F372981

General Info

Members Datasets Scaffolds Average Seq Length
264 159 528 387

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857481737|2857483070
Length 422
Sequence SRRAALRGLLRRPLTALAVAALGAALLSGCDGGGSALSSGASAGTDGGTGGSSAGSSPSAGSSSEADASAAVLDASIPKGKTDVAVDTPLQLSATDGELSAVRVKGTGDAGELAGAMGSDGSWASTGRLEPGATYTVRAEIEDGDGQTVVRRTGFTTADLTLDQQTYPSVAPLSGETVGVGMPVIVTFDVPVTDKASFEKHMSVTTTPEQPGTWHWMSDTEVHYRPKKYWQPGTKVDVDVDVNSVPAGNGIYGQESRAVDFTIGDSHVYKVNAQTHQMQVFSNGKKLRTIPITTGKAGFTTRSGTKVIIEKFDSKRMNSETVGIPAGSADAYDIDNVQWAMRLTYSGEFIHAAPWSVGSQGSANVSHGCTGMSTANADWLYHMSQRGDVVEYTGTDRPMTLDNGYGDWNASWADYTQGSALS

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
85 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
157 2643221615 Nocardioides sp. Root224 Isolate Unclassified
158 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
159 2738541305 Nocardioides sp. CF167 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 4.17
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 0
Rhizoplane 3.79
Rhizosphere 79.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002032 3300000549 Bacteria 2895
2 JGI24735J21928_10016157 3300002067 Bacteria 2321
3 Ga0058858_1011052 3300004785 Bacteria 1536
4 Ga0058858_1436615 3300004785 Bacteria 1508
5 Ga0070658_10016237 3300005327 Bacteria 5957
6 Ga0070658_10018174 3300005327 Bacteria 5624
7 Ga0070658_10076516 3300005327 Bacteria 2744
8 Ga0070683_100029803 3300005329 Bacteria 4945
9 Ga0070682_100021738 3300005337 Bacteria 3791
10 Ga0068868_100070120 3300005338 Bacteria 2794
11 Ga0070689_100093109 3300005340 Bacteria 2378
12 Ga0070687_100038425 3300005343 Bacteria 2399
13 Ga0070692_10025775 3300005345 Bacteria 2901
14 Ga0070674_100106985 3300005356 Bacteria 2047
15 Ga0070673_100105409 3300005364 Bacteria 2329
16 Ga0070659_100008655 3300005366 Bacteria 7444
17 Ga0070659_100012753 3300005366 Bacteria 6239
18 Ga0070701_10018385 3300005438 Bacteria 3284
19 Ga0070700_100001934 3300005441 Bacteria 10490
20 Ga0070681_10049405 3300005458 Bacteria 4201
21 Ga0070685_10078142 3300005466 Bacteria 1978
22 Ga0070679_100119939 3300005530 Bacteria 2615
23 Ga0070684_100000520 3300005535 Bacteria 26402
24 Ga0068853_100049440 3300005539 Bacteria 3614
25 Ga0070672_100052553 3300005543 Bacteria 3181
26 Ga0070665_100054478 3300005548 Bacteria 4011
27 Ga0068855_100134365 3300005563 Bacteria 2823
28 Ga0070664_100048853 3300005564 Bacteria 3577
29 Ga0068857_100017453 3300005577 Bacteria 6291
30 Ga0068856_100084487 3300005614 Bacteria 3153
31 Ga0068852_100098245 3300005616 Bacteria 2636
32 Ga0068861_100009205 3300005719 Bacteria 6811
33 Ga0068860_100008444 3300005843 Bacteria 10259
34 Ga0068860_100070366 3300005843 Bacteria 3326
35 Ga0081455_10101409 3300005937 Bacteria 2310
36 Ga0075365_10002298 3300006038 Bacteria 9294
37 Ga0075365_10034925 3300006038 Bacteria 3250
38 Ga0075365_10037394 3300006038 Bacteria 3151
39 Ga0075365_10043771 3300006038 Bacteria 2931
40 Ga0075365_10068187 3300006038 Bacteria 2389
41 Ga0075365_10075864 3300006038 Bacteria 2270
42 Ga0075365_10077750 3300006038 Bacteria 2242
43 Ga0075363_100006603 3300006048 Bacteria 5285
44 Ga0075363_100007648 3300006048 Bacteria 4983
45 Ga0075363_100025757 3300006048 Bacteria 3003
46 Ga0075364_10005194 3300006051 Bacteria 7553
47 Ga0075364_10016934 3300006051 Bacteria 4542
48 Ga0075364_10046244 3300006051 Bacteria 2833
49 Ga0075364_10059407 3300006051 Bacteria 2506
50 Ga0075364_10125333 3300006051 Bacteria 1721
51 Ga0075364_10125897 3300006051 Bacteria 1718
52 Ga0075367_10030756 3300006178 Bacteria 3080
53 Ga0075367_10053815 3300006178 Bacteria 2386
54 Ga0097621_100109061 3300006237 Bacteria 2338
55 Ga0075370_10002627 3300006353 Bacteria 8385
56 Ga0075370_10023318 3300006353 Bacteria 3407
57 Ga0068865_100016326 3300006881 Bacteria 4750
58 Ga0111539_10493724 3300009094 Bacteria 1426
59 Ga0105245_10023011 3300009098 Bacteria 5467
60 Ga0114129_10066294 3300009147 Bacteria 5037
61 Ga0114129_10193999 3300009147 Bacteria 2756
62 Ga0105243_10006664 3300009148 Bacteria 8918
63 Ga0105243_10018667 3300009148 Bacteria 5255
64 Ga0105248_10062422 3300009177 Bacteria 4184
65 Ga0105248_10083953 3300009177 Bacteria 3583
66 Ga0105237_10170643 3300009545 Bacteria 2175
67 Ga0105238_10072138 3300009551 Bacteria 3450
68 Ga0105249_10015783 3300009553 Bacteria 6690
69 Ga0105249_10121796 3300009553 Bacteria 2480
70 Ga0105239_10007996 3300010375 Bacteria 12073
71 Ga0105239_10100147 3300010375 Bacteria 3205
72 Ga0163162_10012578 3300013306 Bacteria 8266
73 Ga0157372_10016621 3300013307 Bacteria 7895
74 Ga0157372_10132769 3300013307 Bacteria 2866
75 Ga0157375_10019045 3300013308 Bacteria 6232
76 Ga0157375_10382831 3300013308 Bacteria 1573
77 Ga0163163_10185242 3300014325 Bacteria 2129
78 Ga0157377_10044174 3300014745 Bacteria 2483
79 Ga0157377_10098165 3300014745 Bacteria 1741
80 Ga0206352_10951383 3300020078 Bacteria 1401
81 Ga0206354_10386419 3300020081 Bacteria 1690
82 Ga0207688_10007640 3300025901 Bacteria 5887
83 Ga0207705_10073734 3300025909 Bacteria 2477
84 Ga0207707_10066323 3300025912 Bacteria 3144
85 Ga0207660_10067977 3300025917 Bacteria 2583
86 Ga0207662_10078613 3300025918 Bacteria 2008
87 Ga0207657_10201265 3300025919 Bacteria 1602
88 Ga0207652_10102531 3300025921 Bacteria 2529
89 Ga0207687_10024035 3300025927 Bacteria 4066
90 Ga0207690_10033737 3300025932 Bacteria 3293
91 Ga0207706_10161100 3300025933 Bacteria 1972
92 Ga0207709_10024487 3300025935 Bacteria 3447
93 Ga0207691_10003929 3300025940 Bacteria 14444
94 Ga0207711_10125093 3300025941 Bacteria 2299
95 Ga0207661_10131582 3300025944 Bacteria 2143
96 Ga0207667_10168153 3300025949 Bacteria 2254
97 Ga0207712_10063585 3300025961 Bacteria 2628
98 Ga0207712_10116700 3300025961 Bacteria 2012
99 Ga0207640_10072766 3300025981 Bacteria 2320
100 Ga0207677_10053881 3300026023 Bacteria 2741
101 Ga0207677_10182762 3300026023 Bacteria 1651
102 Ga0207708_10004775 3300026075 Bacteria 9978
103 Ga0207674_10147759 3300026116 Bacteria 2308
104 Ga0207675_100001326 3300026118 Bacteria 24790
105 Ga0207698_10043308 3300026142 Bacteria 3371
106 Ga0207698_10239247 3300026142 Bacteria 1653
107 Ga0268266_10001844 3300028379 Bacteria 23906
108 Ga0268264_10000843 3300028381 Bacteria 32793
109 Ga0268264_10012672 3300028381 Bacteria 6941
110 Ga0307410_10101722 3300031852 Bacteria 2061
111 Ga0307416_100100332 3300032002 Bacteria 2517
112 Ga0307415_100218067 3300032126 Bacteria 1527
113 Ga0395900_0084809 3300037418 Bacteria 3256
114 Ga0436364_1123713 3300037853 Bacteria 3237
115 Ga0395901_0068495 3300038443 Bacteria 3697
116 Ga0451837_0223869 3300041494 Bacteria 8135
117 Ga0451839_0944622 3300041496 Bacteria 2619
118 Ga0466972_0025623 3300044658 Bacteria 2922
119 Ga0466972_0037382 3300044658 Bacteria 2374
120 Ga0466965_0024651 3300044683 Bacteria 2911
121 Ga0466965_0029335 3300044683 Bacteria 2677
122 Ga0466966_0026549 3300044684 Bacteria 3781
123 Ga0466964_0015995 3300044706 Bacteria 2858
124 Ga0466968_0051097 3300044735 Bacteria 1766
125 Ga0466970_0105671 3300044765 Bacteria 1536
126 Ga0466970_0118100 3300044765 Bacteria 1451
127 Ga0466957_0038529 3300044842 Bacteria 2880
128 Ga0466960_0000473 3300044901 Bacteria 13691
129 Ga0466960_0038000 3300044901 Bacteria 2261
130 Ga0466960_0087974 3300044901 Bacteria 1578
131 Ga0466960_0091818 3300044901 Bacteria 1549
132 Ga0451576_0153046 3300045051 Bacteria 2405
133 Ga0466967_0001211 3300045976 Bacteria 14529
134 Ga0466967_0008757 3300045976 Bacteria 7454
135 Ga0466967_0011586 3300045976 Bacteria 6692
136 Ga0466967_0113831 3300045976 Bacteria 2490
137 Ga0466967_0226941 3300045976 Bacteria 1777
138 Ga0466967_0280563 3300045976 Bacteria 1598
139 Ga0466967_0400515 3300045976 Bacteria 1335
140 Ga0495657_0064769 3300046675 Bacteria 2406
141 Ga0496102_0015450 3300048905 Bacteria 6650
142 Ga0496102_0042709 3300048905 Bacteria 4109
143 Ga0496105_0097996 3300048908 Bacteria 2421
144 Ga0496107_0006723 3300048910 Bacteria 7921
145 Ga0496108_0053970 3300048911 Bacteria 3372
146 Ga0496110_0083879 3300048913 Bacteria 2843
147 Ga0496110_0467669 3300048913 Bacteria 1149
148 Ga0496111_0071260 3300048914 Bacteria 2529
149 Ga0496113_0284073 3300048916 Bacteria 1324
150 Ga0496114_0035136 3300048917 Bacteria 4137
151 Ga0501310_003656 3300049130 Bacteria 1513
152 Ga0501312_006055 3300049528 Bacteria 1494
153 Ga0501313_007825 3300049529 Bacteria 1182
154 Ga0501317_002872 3300049533 Bacteria 1669
155 Ga0501318_000982 3300049534 Bacteria 2079
156 Ga0501321_001444 3300049537 Bacteria 1888
157 Ga0501323_004926 3300049539 Bacteria 1437
158 Ga0501031_0003445 3300049568 Bacteria 10151
159 Ga0501031_0004245 3300049568 Bacteria 9254
160 Ga0501031_0006306 3300049568 Bacteria 7732
161 Ga0501031_0058218 3300049568 Bacteria 2518
162 Ga0501031_0058739 3300049568 Bacteria 2507
163 Ga0501032_0005543 3300049569 Bacteria 9366
164 Ga0501033_0018544 3300049570 Bacteria 5259
165 Ga0501034_0061577 3300049571 Bacteria 3768
166 Ga0501034_0201634 3300049571 Bacteria 1947
167 Ga0501036_0002283 3300049572 Bacteria 14995
168 Ga0501036_0002493 3300049572 Bacteria 14439
169 Ga0501036_0008684 3300049572 Bacteria 8336
170 Ga0501036_0061271 3300049572 Bacteria 3187
171 Ga0501036_0063499 3300049572 Bacteria 3127
172 Ga0501037_0007658 3300049573 Bacteria 7908
173 Ga0501037_0008499 3300049573 Bacteria 7528
174 Ga0501038_0002765 3300049574 Bacteria 16329
175 Ga0501038_0020250 3300049574 Bacteria 5984
176 Ga0501038_0105082 3300049574 Bacteria 2346
177 Ga0501039_0001873 3300049575 Bacteria 15543
178 Ga0501039_0064159 3300049575 Bacteria 2847
179 Ga0501040_0013748 3300049576 Bacteria 5325
180 Ga0501040_0030495 3300049576 Bacteria 3642
181 Ga0501040_0077995 3300049576 Bacteria 2292
182 Ga0501041_0007852 3300049577 Bacteria 6269
183 Ga0501041_0082676 3300049577 Bacteria 1979
184 Ga0501042_0014776 3300049578 Bacteria 5331
185 Ga0501043_0107689 3300049579 Bacteria 2189
186 Ga0501043_0147564 3300049579 Bacteria 1841
187 Ga0501046_0000841 3300049580 Bacteria 29918
188 Ga0501046_0001259 3300049580 Bacteria 24523
189 Ga0501046_0014681 3300049580 Bacteria 6597
190 Ga0501047_0083154 3300049581 Bacteria 3077
191 Ga0501048_0002290 3300049582 Bacteria 14604
192 Ga0501048_0018462 3300049582 Bacteria 5128
193 Ga0501048_0027934 3300049582 Bacteria 4098
194 Ga0501048_0244082 3300049582 Bacteria 1274
195 Ga0501067_0005656 3300049583 Bacteria 6940
196 Ga0501067_0059251 3300049583 Bacteria 2119
197 Ga0501068_0058252 3300049584 Bacteria 2343
198 Ga0501069_0037504 3300049585 Bacteria 2675
199 Ga0501069_0045836 3300049585 Bacteria 2423
200 Ga0501069_0070912 3300049585 Bacteria 1953
201 Ga0501069_0088711 3300049585 Bacteria 1748
202 Ga0501070_0006526 3300049586 Bacteria 9924
203 Ga0501070_0036141 3300049586 Bacteria 4125
204 Ga0501070_0087581 3300049586 Bacteria 2577
205 Ga0501070_0108880 3300049586 Bacteria 2289
206 Ga0501071_0011299 3300049587 Bacteria 6010
207 Ga0501071_0039823 3300049587 Bacteria 3362
208 Ga0501071_0040247 3300049587 Bacteria 3344
209 Ga0501071_0060213 3300049587 Bacteria 2748
210 Ga0501072_0040764 3300049588 Bacteria 3646
211 Ga0501072_0091613 3300049588 Bacteria 2413
212 Ga0501072_0101098 3300049588 Bacteria 2291
213 Ga0501072_0190207 3300049588 Bacteria 1637
214 Ga0501072_0195851 3300049588 Bacteria 1611
215 Ga0501073_0047056 3300049589 Bacteria 3032
216 Ga0501074_0085426 3300049590 Bacteria 2261
217 Ga0501074_0094015 3300049590 Bacteria 2147
218 Ga0501075_0068711 3300049591 Bacteria 2677
219 Ga0501075_0195090 3300049591 Bacteria 1544
220 Ga0501076_0003246 3300049592 Bacteria 11377
221 Ga0501076_0088792 3300049592 Bacteria 2485
222 Ga0501077_0023411 3300049593 Bacteria 3916
223 Ga0501079_0027103 3300049741 Bacteria 4392
224 Ga0501079_0116968 3300049741 Bacteria 2072
225 Ga0501079_0134419 3300049741 Bacteria 1925
226 Ga0501079_0184852 3300049741 Bacteria 1627
227 Ga0501080_0009657 3300049742 Bacteria 8810
228 Ga0501080_0122006 3300049742 Bacteria 2414
229 Ga0501081_0039562 3300049743 Bacteria 3227
230 Ga0501083_0030445 3300049744 Bacteria 3708
231 Ga0501083_0075336 3300049744 Bacteria 2241
232 Ga0501035_0001212 3300049822 Bacteria 26882
233 Ga0501035_0044428 3300049822 Bacteria 4001
234 Ga0501035_0241690 3300049822 Bacteria 1535
235 Ga0501044_0017119 3300049823 Bacteria 7778
236 Ga0501045_0053688 3300049824 Bacteria 2945
237 nmdc:mga03n38_6654_c1 3300050490 Bacteria 4035
238 nmdc:mga03n38_73592_c1 3300050490 Bacteria 1587
239 nmdc:mga00v17_101856_c1 3300050491 Bacteria 1813
240 nmdc:mga00v17_11465_c1 3300050491 Bacteria 4871
241 nmdc:mga00v17_24335_c1 3300050491 Bacteria 3511
242 nmdc:mga00v17_48411_c1 3300050491 Bacteria 2577
243 nmdc:mga00v17_89823_c1 3300050491 Bacteria 1928
244 nmdc:mga0yw44_134869_c1 3300050492 Bacteria 1601
245 nmdc:mga0yw44_29867_c1 3300050492 Bacteria 3152
246 nmdc:mga0yw44_47159_c1 3300050492 Bacteria 2592
247 nmdc:mga0yw44_59993_c1 3300050492 Bacteria 2329
248 nmdc:mga07m45_14359_c1 3300050496 Bacteria 3913
249 nmdc:mga07m45_36596_c1 3300050496 Bacteria 2735
250 nmdc:mga09592_143981_c1 3300050508 Bacteria 2055
251 Ga0495619_0092625 3300053085 Bacteria 2047
252 Ga0500644_0000630 3300053088 Bacteria 13175
253 Ga0500573_0003452 3300053140 Bacteria 8181
254 Ga0501084_0049475 3300054114 Bacteria 3519
255 Ga0501084_0099166 3300054114 Bacteria 2446
256 Ga0501084_0105656 3300054114 Bacteria 2365
257 Ga0501082_0071515 3300060353 Bacteria 2987
258 Ga0501082_0248604 3300060353 Bacteria 1548
259 Ga0530510_0068272 3300061734 Bacteria 2579
260 Ga0530510_0124652 3300061734 Bacteria 1893
261 2857483070 2857481737 Bacteria 4761446
262 2644089676 2643221615 Bacteria 5487866
263 2644319521 2643221657 Bacteria 5490246
264 2738867984 2738541305 Bacteria 4910150
265 LJQas_1002032
266 JGI24735J21928_10016157
267 Ga0058858_1011052
268 Ga0058858_1436615
269 Ga0070658_10016237
270 Ga0070658_10018174
271 Ga0070658_10076516
272 Ga0070683_100029803
273 Ga0070682_100021738
274 Ga0068868_100070120
275 Ga0070689_100093109
276 Ga0070687_100038425
277 Ga0070692_10025775
278 Ga0070674_100106985
279 Ga0070673_100105409
280 Ga0070659_100008655
281 Ga0070659_100012753
282 Ga0070701_10018385
283 Ga0070700_100001934
284 Ga0070681_10049405
285 Ga0070685_10078142
286 Ga0070679_100119939
287 Ga0070684_100000520
288 Ga0068853_100049440
289 Ga0070672_100052553
290 Ga0070665_100054478
291 Ga0068855_100134365
292 Ga0070664_100048853
293 Ga0068857_100017453
294 Ga0068856_100084487
295 Ga0068852_100098245
296 Ga0068861_100009205
297 Ga0068860_100008444
298 Ga0068860_100070366
299 Ga0081455_10101409
300 Ga0075365_10002298
301 Ga0075365_10034925
302 Ga0075365_10037394
303 Ga0075365_10043771
304 Ga0075365_10068187
305 Ga0075365_10075864
306 Ga0075365_10077750
307 Ga0075363_100006603
308 Ga0075363_100007648
309 Ga0075363_100025757
310 Ga0075364_10005194
311 Ga0075364_10016934
312 Ga0075364_10046244
313 Ga0075364_10059407
314 Ga0075364_10125333
315 Ga0075364_10125897
316 Ga0075367_10030756
317 Ga0075367_10053815
318 Ga0097621_100109061
319 Ga0075370_10002627
320 Ga0075370_10023318
321 Ga0068865_100016326
322 Ga0111539_10493724
323 Ga0105245_10023011
324 Ga0114129_10066294
325 Ga0114129_10193999
326 Ga0105243_10006664
327 Ga0105243_10018667
328 Ga0105248_10062422
329 Ga0105248_10083953
330 Ga0105237_10170643
331 Ga0105238_10072138
332 Ga0105249_10015783
333 Ga0105249_10121796
334 Ga0105239_10007996
335 Ga0105239_10100147
336 Ga0163162_10012578
337 Ga0157372_10016621
338 Ga0157372_10132769
339 Ga0157375_10019045
340 Ga0157375_10382831
341 Ga0163163_10185242
342 Ga0157377_10044174
343 Ga0157377_10098165
344 Ga0206352_10951383
345 Ga0206354_10386419
346 Ga0207688_10007640
347 Ga0207705_10073734
348 Ga0207707_10066323
349 Ga0207660_10067977
350 Ga0207662_10078613
351 Ga0207657_10201265
352 Ga0207652_10102531
353 Ga0207687_10024035
354 Ga0207690_10033737
355 Ga0207706_10161100
356 Ga0207709_10024487
357 Ga0207691_10003929
358 Ga0207711_10125093
359 Ga0207661_10131582
360 Ga0207667_10168153
361 Ga0207712_10063585
362 Ga0207712_10116700
363 Ga0207640_10072766
364 Ga0207677_10053881
365 Ga0207677_10182762
366 Ga0207708_10004775
367 Ga0207674_10147759
368 Ga0207675_100001326
369 Ga0207698_10043308
370 Ga0207698_10239247
371 Ga0268266_10001844
372 Ga0268264_10000843
373 Ga0268264_10012672
374 Ga0307410_10101722
375 Ga0307416_100100332
376 Ga0307415_100218067
377 Ga0395900_0084809
378 Ga0436364_1123713
379 Ga0395901_0068495
380 Ga0451837_0223869
381 Ga0451839_0944622
382 Ga0466972_0025623
383 Ga0466972_0037382
384 Ga0466965_0024651
385 Ga0466965_0029335
386 Ga0466966_0026549
387 Ga0466964_0015995
388 Ga0466968_0051097
389 Ga0466970_0105671
390 Ga0466970_0118100
391 Ga0466957_0038529
392 Ga0466960_0000473
393 Ga0466960_0038000
394 Ga0466960_0087974
395 Ga0466960_0091818
396 Ga0451576_0153046
397 Ga0466967_0001211
398 Ga0466967_0008757
399 Ga0466967_0011586
400 Ga0466967_0113831
401 Ga0466967_0226941
402 Ga0466967_0280563
403 Ga0466967_0400515
404 Ga0495657_0064769
405 Ga0496102_0015450
406 Ga0496102_0042709
407 Ga0496105_0097996
408 Ga0496107_0006723
409 Ga0496108_0053970
410 Ga0496110_0083879
411 Ga0496110_0467669
412 Ga0496111_0071260
413 Ga0496113_0284073
414 Ga0496114_0035136
415 Ga0501310_003656
416 Ga0501312_006055
417 Ga0501313_007825
418 Ga0501317_002872
419 Ga0501318_000982
420 Ga0501321_001444
421 Ga0501323_004926
422 Ga0501031_0003445
423 Ga0501031_0004245
424 Ga0501031_0006306
425 Ga0501031_0058218
426 Ga0501031_0058739
427 Ga0501032_0005543
428 Ga0501033_0018544
429 Ga0501034_0061577
430 Ga0501034_0201634
431 Ga0501036_0002283
432 Ga0501036_0002493
433 Ga0501036_0008684
434 Ga0501036_0061271
435 Ga0501036_0063499
436 Ga0501037_0007658
437 Ga0501037_0008499
438 Ga0501038_0002765
439 Ga0501038_0020250
440 Ga0501038_0105082
441 Ga0501039_0001873
442 Ga0501039_0064159
443 Ga0501040_0013748
444 Ga0501040_0030495
445 Ga0501040_0077995
446 Ga0501041_0007852
447 Ga0501041_0082676
448 Ga0501042_0014776
449 Ga0501043_0107689
450 Ga0501043_0147564
451 Ga0501046_0000841
452 Ga0501046_0001259
453 Ga0501046_0014681
454 Ga0501047_0083154
455 Ga0501048_0002290
456 Ga0501048_0018462
457 Ga0501048_0027934
458 Ga0501048_0244082
459 Ga0501067_0005656
460 Ga0501067_0059251
461 Ga0501068_0058252
462 Ga0501069_0037504
463 Ga0501069_0045836
464 Ga0501069_0070912
465 Ga0501069_0088711
466 Ga0501070_0006526
467 Ga0501070_0036141
468 Ga0501070_0087581
469 Ga0501070_0108880
470 Ga0501071_0011299
471 Ga0501071_0039823
472 Ga0501071_0040247
473 Ga0501071_0060213
474 Ga0501072_0040764
475 Ga0501072_0091613
476 Ga0501072_0101098
477 Ga0501072_0190207
478 Ga0501072_0195851
479 Ga0501073_0047056
480 Ga0501074_0085426
481 Ga0501074_0094015
482 Ga0501075_0068711
483 Ga0501075_0195090
484 Ga0501076_0003246
485 Ga0501076_0088792
486 Ga0501077_0023411
487 Ga0501079_0027103
488 Ga0501079_0116968
489 Ga0501079_0134419
490 Ga0501079_0184852
491 Ga0501080_0009657
492 Ga0501080_0122006
493 Ga0501081_0039562
494 Ga0501083_0030445
495 Ga0501083_0075336
496 Ga0501035_0001212
497 Ga0501035_0044428
498 Ga0501035_0241690
499 Ga0501044_0017119
500 Ga0501045_0053688
501 nmdc:mga03n38_6654_c1
502 nmdc:mga03n38_73592_c1
503 nmdc:mga00v17_101856_c1
504 nmdc:mga00v17_11465_c1
505 nmdc:mga00v17_24335_c1
506 nmdc:mga00v17_48411_c1
507 nmdc:mga00v17_89823_c1
508 nmdc:mga0yw44_134869_c1
509 nmdc:mga0yw44_29867_c1
510 nmdc:mga0yw44_47159_c1
511 nmdc:mga0yw44_59993_c1
512 nmdc:mga07m45_14359_c1
513 nmdc:mga07m45_36596_c1
514 nmdc:mga09592_143981_c1
515 Ga0495619_0092625
516 Ga0500644_0000630
517 Ga0500573_0003452
518 Ga0501084_0049475
519 Ga0501084_0099166
520 Ga0501084_0105656
521 Ga0501082_0071515
522 Ga0501082_0248604
523 Ga0530510_0068272
524 Ga0530510_0124652
525 2857483070
526 2644089676
527 2644319521
528 2738867984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17964

Big_10

Bacterial Ig domain

81

246

0.94

PF03734

YkuD

L,D-transpeptidase catalytic domain

266

391

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tx4-assembly1.cif.gz_A crystal structure of mutant (c354a) m. tuberculosis ld-transpeptidase type 2 0.9516 133 388
3tur-assembly2.cif.gz_B crystal structure of m. tuberculosis ld-transpeptidase type 2 complexed with a peptidoglycan fragment 0.9516 133 388
7a1c-assembly2.cif.gz_B ldtmt2 with covalent adduct derived from n-thio-beta-lactam 1a 0.9499 137 388
7a1c-assembly1.cif.gz_A ldtmt2 with covalent adduct derived from n-thio-beta-lactam 1a 0.9487 137 388
5lb1-assembly2.cif.gz_B crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with thionitrobenzoate (tnb) adduct at the active site cysteine-354 0.9422 133 388
ID Description Score Start End Superfamily
4hu2A02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9851 138 236 2.60.40.3710
5dujB02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9731 136 235 2.60.40.3710
6d5aA02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9729 137 235 2.60.40.3710
4hu2A02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9659 138 236 2.60.40.3710
af_O07436_141_220_2.60.40.3710 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9361 144 237 2.60.40.3710
ID Description Score Start End GO Terms
AF-A0A0L8M333-F1-model_v4 deleted 0.9727 140 270
AF-A0A6P0EXT7-F1-model_v4 L,D-transpeptidase 0.97 153 392 GO:0005576
GO:0008360
GO:0016746
GO:0018104
GO:0071555
GO:0071972
AF-A0A558C7X6-F1-model_v4 L,D-transpeptidase family protein 0.9653 138 391 GO:0005576
GO:0008360
GO:0016746
GO:0018104
GO:0071555
GO:0071972
AF-A0A6B2WAW5-F1-model_v4 L,D-transpeptidase 0.9644 141 305 GO:0005576
GO:0008360
GO:0016746
GO:0018104
GO:0071555
GO:0071972
AF-A0A520DY17-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9616 100 392 GO:0005576
GO:0008360
GO:0016746
GO:0018104
GO:0071555
GO:0071972

Map