3300025941 Bacteria 5648
118 Ga0207679_10023047 3300025945 Bacteria 4251
119 Ga0207679_10023473 3300025945 Bacteria 4219
120 Ga0207679_10027257 3300025945 Bacteria 3949
121 Ga0207679_10170150 3300025945 Bacteria 1793
122 Ga0207651_10067947 3300025960 Bacteria 2510
123 Ga0207712_10015045 3300025961 Bacteria 4985
124 Ga0207668_10023529 3300025972 Bacteria 3962
125 Ga0207668_10064100 3300025972 Bacteria 2595
126 Ga0207668_10756409 3300025972 Bacteria 858
127 Ga0207658_10167918 3300025986 Bacteria 1805
128 Ga0207639_10025813 3300026041 Bacteria 4263
129 Ga0207678_10017347 3300026067 Bacteria 6320
130 Ga0207708_10233826 3300026075 Bacteria 1476
131 Ga0207648_10017225 3300026089 Bacteria 6584
132 Ga0207676_10016776 3300026095 Bacteria 5302
133 Ga0207675_100002497 3300026118 Bacteria 18203
134 Ga0207683_10023860 3300026121 Bacteria 5262
135 Ga0207683_10203843 3300026121 Bacteria 1799
136 Ga0268266_10047058 3300028379 Bacteria 3693
137 Ga0268265_10062477 3300028380 Bacteria 2862
138 Ga0268264_10124993 3300028381 Bacteria 2272
139 Ga0316178_1078801 3300030735 Bacteria 767
140 Ga0316182_1441995 3300030745 Bacteria 1667
141 Ga0307408_100128007 3300031548 Bacteria 1977
142 Ga0307408_100187265 3300031548 Bacteria 1665
143 Ga0307408_100543675 3300031548 Bacteria 1024
144 Ga0307408_100546995 3300031548 Unclassified 1021
145 Ga0307405_10028091 3300031731 Bacteria 3272
146 Ga0307405_10174340 3300031731 Bacteria 1537
147 Ga0307405_10216800 3300031731 Bacteria 1401
148 Ga0307405_10229103 3300031731 Bacteria 1368
149 Ga0307405_10704473 3300031731 Bacteria 836
150 Ga0307413_10001063 3300031824 Bacteria 9988
151 Ga0307413_10049662 3300031824 Bacteria 2515
152 Ga0307413_10082089 3300031824 Bacteria 2069
153 Ga0307413_10101444 3300031824 Bacteria 1903
154 Ga0307413_10214254 3300031824 Bacteria 1401
155 Ga0307413_10237686 3300031824 Bacteria 1343
156 Ga0307413_10241394 3300031824 Bacteria 1334
157 Ga0307413_10273449 3300031824 Bacteria 1266
158 Ga0307413_10343099 3300031824 Bacteria 1149
159 Ga0307413_10346762 3300031824 Bacteria 1144
160 Ga0307413_10453365 3300031824 Bacteria 1019
161 Ga0307410_10000301 3300031852 Bacteria 19232
162 Ga0307410_10030923 3300031852 Bacteria 3428
163 Ga0307410_10063107 3300031852 Bacteria 2540
164 Ga0307410_10204246 3300031852 Bacteria 1510
165 Ga0307410_10205098 3300031852 Bacteria 1508
166 Ga0307410_10246874 3300031852 Bacteria 1386
167 Ga0307410_10451870 3300031852 Bacteria 1048
168 Ga0307410_10528598 3300031852 Bacteria 974
169 Ga0307406_10121447 3300031901 Bacteria 1817
170 Ga0307406_10214690 3300031901 Bacteria 1426
171 Ga0307406_10230981 3300031901 Bacteria 1381
172 Ga0307406_10251841 3300031901 Bacteria 1331
173 Ga0307406_10341057 3300031901 Bacteria 1167
174 Ga0307407_10001009 3300031903 Bacteria 9677
175 Ga0307407_10002625 3300031903 Bacteria 7105
176 Ga0307407_10007949 3300031903 Bacteria 4835
177 Ga0307407_10104842 3300031903 Bacteria 1763
178 Ga0307407_10603984 3300031903 Bacteria 817
179 Ga0307412_10093758 3300031911 Bacteria 2107
180 Ga0307412_10094423 3300031911 Bacteria 2100
181 Ga0307412_10128737 3300031911 Bacteria 1835
182 Ga0307409_100000905 3300031995 Bacteria 13746
183 Ga0307409_100006076 3300031995 Bacteria 7052
184 Ga0307409_100040024 3300031995 Bacteria 3485
185 Ga0307409_100052214 3300031995 Bacteria 3132
186 Ga0307409_100054634 3300031995 Bacteria 3077
187 Ga0307409_100063156 3300031995 Bacteria 2903
188 Ga0307409_100074806 3300031995 Bacteria 2708
189 Ga0307409_100124360 3300031995 Bacteria 2191
190 Ga0307409_100130332 3300031995 Bacteria 2147
191 Ga0307409_100399371 3300031995 Bacteria 1312
192 Ga0307409_100663720 3300031995 Bacteria 1038
193 Ga0307409_100809487 3300031995 Unclassified 945
194 Ga0307416_100020731 3300032002 Bacteria 4699
195 Ga0307416_100027103 3300032002 Bacteria 4237
196 Ga0307416_100057679 3300032002 Bacteria 3143
197 Ga0307416_100378737 3300032002 Bacteria 1444
198 Ga0307416_100889235 3300032002 Bacteria 990
199 Ga0307416_101347727 3300032002 Bacteria 819
200 Ga0307414_10000965 3300032004 Bacteria 14647
201 Ga0307414_10017449 3300032004 Bacteria 4392
202 Ga0307414_10049066 3300032004 Bacteria 2916
203 Ga0307414_10072686 3300032004 Bacteria 2485
204 Ga0307414_10129872 3300032004 Bacteria 1954
205 Ga0307414_10233693 3300032004 Bacteria 1517
206 Ga0307414_10416680 3300032004 Bacteria 1170
207 Ga0307414_10605355 3300032004 Bacteria 983
208 Ga0307414_10618879 3300032004 Bacteria 973
209 Ga0307411_10001187 3300032005 Bacteria 10293
210 Ga0307411_10003351 3300032005 Bacteria 7420
211 Ga0307411_10034669 3300032005 Bacteria 3143
212 Ga0307411_10034904 3300032005 Bacteria 3134
213 Ga0307411_10046420 3300032005 Bacteria 2800
214 Ga0307411_10072003 3300032005 Bacteria 2345
215 Ga0307411_10075587 3300032005 Bacteria 2300
216 Ga0307411_10111603 3300032005 Bacteria 1958
217 Ga0307411_10142556 3300032005 Unclassified 1769
218 Ga0307411_10156070 3300032005 Bacteria 1703
219 Ga0307411_10157578 3300032005 Bacteria 1695
220 Ga0307411_10223268 3300032005 Bacteria 1463
221 Ga0307411_10364898 3300032005 Bacteria 1182
222 Ga0307411_10497588 3300032005 Bacteria 1030
223 Ga0307415_100000452 3300032126 Bacteria 17624
224 Ga0307415_100019809 3300032126 Bacteria 4093
225 Ga0307415_100031493 3300032126 Bacteria 3417
226 Ga0307415_100044001 3300032126 Bacteria 2982
227 Ga0307415_100055972 3300032126 Bacteria 2702
228 Ga0307415_100063857 3300032126 Bacteria 2560
229 Ga0307415_100064835 3300032126 Bacteria 2543
230 Ga0307415_100179618 3300032126 Bacteria 1659
231 Ga0307415_100190359 3300032126 Bacteria 1618
232 Ga0307415_100262834 3300032126 Bacteria 1409
233 Ga0307415_101049217 3300032126 Bacteria 760
234 Ga0395905_0336244 3300037471 Bacteria 1401
235 Ga0439445_0000230 3300042004 Bacteria 10425
236 Ga0439449_0011294 3300042007 Bacteria 3362
237 Ga0439449_0212272 3300042007 Bacteria 725
238 Ga0439462_0046182 3300042015 Bacteria 1167
239 Ga0450907_023458 3300042146 Bacteria 1041
240 Ga0439446_0073707 3300042156 Bacteria 1048
241 Ga0439464_0084919 3300042439 Bacteria 949
242 Ga0451577_0190966 3300042876 Bacteria 1848
243 Ga0495585_0036425 3300046492 Bacteria 2775
244 Ga0495663_0006691 3300046525 Bacteria 3180
245 Ga0495663_0176010 3300046525 Bacteria 739
246 Ga0495598_0016541 3300046537 Bacteria 1884
247 Ga0495621_0017219 3300046539 Bacteria 2332
248 Ga0495621_0097059 3300046539 Bacteria 1117
249 Ga0495633_0030380 3300046558 Bacteria 2624
250 Ga0495659_0063047 3300046664 Bacteria 1373
251 Ga0495669_0003468 3300046684 Bacteria 6501
252 Ga0495669_0009559 3300046684 Bacteria 4092
253 Ga0495669_0052083 3300046684 Bacteria 1838
254 Ga0495669_0177822 3300046684 Unclassified 1013
255 Ga0495670_0028119 3300046691 Bacteria 2787
256 Ga0495670_0051801 3300046691 Bacteria 2054
257 Ga0495670_0099802 3300046691 Bacteria 1494
258 Ga0495670_0116750 3300046691 Bacteria 1384
259 Ga0495670_0238172 3300046691 Bacteria 968
260 Ga0496108_0217161 3300048911 Bacteria 1661
261 Ga0501249_046054 3300049679 Bacteria 996
262 Ga0501259_033706 3300049688 Bacteria 979
263 Ga0501272_033372 3300049769 Bacteria 663
264 nmdc:mga06r32_13244_c1 3300050510 Bacteria 7470
265 nmdc:mga08y16_455350_c1 3300050511 Bacteria 1304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042146 Ga0450907_023458 Ga0450907_023458_21_617 157
2 3300005331 Ga0070670_100028191 Ga0070670_1000281914 159
3 3300005353 Ga0070669_100004398 Ga0070669_1000043985 159
4 3300005354 Ga0070675_100001540 Ga0070675_1000015407 159
5 3300005356 Ga0070674_100024195 Ga0070674_1000241955 159
6 3300005456 Ga0070678_100143792 Ga0070678_1001437922 159
7 3300005457 Ga0070662_100003089 Ga0070662_1000030899 159
8 3300005543 Ga0070672_100059052 Ga0070672_1000590524 159
9 3300005564 Ga0070664_100018455 Ga0070664_1000184554 159
10 3300014326 Ga0157380_10009215 Ga0157380_100092154 159
11 3300025893 Ga0207682_10000432 Ga0207682_1000043210 159
12 3300025901 Ga0207688_10012898 Ga0207688_100128982 159
13 3300025907 Ga0207645_10086350 Ga0207645_100863503 159
14 3300025923 Ga0207681_10018698 Ga0207681_100186982 159
15 3300025926 Ga0207659_10100899 Ga0207659_101008992 159
16 3300025933 Ga0207706_10044240 Ga0207706_100442403 159
17 3300025940 Ga0207691_10611480 Ga0207691_106114801 159
18 3300025945 Ga0207679_10023473 Ga0207679_100234732 159
19 3300025986 Ga0207658_10167918 Ga0207658_101679182 159
20 3300026121 Ga0207683_10203843 Ga0207683_102038432 159
21 3300031824 Ga0307413_10453365 Ga0307413_104533652 161
22 3300031731 Ga0307405_10174340 Ga0307405_101743402 164
23 3300031824 Ga0307413_10082089 Ga0307413_100820893 167
24 3300042007 Ga0439449_0212272 Ga0439449_0212272_29_625 168
25 3300005331 Ga0070670_100114160 Ga0070670_1001141602 174
26 3300005618 Ga0068864_101342111 Ga0068864_1013421112 174
27 3300032005 Ga0307411_10223268 Ga0307411_102232682 175
28 3300032126 Ga0307415_100031493 Ga0307415_1000314934 175
29 3300006844 Ga0075428_100077097 Ga0075428_1000770973 176
30 3300030745 Ga0316182_1441995 Ga0316182_14419952 176
31 3300031731 Ga0307405_10704473 Ga0307405_107044732 176
32 3300031824 Ga0307413_10214254 Ga0307413_102142542 176
33 3300031824 Ga0307413_10237686 Ga0307413_102376862 176
34 3300031903 Ga0307407_10002625 Ga0307407_100026253 176
35 3300032002 Ga0307416_100378737 Ga0307416_1003787372 176
36 3300032004 Ga0307414_10129872 Ga0307414_101298723 176
37 3300032005 Ga0307411_10072003 Ga0307411_100720032 176
38 3300032005 Ga0307411_10156070 Ga0307411_101560703 176
39 3300032126 Ga0307415_100262834 Ga0307415_1002628341 176
40 3300042004 Ga0439445_0000230 Ga0439445_0000230_7556_8152 176
41 3300042156 Ga0439446_0073707 Ga0439446_0073707_260_856 176
42 3300025940 Ga0207691_10268555 Ga0207691_102685551 177
43 3300025945 Ga0207679_10170150 Ga0207679_101701502 177
44 3300031548 Ga0307408_100543675 Ga0307408_1005436752 177
45 3300031852 Ga0307410_10528598 Ga0307410_105285982 177
46 3300032002 Ga0307416_100027103 Ga0307416_1000271031 177
47 3300032005 Ga0307411_10046420 Ga0307411_100464203 177
48 3300031548 Ga0307408_100128007 Ga0307408_1001280072 178
49 3300031731 Ga0307405_10229103 Ga0307405_102291033 178
50 3300031911 Ga0307412_10128737 Ga0307412_101287372 178
51 3300031995 Ga0307409_100130332 Ga0307409_1001303322 178
52 3300032004 Ga0307414_10233693 Ga0307414_102336933 178
53 3300032004 Ga0307414_10618879 Ga0307414_106188792 178
54 3300032126 Ga0307415_100190359 Ga0307415_1001903592 178
55 3300042876 Ga0451577_0190966 Ga0451577_0190966_762_1358 178
56 3300005339 Ga0070660_100865853 Ga0070660_1008658531 179
57 3300005347 Ga0070668_100029728 Ga0070668_1000297282 179
58 3300031824 Ga0307413_10049662 Ga0307413_100496622 179
59 3300031824 Ga0307413_10273449 Ga0307413_102734492 179
60 3300031824 Ga0307413_10346762 Ga0307413_103467622 179
61 3300031852 Ga0307410_10000301 Ga0307410_1000030111 179
62 3300031852 Ga0307410_10030923 Ga0307410_100309232 179
63 3300031852 Ga0307410_10204246 Ga0307410_102042462 179
64 3300031852 Ga0307410_10246874 Ga0307410_102468741 179
65 3300031901 Ga0307406_10230981 Ga0307406_102309812 179
66 3300031901 Ga0307406_10341057 Ga0307406_103410572 179
67 3300031903 Ga0307407_10007949 Ga0307407_100079493 179
68 3300031995 Ga0307409_100000905 Ga0307409_1000009058 179
69 3300031995 Ga0307409_100040024 Ga0307409_1000400242 179
70 3300031995 Ga0307409_100063156 Ga0307409_1000631563 179
71 3300032004 Ga0307414_10000965 Ga0307414_1000096514 179
72 3300032004 Ga0307414_10049066 Ga0307414_100490663 179
73 3300032005 Ga0307411_10003351 Ga0307411_100033515 179
74 3300032005 Ga0307411_10034669 Ga0307411_100346692 179
75 3300032005 Ga0307411_10111603 Ga0307411_101116032 179
76 3300032005 Ga0307411_10157578 Ga0307411_101575782 179
77 3300032005 Ga0307411_10497588 Ga0307411_104975882 179
78 3300032126 Ga0307415_100064835 Ga0307415_1000648354 179
79 3300032126 Ga0307415_100179618 Ga0307415_1001796182 179
80 3300032126 Ga0307415_101049217 Ga0307415_1010492172 179
81 3300046492 Ga0495585_0036425 Ga0495585_0036425_1681_2271 179
82 3300046537 Ga0495598_0016541 Ga0495598_0016541_89_682 179
83 3300046684 Ga0495669_0003468 Ga0495669_0003468_381_974 179
84 3300046691 Ga0495670_0116750 Ga0495670_0116750_720_1313 179
85 3300005353 Ga0070669_100444794 Ga0070669_1004447942 180
86 3300025972 Ga0207668_10023529 Ga0207668_100235295 180
87 3300031903 Ga0307407_10603984 Ga0307407_106039842 180
88 3300032004 Ga0307414_10416680 Ga0307414_104166802 180
89 3300046691 Ga0495670_0238172 Ga0495670_0238172_292_885 180
90 3300005295 Ga0065707_10377187 Ga0065707_103771871 181
91 3300005548 Ga0070665_100119182 Ga0070665_1001191823 181
92 3300028379 Ga0268266_10047058 Ga0268266_100470584 181
93 3300031901 Ga0307406_10214690 Ga0307406_102146902 181
94 3300031911 Ga0307412_10093758 Ga0307412_100937583 181
95 3300031995 Ga0307409_100124360 Ga0307409_1001243603 181
96 3300032002 Ga0307416_101347727 Ga0307416_1013477271 181
97 3300032005 Ga0307411_10075587 Ga0307411_100755872 181
98 3300042439 Ga0439464_0084919 Ga0439464_0084919_321_920 181
99 3300005366 Ga0070659_100949601 Ga0070659_1009496011 182
100 3300005457 Ga0070662_100036111 Ga0070662_1000361114 182
101 3300005564 Ga0070664_100233324 Ga0070664_1002333242 182
102 3300005578 Ga0068854_100255658 Ga0068854_1002556583 182
103 3300005618 Ga0068864_100620947 Ga0068864_1006209472 182
104 3300025932 Ga0207690_10798469 Ga0207690_107984692 182
105 3300025933 Ga0207706_10045263 Ga0207706_100452634 182
106 3300025972 Ga0207668_10756409 Ga0207668_107564092 182
107 3300031548 Ga0307408_100187265 Ga0307408_1001872652 182
108 3300031995 Ga0307409_100663720 Ga0307409_1006637202 182
109 3300042007 Ga0439449_0011294 Ga0439449_0011294_1327_1923 182
110 3300042015 Ga0439462_0046182 Ga0439462_0046182_140_736 182
111 3300031824 Ga0307413_10001063 Ga0307413_100010636 183
112 3300031852 Ga0307410_10063107 Ga0307410_100631073 183
113 3300031903 Ga0307407_10001009 Ga0307407_100010097 183
114 3300031995 Ga0307409_100052214 Ga0307409_1000522142 183
115 3300032002 Ga0307416_100057679 Ga0307416_1000576794 183
116 3300032004 Ga0307414_10017449 Ga0307414_100174494 183
117 3300032005 Ga0307411_10001187 Ga0307411_100011874 183
118 3300032126 Ga0307415_100000452 Ga0307415_10000045212 183
119 3300046664 Ga0495659_0063047 Ga0495659_0063047_184_774 183
120 3300046684 Ga0495669_0052083 Ga0495669_0052083_1232_1786 184
121 3300009148 Ga0105243_10235355 Ga0105243_102353552 187
122 3300048911 Ga0496108_0217161 Ga0496108_0217161_798_1361 187
123 3300009094 Ga0111539_10277006 Ga0111539_102770062 188
124 3300009176 Ga0105242_10348095 Ga0105242_103480952 188
125 3300046691 Ga0495670_0028119 Ga0495670_0028119_2205_2771 188
126 3300050511 nmdc:mga08y16_455350_c1 nmdc:mga08y16_455350_c1_352_918 188
127 3300031731 Ga0307405_10216800 Ga0307405_102168002 189
128 3300032002 Ga0307416_100889235 Ga0307416_1008892352 189
129 3300031911 Ga0307412_10094423 Ga0307412_100944232 191
130 3300031995 Ga0307409_100399371 Ga0307409_1003993712 191
131 3300005331 Ga0070670_100241358 Ga0070670_1002413582 192
132 3300005331 Ga0070670_100531136 Ga0070670_1005311362 192
133 3300005353 Ga0070669_100108558 Ga0070669_1001085583 192
134 3300005844 Ga0068862_101081438 Ga0068862_1010814382 192
135 3300025923 Ga0207681_10163491 Ga0207681_101634912 192
136 3300025925 Ga0207650_10127169 Ga0207650_101271692 192
137 3300025925 Ga0207650_10331801 Ga0207650_103318012 192
138 3300030735 Ga0316178_1078801 Ga0316178_10788012 192
139 3300031824 Ga0307413_10241394 Ga0307413_102413942 192
140 3300031901 Ga0307406_10121447 Ga0307406_101214472 193
141 3300031903 Ga0307407_10104842 Ga0307407_101048422 193
142 3300031995 Ga0307409_100006076 Ga0307409_1000060764 193
143 3300032002 Ga0307416_100020731 Ga0307416_1000207313 193
144 3300032126 Ga0307415_100044001 Ga0307415_1000440013 193
145 3300049679 Ga0501249_046054 Ga0501249_046054_38_631 193
146 3300049688 Ga0501259_033706 Ga0501259_033706_32_622 193
147 3300049769 Ga0501272_033372 Ga0501272_033372_22_615 193
148 3300025908 Ga0207643_10227170 Ga0207643_102271702 194
149 3300031824 Ga0307413_10343099 Ga0307413_103430992 194
150 3300032004 Ga0307414_10605355 Ga0307414_106053552 194
151 3300032005 Ga0307411_10034904 Ga0307411_100349043 194
152 3300046525 Ga0495663_0006691 Ga0495663_0006691_2205_2798 194
153 3300046558 Ga0495633_0030380 Ga0495633_0030380_1142_1735 194
154 3300005328 Ga0070676_10238061 Ga0070676_102380612 195
155 3300005331 Ga0070670_100001305 Ga0070670_1000013056 195
156 3300005331 Ga0070670_100202697 Ga0070670_1002026973 195
157 3300005335 Ga0070666_10040830 Ga0070666_100408303 195
158 3300005339 Ga0070660_100333590 Ga0070660_1003335902 195
159 3300005344 Ga0070661_100023835 Ga0070661_1000238352 195
160 3300005353 Ga0070669_100035395 Ga0070669_1000353953 195
161 3300005354 Ga0070675_100002598 Ga0070675_1000025985 195
162 3300005355 Ga0070671_100002687 Ga0070671_1000026876 195
163 3300005355 Ga0070671_100071732 Ga0070671_1000717322 195
164 3300005356 Ga0070674_100059143 Ga0070674_1000591433 195
165 3300005366 Ga0070659_100050523 Ga0070659_1000505234 195
166 3300005367 Ga0070667_100010738 Ga0070667_1000107384 195
167 3300005455 Ga0070663_100323271 Ga0070663_1003232712 195
168 3300005456 Ga0070678_100139792 Ga0070678_1001397922 195
169 3300005457 Ga0070662_100015206 Ga0070662_1000152063 195
170 3300005457 Ga0070662_100046891 Ga0070662_1000468914 195
171 3300005539 Ga0068853_100037592 Ga0068853_1000375923 195
172 3300005564 Ga0070664_100001698 Ga0070664_1000016987 195
173 3300005564 Ga0070664_100094041 Ga0070664_1000940414 195
174 3300005844 Ga0068862_100110271 Ga0068862_1001102713 195
175 3300009177 Ga0105248_10006399 Ga0105248_100063996 195
176 3300013308 Ga0157375_10077791 Ga0157375_100777913 195
177 3300014325 Ga0163163_10367380 Ga0163163_103673802 195
178 3300017792 Ga0163161_10086444 Ga0163161_100864443 195
179 3300025907 Ga0207645_10274932 Ga0207645_102749322 195
180 3300025909 Ga0207705_10460586 Ga0207705_104605862 195
181 3300025919 Ga0207657_10680253 Ga0207657_106802532 195
182 3300025920 Ga0207649_10018435 Ga0207649_100184354 195
183 3300025925 Ga0207650_10526601 Ga0207650_105266012 195
184 3300025926 Ga0207659_10068734 Ga0207659_100687344 195
185 3300025931 Ga0207644_10003015 Ga0207644_100030156 195
186 3300025932 Ga0207690_10058088 Ga0207690_100580884 195
187 3300025933 Ga0207706_10009223 Ga0207706_100092233 195
188 3300025933 Ga0207706_10228906 Ga0207706_102289062 195
189 3300025937 Ga0207669_10013375 Ga0207669_100133752 195
190 3300025940 Ga0207691_10041450 Ga0207691_100414502 195
191 3300025941 Ga0207711_10019482 Ga0207711_100194822 195
192 3300025945 Ga0207679_10023047 Ga0207679_100230473 195
193 3300026041 Ga0207639_10025813 Ga0207639_100258135 195
194 3300026095 Ga0207676_10016776 Ga0207676_100167762 195
195 3300028380 Ga0268265_10062477 Ga0268265_100624773 195
196 3300031548 Ga0307408_100546995 Ga0307408_1005469952 195
197 3300031824 Ga0307413_10101444 Ga0307413_101014442 195
198 3300031852 Ga0307410_10205098 Ga0307410_102050982 195
199 3300031852 Ga0307410_10451870 Ga0307410_104518702 195
200 3300031995 Ga0307409_100074806 Ga0307409_1000748063 195
201 3300031995 Ga0307409_100809487 Ga0307409_1008094872 195
202 3300032005 Ga0307411_10142556 Ga0307411_101425562 195
203 3300032126 Ga0307415_100063857 Ga0307415_1000638574 195
204 3300046684 Ga0495669_0177822 Ga0495669_0177822_90_686 195
205 3300005293 Ga0065715_10000622 Ga0065715_100006224 196
206 3300005328 Ga0070676_10005027 Ga0070676_100050277 196
207 3300005331 Ga0070670_100018314 Ga0070670_1000183144 196
208 3300005340 Ga0070689_100431078 Ga0070689_1004310782 196
209 3300005347 Ga0070668_100025999 Ga0070668_1000259995 196
210 3300005355 Ga0070671_100014139 Ga0070671_1000141396 196
211 3300005364 Ga0070673_100058811 Ga0070673_1000588113 196
212 3300005366 Ga0070659_100136298 Ga0070659_1001362983 196
213 3300005456 Ga0070678_100015876 Ga0070678_1000158765 196
214 3300005543 Ga0070672_100009738 Ga0070672_1000097387 196
215 3300005549 Ga0070704_101212880 Ga0070704_1012128801 196
216 3300005564 Ga0070664_100028322 Ga0070664_1000283225 196
217 3300005843 Ga0068860_100027547 Ga0068860_1000275473 196
218 3300005844 Ga0068862_100024157 Ga0068862_1000241575 196
219 3300014326 Ga0157380_10027848 Ga0157380_100278483 196
220 3300025315 Ga0207697_10001912 Ga0207697_100019129 196
221 3300025907 Ga0207645_10010141 Ga0207645_100101415 196
222 3300025926 Ga0207659_10017704 Ga0207659_100177043 196
223 3300025933 Ga0207706_10000564 Ga0207706_1000056411 196
224 3300025940 Ga0207691_10000442 Ga0207691_1000044220 196
225 3300025945 Ga0207679_10027257 Ga0207679_100272575 196
226 3300025960 Ga0207651_10067947 Ga0207651_100679473 196
227 3300025972 Ga0207668_10064100 Ga0207668_100641003 196
228 3300026121 Ga0207683_10023860 Ga0207683_100238605 196
229 3300028381 Ga0268264_10124993 Ga0268264_101249932 196
230 3300031901 Ga0307406_10251841 Ga0307406_102518412 196
231 3300037471 Ga0395905_0336244 Ga0395905_0336244_755_1345 196
232 3300046525 Ga0495663_0176010 Ga0495663_0176010_74_664 196
233 3300046684 Ga0495669_0009559 Ga0495669_0009559_3481_4071 196
234 3300046691 Ga0495670_0099802 Ga0495670_0099802_142_732 196
235 3300002076 JGI24749J21850_1009629 JGI24749J21850_10096292 197
236 3300005295 Ga0065707_10253366 Ga0065707_102533662 197
237 3300005331 Ga0070670_100050075 Ga0070670_1000500756 197
238 3300005354 Ga0070675_100012508 Ga0070675_1000125085 197
239 3300005367 Ga0070667_100015297 Ga0070667_1000152973 197
240 3300005438 Ga0070701_10090321 Ga0070701_100903212 197
241 3300005455 Ga0070663_100074126 Ga0070663_1000741263 197
242 3300005457 Ga0070662_100002527 Ga0070662_1000025279 197
243 3300005459 Ga0068867_100060475 Ga0068867_1000604753 197
244 3300005578 Ga0068854_100288159 Ga0068854_1002881592 197
245 3300005841 Ga0068863_100269710 Ga0068863_1002697102 197
246 3300006847 Ga0075431_100004646 Ga0075431_1000046464 197
247 3300009553 Ga0105249_10012480 Ga0105249_100124805 197
248 3300014326 Ga0157380_10011294 Ga0157380_100112943 197
249 3300017792 Ga0163161_10006778 Ga0163161_100067787 197
250 3300025925 Ga0207650_10025004 Ga0207650_100250044 197
251 3300025961 Ga0207712_10015045 Ga0207712_100150455 197
252 3300026067 Ga0207678_10017347 Ga0207678_100173473 197
253 3300026075 Ga0207708_10233826 Ga0207708_102338262 197
254 3300026089 Ga0207648_10017225 Ga0207648_100172256 197
255 3300026118 Ga0207675_100002497 Ga0207675_1000024975 197
256 3300031731 Ga0307405_10028091 Ga0307405_100280916 197
257 3300031995 Ga0307409_100054634 Ga0307409_1000546345 197
258 3300032004 Ga0307414_10072686 Ga0307414_100726862 197
259 3300032005 Ga0307411_10364898 Ga0307411_103648982 197
260 3300032126 Ga0307415_100019809 Ga0307415_1000198096 197
261 3300032126 Ga0307415_100055972 Ga0307415_1000559723 197
262 3300046539 Ga0495621_0017219 Ga0495621_0017219_24_617 197
263 3300046539 Ga0495621_0097059 Ga0495621_0097059_236_829 197
264 3300046691 Ga0495670_0051801 Ga0495670_0051801_222_815 197
265 3300050510 nmdc:mga06r32_13244_c1 nmdc:mga06r32_13244_c1_1580_2176 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

42

180

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp0-assembly1.cif.gz_A human sco1 0.9242 43 194
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.9231 41 195
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.9218 41 195
2gt6-assembly1.cif.gz_A solution structure of human cu(i) sco1 0.9018 42 194
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.8894 41 195
ID Description Score Start End Superfamily
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9494 58 195 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9189 42 192 3.40.30.10
af_Q17557_120_303_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8841 34 194 3.40.30.10
af_B4FLA5_101_276_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8836 28 195 3.40.30.10
af_P38072_102_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8784 42 196 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3M3RF18-F1-model_v4 Sco1/SenC protein 0.9521 67 195 GO:0046872
AF-X7F1J4-F1-model_v4 Electron transport protein SCO1/SenC 0.9474 67 195 GO:0046872
AF-A0A656Z4I0-F1-model_v4 Electron transporter SenC 0.9472 60 196 GO:0046872
AF-A0A3M0F6Y3-F1-model_v4 deleted 0.9469 45 197
AF-A0A534A362-F1-model_v4 SCO family protein 0.9464 43 194 GO:0046872

Feature Viewer

pLDDT pTM Quality
86.24 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map