F373044

General Info

Members Datasets Scaffolds Average Seq Length
265 130 530 209

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10023666|JGI25407J50210_100236662
Length 221
Sequence MMDIGTQLKAIDREVTRRPGPDGEEVSVRVRRTYDAAVADVWDALTDPDRMKRWFLPVSGDLRVGGAFQLEGNAGGEILRCEPPRLLKVSFGGPTSLVELRLSPSGEDRTTLELEHTVPIEMAQSGAGALYVGPGWDGGFVALDLYLRGELSDDPVAAANSPEGQELTRQSVDSWVTVVRGSGTATAEELAAAKEMSMAQFAPDLAGASDDGGTGVSGTRG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
71 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
72 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
73 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
74 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
75 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
76 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
126 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
127 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
128 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
129 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
130 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.89
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 12.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10023666 3300003373 Bacteria 1594
2 JGI25407J50210_10028775 3300003373 Bacteria 1441
3 JGI25405J52794_10038760 3300003911 Unclassified 1004
4 JGI25405J52794_10042529 3300003911 Unclassified 963
5 Ga0070658_10305429 3300005327 Bacteria 1357
6 Ga0070683_100008092 3300005329 Bacteria 8929
7 Ga0070674_100227087 3300005356 Bacteria 1455
8 Ga0070659_100011799 3300005366 Bacteria 6467
9 Ga0070663_100573582 3300005455 Bacteria 946
10 Ga0070706_100000643 3300005467 Bacteria 39930
11 Ga0070707_101195962 3300005468 Bacteria 726
12 Ga0070684_100022124 3300005535 Bacteria 5300
13 Ga0070697_100897500 3300005536 Bacteria 786
14 Ga0068853_100336254 3300005539 Bacteria 1402
15 Ga0070664_100004924 3300005564 Bacteria 10695
16 Ga0070702_100504617 3300005615 Unclassified 889
17 Ga0068861_100064144 3300005719 Unclassified 2825
18 Ga0068860_100262702 3300005843 Bacteria 1683
19 Ga0068862_100079514 3300005844 Unclassified 2842
20 Ga0081455_10001296 3300005937 Bacteria 31084
21 Ga0081455_10011360 3300005937 Bacteria 8951
22 Ga0081455_10032597 3300005937 Bacteria 4693
23 Ga0081455_10044361 3300005937 Bacteria 3880
24 Ga0081455_10063689 3300005937 Bacteria 3092
25 Ga0081538_10003503 3300005981 Bacteria 14796
26 Ga0081538_10005273 3300005981 Bacteria 11669
27 Ga0081538_10010884 3300005981 Bacteria 7417
28 Ga0081538_10021736 3300005981 Bacteria 4670
29 Ga0081538_10025244 3300005981 Bacteria 4198
30 Ga0081538_10050297 3300005981 Bacteria 2518
31 Ga0081538_10067400 3300005981 Bacteria 1999
32 Ga0081538_10072109 3300005981 Bacteria 1896
33 Ga0075432_10015367 3300006058 Bacteria 2610
34 Ga0075428_100003535 3300006844 Bacteria 17113
35 Ga0075428_100003656 3300006844 Bacteria 16858
36 Ga0075428_100168565 3300006844 Unclassified 2375
37 Ga0075428_100507245 3300006844 Bacteria 1290
38 Ga0075428_101087352 3300006844 Bacteria 845
39 Ga0075430_100008346 3300006846 Bacteria 8748
40 Ga0075431_100007476 3300006847 Bacteria 10878
41 Ga0075431_100012925 3300006847 Bacteria 8428
42 Ga0075433_10001842 3300006852 Bacteria 15927
43 Ga0075433_10011395 3300006852 Bacteria 7160
44 Ga0075434_100000967 3300006871 Bacteria 23164
45 Ga0075434_100005618 3300006871 Bacteria 11431
46 Ga0075429_100005473 3300006880 Bacteria 10937
47 Ga0075429_100162594 3300006880 Bacteria 1955
48 Ga0075429_100636489 3300006880 Unclassified 934
49 Ga0075436_100296903 3300006914 Bacteria 1157
50 Ga0075435_100010097 3300007076 Bacteria 6889
51 Ga0075435_100185875 3300007076 Bacteria 1757
52 Ga0111539_10001701 3300009094 Bacteria 29310
53 Ga0111539_10097899 3300009094 Bacteria 3446
54 Ga0111539_10130071 3300009094 Bacteria 2948
55 Ga0114129_10001788 3300009147 Bacteria 29288
56 Ga0114129_10003435 3300009147 Bacteria 22270
57 Ga0114129_10006268 3300009147 Bacteria 16857
58 Ga0114129_10092335 3300009147 Bacteria 4194
59 Ga0114129_10603657 3300009147 Bacteria 1422
60 Ga0114129_10918667 3300009147 Bacteria 1108
61 Ga0114129_10977597 3300009147 Bacteria 1067
62 Ga0105243_10103124 3300009148 Unclassified 2372
63 Ga0105237_10192520 3300009545 Unclassified 2039
64 Ga0105238_10230216 3300009551 Bacteria 1830
65 Ga0105249_10010042 3300009553 Bacteria 8308
66 Ga0105249_10469086 3300009553 Bacteria 1300
67 Ga0105239_10112340 3300010375 Unclassified 3021
68 Ga0157374_10601053 3300013296 Bacteria 1110
69 Ga0163162_10009435 3300013306 Bacteria 9488
70 Ga0163163_10955937 3300014325 Bacteria 920
71 Ga0157380_11034200 3300014326 Unclassified 857
72 Ga0207705_10196569 3300025909 Bacteria 1527
73 Ga0207684_10000688 3300025910 Bacteria 39936
74 Ga0207694_10203893 3300025924 Unclassified 1609
75 Ga0207690_10080709 3300025932 Unclassified 2270
76 Ga0207709_10147411 3300025935 Bacteria 1626
77 Ga0207669_10185488 3300025937 Bacteria 1496
78 Ga0207704_10058946 3300025938 Unclassified 2367
79 Ga0207661_10015564 3300025944 Bacteria 5601
80 Ga0207679_10119690 3300025945 Bacteria 2094
81 Ga0207639_10907094 3300026041 Unclassified 824
82 Ga0207675_100018990 3300026118 Bacteria 6418
83 Ga0207675_101034422 3300026118 Unclassified 840
84 Ga0207683_10473549 3300026121 Bacteria 1155
85 Ga0207698_10231907 3300026142 Unclassified 1676
86 Ga0207428_10000732 3300027907 Bacteria 37790
87 Ga0307515_10000319 3300028794 Bacteria 118880
88 Ga0307513_10027253 3300031456 Bacteria 6564
89 Ga0307509_10403970 3300031507 Unclassified 1072
90 Ga0307408_101104460 3300031548 Bacteria 736
91 Ga0307514_10099536 3300031649 Bacteria 2092
92 Ga0307405_10142414 3300031731 Bacteria 1674
93 Ga0307406_10008907 3300031901 Bacteria 5610
94 Ga0307406_10067987 3300031901 Bacteria 2325
95 Ga0307412_10128512 3300031911 Bacteria 1837
96 Ga0307409_100246356 3300031995 Bacteria 1631
97 Ga0307409_100406906 3300031995 Bacteria 1301
98 Ga0307409_101190382 3300031995 Bacteria 785
99 Ga0307416_101155146 3300032002 Unclassified 879
100 Ga0307416_101701160 3300032002 Bacteria 735
101 Ga0307415_100162075 3300032126 Bacteria 1734
102 Ga0373951_0051883 3300035091 Bacteria 1010
103 Ga0373941_0067168 3300035115 Bacteria 1182
104 Ga0373931_0070530 3300035691 Bacteria 1907
105 Ga0395898_0239344 3300037466 Bacteria 1731
106 Ga0439448_0056538 3300042005 Bacteria 1292
107 Ga0439449_0023517 3300042007 Bacteria 2304
108 Ga0439451_048699 3300042009 Bacteria 848
109 Ga0439455_0009204 3300042012 Bacteria 2137
110 Ga0450923_008022 3300042125 Unclassified 1805
111 Ga0450908_010348 3300042184 Unclassified 1722
112 Ga0439460_0005350 3300042461 Bacteria 3148
113 Ga0439440_0055029 3300042993 Bacteria 1003
114 Ga0439440_0128247 3300042993 Bacteria 711
115 Ga0466960_0246667 3300044901 Bacteria 991
116 Ga0495637_0149018 3300046520 Bacteria 884
117 Ga0495637_0185419 3300046520 Archaea 770
118 Ga0495656_0173035 3300046615 Unclassified 1057
119 Ga0495671_0161455 3300046692 Bacteria 1090
120 Ga0496102_0432031 3300048905 Bacteria 1236
121 Ga0496104_0102976 3300048907 Bacteria 2735
122 Ga0496105_0019753 3300048908 Bacteria 5436
123 Ga0496108_0779402 3300048911 Unclassified 826
124 Ga0496114_0101173 3300048917 Bacteria 2460
125 Ga0501031_0000379 3300049568 Bacteria 26077
126 Ga0501031_0472298 3300049568 Unclassified 810
127 Ga0501032_0047747 3300049569 Bacteria 2891
128 Ga0501036_0021053 3300049572 Bacteria 5477
129 Ga0501036_0261716 3300049572 Bacteria 1449
130 Ga0501037_0055505 3300049573 Bacteria 2896
131 Ga0501038_0010413 3300049574 Bacteria 8502
132 Ga0501038_0120701 3300049574 Bacteria 2162
133 Ga0501038_0292095 3300049574 Unclassified 1281
134 Ga0501039_0030806 3300049575 Bacteria 4136
135 Ga0501039_0167957 3300049575 Bacteria 1725
136 Ga0501039_0399613 3300049575 Bacteria 1079
137 Ga0501040_0003152 3300049576 Bacteria 10700
138 Ga0501040_0021895 3300049576 Bacteria 4274
139 Ga0501040_0027144 3300049576 Bacteria 3853
140 Ga0501040_0091228 3300049576 Bacteria 2118
141 Ga0501040_0316962 3300049576 Bacteria 1115
142 Ga0501040_0506523 3300049576 Unclassified 870
143 Ga0501041_0005232 3300049577 Bacteria 7577
144 Ga0501041_0068831 3300049577 Bacteria 2170
145 Ga0501042_0008856 3300049578 Bacteria 6671
146 Ga0501042_0014924 3300049578 Bacteria 5311
147 Ga0501042_0047370 3300049578 Bacteria 3065
148 Ga0501042_0484598 3300049578 Unclassified 898
149 Ga0501042_0666133 3300049578 Bacteria 757
150 Ga0501043_0062007 3300049579 Bacteria 2936
151 Ga0501046_0003335 3300049580 Bacteria 14756
152 Ga0501046_0089237 3300049580 Bacteria 2373
153 Ga0501046_0273798 3300049580 Bacteria 1238
154 Ga0501048_0011469 3300049582 Bacteria 6612
155 Ga0501048_0028974 3300049582 Bacteria 4018
156 Ga0501048_0029075 3300049582 Bacteria 4011
157 Ga0501048_0126495 3300049582 Bacteria 1807
158 Ga0501068_0008648 3300049584 Bacteria 5675
159 Ga0501068_0028910 3300049584 Bacteria 3281
160 Ga0501069_0284245 3300049585 Bacteria 968
161 Ga0501070_0023679 3300049586 Bacteria 5145
162 Ga0501071_0021151 3300049587 Bacteria 4531
163 Ga0501071_0035656 3300049587 Bacteria 3544
164 Ga0501071_0078830 3300049587 Bacteria 2408
165 Ga0501071_0087307 3300049587 Bacteria 2288
166 Ga0501071_0445004 3300049587 Bacteria 991
167 Ga0501071_0913725 3300049587 Unclassified 677
168 Ga0501072_0009693 3300049588 Bacteria 7324
169 Ga0501072_0009836 3300049588 Bacteria 7270
170 Ga0501072_0017647 3300049588 Bacteria 5489
171 Ga0501072_0021152 3300049588 Bacteria 5048
172 Ga0501072_0039193 3300049588 Bacteria 3721
173 Ga0501072_0046023 3300049588 Bacteria 3432
174 Ga0501072_0187288 3300049588 Bacteria 1651
175 Ga0501072_0443158 3300049588 Bacteria 1029
176 Ga0501072_0521496 3300049588 Bacteria 939
177 Ga0501073_0576977 3300049589 Bacteria 777
178 Ga0501074_0003022 3300049590 Bacteria 11848
179 Ga0501074_0074683 3300049590 Bacteria 2434
180 Ga0501074_0093925 3300049590 Bacteria 2148
181 Ga0501074_0118409 3300049590 Bacteria 1894
182 Ga0501075_0004177 3300049591 Bacteria 9751
183 Ga0501075_0008107 3300049591 Bacteria 7306
184 Ga0501075_0009512 3300049591 Bacteria 6802
185 Ga0501075_0013412 3300049591 Bacteria 5849
186 Ga0501075_0097692 3300049591 Bacteria 2229
187 Ga0501075_0112804 3300049591 Bacteria 2067
188 Ga0501075_0122070 3300049591 Bacteria 1983
189 Ga0501075_0362715 3300049591 Bacteria 1104
190 Ga0501075_0705742 3300049591 Unclassified 768
191 Ga0501076_0011581 3300049592 Bacteria 6578
192 Ga0501076_0015070 3300049592 Bacteria 5836
193 Ga0501076_0017080 3300049592 Bacteria 5511
194 Ga0501076_0090701 3300049592 Bacteria 2458
195 Ga0501076_0214128 3300049592 Bacteria 1575
196 Ga0501076_0279979 3300049592 Bacteria 1366
197 Ga0501077_0009333 3300049593 Bacteria 6092
198 Ga0501077_0045270 3300049593 Bacteria 2795
199 Ga0501077_0132630 3300049593 Bacteria 1580
200 Ga0501079_0003649 3300049741 Bacteria 11339
201 Ga0501079_0017634 3300049741 Bacteria 5452
202 Ga0501079_0039216 3300049741 Bacteria 3653
203 Ga0501079_0059276 3300049741 Bacteria 2953
204 Ga0501079_0252294 3300049741 Bacteria 1379
205 Ga0501080_0035897 3300049742 Bacteria 4627
206 Ga0501080_0115505 3300049742 Bacteria 2489
207 Ga0501080_0143474 3300049742 Bacteria 2208
208 Ga0501080_0195429 3300049742 Bacteria 1858
209 Ga0501081_0009188 3300049743 Bacteria 6436
210 Ga0501081_0016714 3300049743 Bacteria 4851
211 Ga0501081_0021188 3300049743 Bacteria 4338
212 Ga0501081_0077919 3300049743 Bacteria 2317
213 Ga0501081_0107535 3300049743 Bacteria 1978
214 Ga0501081_0135230 3300049743 Bacteria 1764
215 Ga0501081_0195213 3300049743 Bacteria 1467
216 Ga0501081_0282192 3300049743 Bacteria 1216
217 Ga0501083_0012454 3300049744 Bacteria 5948
218 Ga0501083_0053507 3300049744 Bacteria 2710
219 Ga0501083_0107918 3300049744 Bacteria 1832
220 Ga0501035_0057359 3300049822 Bacteria 3472
221 Ga0501045_0004068 3300049824 Bacteria 10092
222 Ga0501045_0033724 3300049824 Bacteria 3713
223 Ga0501045_0051480 3300049824 Bacteria 3005
224 Ga0501045_0097347 3300049824 Bacteria 2177
225 Ga0501045_0381010 3300049824 Unclassified 1050
226 Ga0501045_0525018 3300049824 Unclassified 879
227 nmdc:mga05p37_2450_c1 3300050507 Bacteria 21567
228 nmdc:mga05p37_5710_c1 3300050507 Bacteria 14634
229 nmdc:mga05p37_62710_c1 3300050507 Bacteria 4575
230 nmdc:mga09592_23730_c1 3300050508 Bacteria 5067
231 nmdc:mga09592_500032_c1 3300050508 Bacteria 1047
232 nmdc:mga09592_849335_c1 3300050508 Unclassified 770
233 nmdc:mga06r32_24343_c1 3300050510 Bacteria 5618
234 nmdc:mga06r32_34166_c1 3300050510 Unclassified 4794
235 nmdc:mga08y16_20911_c1 3300050511 Bacteria 6910
236 nmdc:mga08y16_599038_c1 3300050511 Bacteria 1111
237 nmdc:mga0n895_1027_c1 3300050512 Bacteria 20306
238 nmdc:mga0n895_13402_c1 3300050512 Bacteria 7393
239 nmdc:mga0rr50_18866_c1 3300050513 Bacteria 4643
240 nmdc:mga08x19_223688_c1 3300050514 Bacteria 1294
241 nmdc:mga0a205_21413_c1 3300050515 Bacteria 6117
242 nmdc:mga0a205_981_c1 3300050515 Bacteria 23586
243 Ga0501084_0019217 3300054114 Bacteria 5690
244 Ga0501084_0036721 3300054114 Bacteria 4093
245 Ga0501084_0040231 3300054114 Bacteria 3910
246 Ga0501084_0096280 3300054114 Bacteria 2486
247 Ga0501084_0246783 3300054114 Bacteria 1507
248 Ga0501084_0637918 3300054114 Bacteria 899
249 Ga0501082_0012674 3300060353 Bacteria 7246
250 Ga0501082_0015934 3300060353 Bacteria 6465
251 Ga0501082_0024607 3300060353 Bacteria 5190
252 Ga0501082_0168382 3300060353 Bacteria 1904
253 Ga0501082_0443365 3300060353 Bacteria 1134
254 Ga0501082_0650829 3300060353 Bacteria 922
255 Ga0530510_0000820 3300061734 Bacteria 20361
256 Ga0530510_0032337 3300061734 Bacteria 3763
257 Ga0530510_0054746 3300061734 Bacteria 2883
258 Ga0530510_0185780 3300061734 Bacteria 1542
259 Ga0530510_0540574 3300061734 Bacteria 884
260 2676483936 2675903059 Bacteria 8644972
261 2753071182 2751185734 Bacteria 8863695
262 2791912056 2791354901 Bacteria 8322202
263 2816424427 2816332119 Bacteria 8120218
264 2870722015 2870721527 Bacteria 9689237
265 8047714896 8047710418 Bacteria 11023148
266 JGI25407J50210_10023666
267 JGI25407J50210_10028775
268 JGI25405J52794_10038760
269 JGI25405J52794_10042529
270 Ga0070658_10305429
271 Ga0070683_100008092
272 Ga0070674_100227087
273 Ga0070659_100011799
274 Ga0070663_100573582
275 Ga0070706_100000643
276 Ga0070707_101195962
277 Ga0070684_100022124
278 Ga0070697_100897500
279 Ga0068853_100336254
280 Ga0070664_100004924
281 Ga0070702_100504617
282 Ga0068861_100064144
283 Ga0068860_100262702
284 Ga0068862_100079514
285 Ga0081455_10001296
286 Ga0081455_10011360
287 Ga0081455_10032597
288 Ga0081455_10044361
289 Ga0081455_10063689
290 Ga0081538_10003503
291 Ga0081538_10005273
292 Ga0081538_10010884
293 Ga0081538_10021736
294 Ga0081538_10025244
295 Ga0081538_10050297
296 Ga0081538_10067400
297 Ga0081538_10072109
298 Ga0075432_10015367
299 Ga0075428_100003535
300 Ga0075428_100003656
301 Ga0075428_100168565
302 Ga0075428_100507245
303 Ga0075428_101087352
304 Ga0075430_100008346
305 Ga0075431_100007476
306 Ga0075431_100012925
307 Ga0075433_10001842
308 Ga0075433_10011395
309 Ga0075434_100000967
310 Ga0075434_100005618
311 Ga0075429_100005473
312 Ga0075429_100162594
313 Ga0075429_100636489
314 Ga0075436_100296903
315 Ga0075435_100010097
316 Ga0075435_100185875
317 Ga0111539_10001701
318 Ga0111539_10097899
319 Ga0111539_10130071
320 Ga0114129_10001788
321 Ga0114129_10003435
322 Ga0114129_10006268
323 Ga0114129_10092335
324 Ga0114129_10603657
325 Ga0114129_10918667
326 Ga0114129_10977597
327 Ga0105243_10103124
328 Ga0105237_10192520
329 Ga0105238_10230216
330 Ga0105249_10010042
331 Ga0105249_10469086
332 Ga0105239_10112340
333 Ga0157374_10601053
334 Ga0163162_10009435
335 Ga0163163_10955937
336 Ga0157380_11034200
337 Ga0207705_10196569
338 Ga0207684_10000688
339 Ga0207694_10203893
340 Ga0207690_10080709
341 Ga0207709_10147411
342 Ga0207669_10185488
343 Ga0207704_10058946
344 Ga0207661_10015564
345 Ga0207679_10119690
346 Ga0207639_10907094
347 Ga0207675_100018990
348 Ga0207675_101034422
349 Ga0207683_10473549
350 Ga0207698_10231907
351 Ga0207428_10000732
352 Ga0307515_10000319
353 Ga0307513_10027253
354 Ga0307509_10403970
355 Ga0307408_101104460
356 Ga0307514_10099536
357 Ga0307405_10142414
358 Ga0307406_10008907
359 Ga0307406_10067987
360 Ga0307412_10128512
361 Ga0307409_100246356
362 Ga0307409_100406906
363 Ga0307409_101190382
364 Ga0307416_101155146
365 Ga0307416_101701160
366 Ga0307415_100162075
367 Ga0373951_0051883
368 Ga0373941_0067168
369 Ga0373931_0070530
370 Ga0395898_0239344
371 Ga0439448_0056538
372 Ga0439449_0023517
373 Ga0439451_048699
374 Ga0439455_0009204
375 Ga0450923_008022
376 Ga0450908_010348
377 Ga0439460_0005350
378 Ga0439440_0055029
379 Ga0439440_0128247
380 Ga0466960_0246667
381 Ga0495637_0149018
382 Ga0495637_0185419
383 Ga0495656_0173035
384 Ga0495671_0161455
385 Ga0496102_0432031
386 Ga0496104_0102976
387 Ga0496105_0019753
388 Ga0496108_0779402
389 Ga0496114_0101173
390 Ga0501031_0000379
391 Ga0501031_0472298
392 Ga0501032_0047747
393 Ga0501036_0021053
394 Ga0501036_0261716
395 Ga0501037_0055505
396 Ga0501038_0010413
397 Ga0501038_0120701
398 Ga0501038_0292095
399 Ga0501039_0030806
400 Ga0501039_0167957
401 Ga0501039_0399613
402 Ga0501040_0003152
403 Ga0501040_0021895
404 Ga0501040_0027144
405 Ga0501040_0091228
406 Ga0501040_0316962
407 Ga0501040_0506523
408 Ga0501041_0005232
409 Ga0501041_0068831
410 Ga0501042_0008856
411 Ga0501042_0014924
412 Ga0501042_0047370
413 Ga0501042_0484598
414 Ga0501042_0666133
415 Ga0501043_0062007
416 Ga0501046_0003335
417 Ga0501046_0089237
418 Ga0501046_0273798
419 Ga0501048_0011469
420 Ga0501048_0028974
421 Ga0501048_0029075
422 Ga0501048_0126495
423 Ga0501068_0008648
424 Ga0501068_0028910
425 Ga0501069_0284245
426 Ga0501070_0023679
427 Ga0501071_0021151
428 Ga0501071_0035656
429 Ga0501071_0078830
430 Ga0501071_0087307
431 Ga0501071_0445004
432 Ga0501071_0913725
433 Ga0501072_0009693
434 Ga0501072_0009836
435 Ga0501072_0017647
436 Ga0501072_0021152
437 Ga0501072_0039193
438 Ga0501072_0046023
439 Ga0501072_0187288
440 Ga0501072_0443158
441 Ga0501072_0521496
442 Ga0501073_0576977
443 Ga0501074_0003022
444 Ga0501074_0074683
445 Ga0501074_0093925
446 Ga0501074_0118409
447 Ga0501075_0004177
448 Ga0501075_0008107
449 Ga0501075_0009512
450 Ga0501075_0013412
451 Ga0501075_0097692
452 Ga0501075_0112804
453 Ga0501075_0122070
454 Ga0501075_0362715
455 Ga0501075_0705742
456 Ga0501076_0011581
457 Ga0501076_0015070
458 Ga0501076_0017080
459 Ga0501076_0090701
460 Ga0501076_0214128
461 Ga0501076_0279979
462 Ga0501077_0009333
463 Ga0501077_0045270
464 Ga0501077_0132630
465 Ga0501079_0003649
466 Ga0501079_0017634
467 Ga0501079_0039216
468 Ga0501079_0059276
469 Ga0501079_0252294
470 Ga0501080_0035897
471 Ga0501080_0115505
472 Ga0501080_0143474
473 Ga0501080_0195429
474 Ga0501081_0009188
475 Ga0501081_0016714
476 Ga0501081_0021188
477 Ga0501081_0077919
478 Ga0501081_0107535
479 Ga0501081_0135230
480 Ga0501081_0195213
481 Ga0501081_0282192
482 Ga0501083_0012454
483 Ga0501083_0053507
484 Ga0501083_0107918
485 Ga0501035_0057359
486 Ga0501045_0004068
487 Ga0501045_0033724
488 Ga0501045_0051480
489 Ga0501045_0097347
490 Ga0501045_0381010
491 Ga0501045_0525018
492 nmdc:mga05p37_2450_c1
493 nmdc:mga05p37_5710_c1
494 nmdc:mga05p37_62710_c1
495 nmdc:mga09592_23730_c1
496 nmdc:mga09592_500032_c1
497 nmdc:mga09592_849335_c1
498 nmdc:mga06r32_24343_c1
499 nmdc:mga06r32_34166_c1
500 nmdc:mga08y16_20911_c1
501 nmdc:mga08y16_599038_c1
502 nmdc:mga0n895_1027_c1
503 nmdc:mga0n895_13402_c1
504 nmdc:mga0rr50_18866_c1
505 nmdc:mga08x19_223688_c1
506 nmdc:mga0a205_21413_c1
507 nmdc:mga0a205_981_c1
508 Ga0501084_0019217
509 Ga0501084_0036721
510 Ga0501084_0040231
511 Ga0501084_0096280
512 Ga0501084_0246783
513 Ga0501084_0637918
514 Ga0501082_0012674
515 Ga0501082_0015934
516 Ga0501082_0024607
517 Ga0501082_0168382
518 Ga0501082_0443365
519 Ga0501082_0650829
520 Ga0530510_0000820
521 Ga0530510_0032337
522 Ga0530510_0054746
523 Ga0530510_0185780
524 Ga0530510_0540574
525 2676483936
526 2753071182
527 2791912056
528 2816424427
529 2870722015
530 8047714896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

35

148

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8789 10 180
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8784 10 179
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8632 10 180
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.858 10 179
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8245 10 183
ID Description Score Start End Superfamily
af_B6U7Y1_211_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8734 27 116 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8535 10 180 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8379 10 180 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8245 10 183 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8239 25 124 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2T0Q5D8-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.978 1 207
AF-A0A4R1WHQ1-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9774 1 203
AF-A0A5P9Q0X2-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9654 1 203
AF-A0A542EAC6-F1-model_v4 Activator of Hsp90 ATPase-like protein 0.961 1 204
AF-A0A1S8C5T2-F1-model_v4 ATPase 0.9578 96 207

Map