F372972

General Info

Members Datasets Scaffolds Average Seq Length
264 187 528 484

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675902999|2676205739
Length 531
Sequence NAPSTLSSRIADTLVLDPAAPFLEFEGEWRTWGQLAMTADAVAAHVPVPGTRVGVLLRNRPAHVGLLVGLLRAGACVVTINPSRGVDRVRADLASLGLPVLAGTPDDIVAFAGEAGDGAVAAGEISETGSLAGDNDGIVTRLVLTATDLGEPVSVTGRLPDDLGVLRPGVAVEMLTSGTTGPPKRIPLGYEMLLRGLVGAKHYESNQDDTPRLRSGVAIVNAPLVHMGGLFRVLQCLHDGRALCLLERFALDTWADAVRRHRPRTISLVPAALRMVLEADLDPAIFATVRSVISGTAPLSPDDAEAFEARYGVPVLVSYAATEFGGGVAGWNLADHQQYGAAKRGSVGRAHAGCELRVVGTETFEPLPPDTEGLLEVRAHQFGDGAGWVRTTDLARLDADGFLWIVGRADQAIIRGGFKVIPDDVRAALERDPRVRGAAVVGRPDARLGAVPVAAVELRTAVDADEARAVAEALRADAARVLAAYELPVEIRVVDALPRTPSGKADLGAVRELLATPDQNQNRDQNQELEH

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
168 2508501039 Frankia saprophytica CN3 Isolate Nodule
169 2517572101 Frankia sp. DC12 Isolate Nodule
170 2547132424 Nocardia nova SH22a Isolate Unclassified
171 2671180195 Frankia sp. CcI49 Isolate Nodule
172 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
173 2687453737 Frankia sp. BMG5.36 Isolate Nodule
174 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
175 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
176 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
177 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
178 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
179 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
180 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
181 2773857922 Frankia sp. CcI49 Isolate Nodule
182 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
183 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
184 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
185 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
186 8002775197 Frankia nepalensis CN7 Isolate Nodule
187 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 0
Isolates 7.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 4.17
Rhizoplane 12.5
Rhizosphere 69.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000527 3300002077 Bacteria 6831
2 Ga0055540_1000003 3300003792 Bacteria 428375
3 Ga0068869_100027549 3300005334 Bacteria 3963
4 Ga0070666_10019835 3300005335 Bacteria 4343
5 Ga0070682_100014065 3300005337 Bacteria 4619
6 Ga0068868_100004202 3300005338 Bacteria 10070
7 Ga0070689_100011814 3300005340 Bacteria 6267
8 Ga0070691_10007751 3300005341 Bacteria 4916
9 Ga0070687_100027412 3300005343 Bacteria 2752
10 Ga0070692_10044876 3300005345 Bacteria 2279
11 Ga0070668_100001102 3300005347 Bacteria 19064
12 Ga0070668_100002764 3300005347 Bacteria 12900
13 Ga0070668_100064739 3300005347 Bacteria 2835
14 Ga0070669_100012898 3300005353 Bacteria 5936
15 Ga0070674_100001747 3300005356 Bacteria 11779
16 Ga0070674_100025360 3300005356 Bacteria 3859
17 Ga0070688_100003291 3300005365 Bacteria 8285
18 Ga0070667_100000087 3300005367 Bacteria 114528
19 Ga0070667_100008925 3300005367 Bacteria 8297
20 Ga0070709_10063017 3300005434 Bacteria 2366
21 Ga0070711_100002316 3300005439 Bacteria 10815
22 Ga0070700_100037617 3300005441 Bacteria 2945
23 Ga0070708_100004513 3300005445 Bacteria 10953
24 Ga0070708_100191476 3300005445 Bacteria 1913
25 Ga0070678_100002488 3300005456 Bacteria 10102
26 Ga0070662_100011521 3300005457 Bacteria 5835
27 Ga0068867_100001718 3300005459 Bacteria 15254
28 Ga0070706_100029175 3300005467 Bacteria 5084
29 Ga0070707_100023135 3300005468 Bacteria 5878
30 Ga0070698_100078065 3300005471 Bacteria 3310
31 Ga0070699_100001586 3300005518 Bacteria 20766
32 Ga0070697_100121708 3300005536 Bacteria 2183
33 Ga0068853_100008861 3300005539 Bacteria 8094
34 Ga0070672_100076191 3300005543 Bacteria 2679
35 Ga0070693_100010871 3300005547 Bacteria 4571
36 Ga0070704_100000113 3300005549 Bacteria 28575
37 Ga0068854_100000637 3300005578 Bacteria 20747
38 Ga0068856_100104137 3300005614 Bacteria 2831
39 Ga0070702_100000639 3300005615 Bacteria 12985
40 Ga0068859_100000291 3300005617 Bacteria 49882
41 Ga0068859_100001028 3300005617 Bacteria 28595
42 Ga0068866_10000435 3300005718 Bacteria 19346
43 Ga0068861_100002086 3300005719 Bacteria 12955
44 Ga0068863_100000179 3300005841 Bacteria 67666
45 Ga0068863_100076427 3300005841 Bacteria 3168
46 Ga0068863_100104082 3300005841 Bacteria 2700
47 Ga0068858_100000362 3300005842 Bacteria 47914
48 Ga0068858_100013045 3300005842 Bacteria 7839
49 Ga0068858_100217687 3300005842 Bacteria 1808
50 Ga0068860_100000020 3300005843 Bacteria 283324
51 Ga0068862_100000013 3300005844 Bacteria 263115
52 Ga0075365_10005331 3300006038 Bacteria 6924
53 Ga0075363_100075615 3300006048 Bacteria 1835
54 Ga0075364_10000404 3300006051 Bacteria 21507
55 Ga0075364_10003659 3300006051 Bacteria 8763
56 Ga0070715_10002704 3300006163 Bacteria 5499
57 Ga0070716_100012497 3300006173 Bacteria 4306
58 Ga0070712_100003765 3300006175 Bacteria 9344
59 Ga0070712_100007418 3300006175 Bacteria 6844
60 Ga0075428_100001458 3300006844 Bacteria 25308
61 Ga0075428_100064298 3300006844 Bacteria 4018
62 Ga0075428_100085074 3300006844 Bacteria 3449
63 Ga0075430_100037873 3300006846 Bacteria 4088
64 Ga0075430_100116951 3300006846 Bacteria 2222
65 Ga0075431_100048890 3300006847 Bacteria 4362
66 Ga0075429_100142282 3300006880 Bacteria 2100
67 Ga0068865_100058469 3300006881 Bacteria 2693
68 Ga0097620_100000291 3300006931 Bacteria 49882
69 Ga0097620_100001028 3300006931 Bacteria 28595
70 Ga0105247_10000009 3300009101 Bacteria 385991
71 Ga0105247_10008882 3300009101 Bacteria 6123
72 Ga0114129_10012445 3300009147 Bacteria 12112
73 Ga0114129_10054923 3300009147 Bacteria 5583
74 Ga0105241_10194810 3300009174 Bacteria 1689
75 Ga0105242_10000766 3300009176 Bacteria 24993
76 Ga0105248_10000207 3300009177 Bacteria 67863
77 Ga0105248_10004117 3300009177 Bacteria 16088
78 Ga0105248_10081392 3300009177 Bacteria 3640
79 Ga0105237_10011206 3300009545 Bacteria 9502
80 Ga0105237_10011273 3300009545 Bacteria 9459
81 Ga0105249_10000057 3300009553 Bacteria 159358
82 Ga0105249_10010089 3300009553 Bacteria 8291
83 Ga0099796_10017053 3300010159 Bacteria 2155
84 Ga0105239_10021300 3300010375 Bacteria 7148
85 Ga0105239_10023004 3300010375 Bacteria 6871
86 Ga0105239_10311443 3300010375 Bacteria 1774
87 Ga0157378_10000831 3300013297 Bacteria 28691
88 Ga0163162_10018675 3300013306 Bacteria 6793
89 Ga0157372_10005208 3300013307 Bacteria 13818
90 Ga0157375_10016100 3300013308 Bacteria 6708
91 Ga0163163_10025241 3300014325 Bacteria 5665
92 Ga0157379_10007816 3300014968 Bacteria 9260
93 Ga0157379_10090163 3300014968 Bacteria 2751
94 Ga0163161_10000872 3300017792 Bacteria 23503
95 Ga0213876_10001171 3300021384 Bacteria 16573
96 Ga0207642_10000415 3300025899 Bacteria 12873
97 Ga0207710_10000014 3300025900 Bacteria 408072
98 Ga0207710_10007319 3300025900 Bacteria 4676
99 Ga0207688_10001700 3300025901 Bacteria 11678
100 Ga0207699_10013205 3300025906 Bacteria 4221
101 Ga0207684_10054807 3300025910 Bacteria 3383
102 Ga0207671_10021214 3300025914 Bacteria 4933
103 Ga0207693_10000949 3300025915 Bacteria 25987
104 Ga0207693_10001079 3300025915 Bacteria 24466
105 Ga0207663_10000777 3300025916 Bacteria 14291
106 Ga0207663_10054594 3300025916 Bacteria 2502
107 Ga0207662_10032182 3300025918 Bacteria 3051
108 Ga0207681_10002380 3300025923 Bacteria 11960
109 Ga0207706_10011525 3300025933 Bacteria 8052
110 Ga0207686_10004275 3300025934 Bacteria 7657
111 Ga0207709_10007501 3300025935 Bacteria 6071
112 Ga0207670_10010825 3300025936 Bacteria 5263
113 Ga0207669_10000486 3300025937 Bacteria 17262
114 Ga0207704_10001580 3300025938 Bacteria 10221
115 Ga0207704_10070293 3300025938 Bacteria 2216
116 Ga0207665_10001980 3300025939 Bacteria 13800
117 Ga0207711_10000242 3300025941 Bacteria 58458
118 Ga0207689_10043353 3300025942 Bacteria 3719
119 Ga0207712_10000050 3300025961 Bacteria 159469
120 Ga0207668_10001030 3300025972 Bacteria 16627
121 Ga0207668_10001475 3300025972 Bacteria 13792
122 Ga0207658_10000065 3300025986 Bacteria 117079
123 Ga0207658_10013553 3300025986 Bacteria 5573
124 Ga0207703_10188855 3300026035 Bacteria 1823
125 Ga0207639_10018266 3300026041 Bacteria 4982
126 Ga0207708_10004173 3300026075 Bacteria 10619
127 Ga0207641_10000740 3300026088 Bacteria 35113
128 Ga0207648_10002377 3300026089 Bacteria 20269
129 Ga0207675_100001291 3300026118 Bacteria 25101
130 Ga0207683_10000738 3300026121 Bacteria 29767
131 Ga0268265_10000004 3300028380 Bacteria 648376
132 Ga0268265_10007324 3300028380 Bacteria 7448
133 Ga0268264_10000024 3300028381 Bacteria 470081
134 Ga0268264_10002508 3300028381 Bacteria 16141
135 Ga0265327_10003731 3300031251 Bacteria 14168
136 Ga0265327_10004031 3300031251 Bacteria 13350
137 Ga0316576_10017389 3300031727 Bacteria 4882
138 Ga0316578_10018302 3300031728 Bacteria 3835
139 Ga0316577_10049736 3300031733 Bacteria 2339
140 Ga0316574_0009546 3300035398 Bacteria 5439
141 Ga0316574_0016981 3300035398 Bacteria 4250
142 Ga0316584_0042755 3300036712 Bacteria 3377
143 Ga0436364_1038490 3300037853 Bacteria 8940
144 Ga0436364_1491030 3300037853 Bacteria 5128
145 Ga0436365_1149052 3300039437 Bacteria 11795
146 Ga0436363_1706154 3300039450 Bacteria 5596
147 Ga0466965_0011195 3300044683 Bacteria 4198
148 Ga0466966_0027462 3300044684 Bacteria 3712
149 Ga0466957_0115936 3300044842 Bacteria 1704
150 Ga0466960_0000518 3300044901 Bacteria 13215
151 Ga0466959_0087902 3300045049 Bacteria 2235
152 Ga0466967_0188523 3300045976 Bacteria 1948
153 Ga0495638_0000482 3300046460 Bacteria 47851
154 Ga0495628_0100589 3300046516 Bacteria 2232
155 Ga0495672_0041448 3300047320 Bacteria 2784
156 Ga0496100_0002861 3300048903 Bacteria 8840
157 Ga0496100_0011959 3300048903 Bacteria 4957
158 Ga0496101_0000381 3300048904 Bacteria 29356
159 Ga0496101_0166384 3300048904 Bacteria 1693
160 Ga0496102_0005520 3300048905 Bacteria 10739
161 Ga0496102_0037697 3300048905 Bacteria 4362
162 Ga0496102_0062993 3300048905 Bacteria 3395
163 Ga0496103_0000630 3300048906 Bacteria 26992
164 Ga0496103_0001260 3300048906 Bacteria 17289
165 Ga0496103_0025101 3300048906 Bacteria 3600
166 Ga0496103_0075224 3300048906 Bacteria 2118
167 Ga0496104_0000946 3300048907 Bacteria 24980
168 Ga0496104_0017574 3300048907 Bacteria 6516
169 Ga0496104_0106278 3300048907 Bacteria 2690
170 Ga0496105_0016361 3300048908 Bacteria 5921
171 Ga0496105_0069271 3300048908 Bacteria 2915
172 Ga0496106_0001931 3300048909 Bacteria 15545
173 Ga0496106_0002262 3300048909 Bacteria 14361
174 Ga0496106_0060625 3300048909 Bacteria 2868
175 Ga0496107_0007465 3300048910 Bacteria 7537
176 Ga0496107_0059207 3300048910 Bacteria 2772
177 Ga0496108_0007250 3300048911 Bacteria 8991
178 Ga0496108_0021022 3300048911 Bacteria 5365
179 Ga0496109_0043363 3300048912 Bacteria 4078
180 Ga0496110_0028100 3300048913 Bacteria 4827
181 Ga0496114_0000842 3300048917 Bacteria 22978
182 Ga0496114_0007738 3300048917 Bacteria 8502
183 Ga0496114_0012464 3300048917 Bacteria 6806
184 Ga0496114_0034661 3300048917 Bacteria 4165
185 Ga0496114_0257865 3300048917 Bacteria 1535
186 Ga0496115_0001478 3300048918 Bacteria 16885
187 Ga0496115_0001852 3300048918 Bacteria 15124
188 Ga0496115_0002158 3300048918 Bacteria 14069
189 Ga0496116_0009735 3300048919 Bacteria 8160
190 Ga0496117_0005321 3300048920 Bacteria 13588
191 Ga0496118_0000236 3300048921 Bacteria 97321
192 Ga0496118_0000514 3300048921 Bacteria 63548
193 Ga0496119_0013290 3300048922 Bacteria 6577
194 Ga0496120_0005989 3300048923 Bacteria 9471
195 Ga0496121_0003437 3300048924 Bacteria 22625
196 Ga0496125_0006870 3300048928 Bacteria 12192
197 Ga0496126_0000022 3300048929 Bacteria 464393
198 Ga0496126_0029127 3300048929 Bacteria 5248
199 Ga0496126_0051340 3300048929 Bacteria 3754
200 Ga0501032_0036387 3300049569 Bacteria 3359
201 Ga0501032_0048381 3300049569 Bacteria 2871
202 Ga0501034_0005030 3300049571 Bacteria 14530
203 Ga0501034_0009414 3300049571 Bacteria 10227
204 Ga0501034_0009551 3300049571 Bacteria 10154
205 Ga0501037_0001277 3300049573 Bacteria 18552
206 Ga0501037_0133236 3300049573 Bacteria 1781
207 Ga0501039_0011148 3300049575 Bacteria 6851
208 Ga0501043_0000206 3300049579 Bacteria 54177
209 Ga0501043_0021587 3300049579 Bacteria 5049
210 Ga0501046_0059008 3300049580 Bacteria 3007
211 Ga0501046_0077062 3300049580 Bacteria 2582
212 Ga0501047_0019184 3300049581 Bacteria 6559
213 Ga0501047_0297567 3300049581 Bacteria 1456
214 Ga0501069_0000044 3300049585 Bacteria 75705
215 Ga0501070_0000001 3300049586 Bacteria 519187
216 Ga0501070_0000386 3300049586 Bacteria 40434
217 Ga0501070_0002304 3300049586 Bacteria 16749
218 Ga0501071_0025825 3300049587 Bacteria 4117
219 Ga0501071_0030382 3300049587 Bacteria 3821
220 Ga0501072_0028129 3300049588 Bacteria 4389
221 Ga0501073_0175213 3300049589 Bacteria 1484
222 Ga0501076_0084479 3300049592 Bacteria 2550
223 Ga0501080_0003271 3300049742 Bacteria 14304
224 Ga0501080_0053514 3300049742 Bacteria 3759
225 Ga0501080_0079182 3300049742 Bacteria 3055
226 Ga0501080_0273745 3300049742 Bacteria 1536
227 Ga0501035_0000340 3300049822 Bacteria 54226
228 Ga0501044_0000380 3300049823 Bacteria 55272
229 Ga0501044_0024246 3300049823 Bacteria 6446
230 nmdc:mga00v17_1174_c1 3300050491 Bacteria 13777
231 nmdc:mga00v17_12537_c1 3300050491 Bacteria 4680
232 nmdc:mga0yw44_15967_c1 3300050492 Bacteria 4041
233 nmdc:mga05p37_121596_c1 3300050507 Bacteria 3207
234 nmdc:mga06r32_179493_c1 3300050510 Bacteria 2102
235 nmdc:mga06r32_46795_c1 3300050510 Bacteria 4128
236 nmdc:mga06r32_86395_c1 3300050510 Bacteria 3059
237 nmdc:mga08y16_213549_c1 3300050511 Bacteria 1998
238 Ga0500566_0001013 3300053094 Bacteria 16187
239 Ga0500652_000479 3300053131 Bacteria 14179
240 Ga0500616_0011541 3300053153 Bacteria 5210
241 Ga0500616_0030854 3300053153 Bacteria 2940
242 Ga0500645_000123 3300053730 Bacteria 61404
243 Ga0466962_0010873 3300061719 Bacteria 4376
244 2676205739 2675902999 Bacteria 9438463
245 2508674786 2508501039 Bacteria 9978592
246 2517759493 2517572101 Bacteria 6884336
247 2548695613 2547132424 Bacteria 8348532
248 2671839716 2671180195 Bacteria 9757215
249 2686538505 2684623035 Bacteria 8032739
250 2689964079 2687453737 Bacteria 11203906
251 2689991749 2687453743 Bacteria 8361025
252 2738667018 2738541264 Bacteria 5935393
253 2738706280 2738541274 Bacteria 6909446
254 2739145862 2738541356 Bacteria 5935017
255 2739328769 2738543028 Bacteria 6917070
256 2744955879 2744054611 Bacteria 5611514
257 2774850314 2773857921 Bacteria 9435764
258 2774857872 2773857922 Bacteria 9757215
259 2842138688 2842134933 Bacteria 5847019
260 2895890561 2895880812 Bacteria 11255272
261 2902804059 2902799365 Bacteria 5419524
262 2929214582 2929212328 Bacteria 7708288
263 8002780243 8002775197 Bacteria 10728764
264 8002791815 8002784119 Bacteria 9788632
265 JGI24744J21845_10000527
266 Ga0055540_1000003
267 Ga0068869_100027549
268 Ga0070666_10019835
269 Ga0070682_100014065
270 Ga0068868_100004202
271 Ga0070689_100011814
272 Ga0070691_10007751
273 Ga0070687_100027412
274 Ga0070692_10044876
275 Ga0070668_100001102
276 Ga0070668_100002764
277 Ga0070668_100064739
278 Ga0070669_100012898
279 Ga0070674_100001747
280 Ga0070674_100025360
281 Ga0070688_100003291
282 Ga0070667_100000087
283 Ga0070667_100008925
284 Ga0070709_10063017
285 Ga0070711_100002316
286 Ga0070700_100037617
287 Ga0070708_100004513
288 Ga0070708_100191476
289 Ga0070678_100002488
290 Ga0070662_100011521
291 Ga0068867_100001718
292 Ga0070706_100029175
293 Ga0070707_100023135
294 Ga0070698_100078065
295 Ga0070699_100001586
296 Ga0070697_100121708
297 Ga0068853_100008861
298 Ga0070672_100076191
299 Ga0070693_100010871
300 Ga0070704_100000113
301 Ga0068854_100000637
302 Ga0068856_100104137
303 Ga0070702_100000639
304 Ga0068859_100000291
305 Ga0068859_100001028
306 Ga0068866_10000435
307 Ga0068861_100002086
308 Ga0068863_100000179
309 Ga0068863_100076427
310 Ga0068863_100104082
311 Ga0068858_100000362
312 Ga0068858_100013045
313 Ga0068858_100217687
314 Ga0068860_100000020
315 Ga0068862_100000013
316 Ga0075365_10005331
317 Ga0075363_100075615
318 Ga0075364_10000404
319 Ga0075364_10003659
320 Ga0070715_10002704
321 Ga0070716_100012497
322 Ga0070712_100003765
323 Ga0070712_100007418
324 Ga0075428_100001458
325 Ga0075428_100064298
326 Ga0075428_100085074
327 Ga0075430_100037873
328 Ga0075430_100116951
329 Ga0075431_100048890
330 Ga0075429_100142282
331 Ga0068865_100058469
332 Ga0097620_100000291
333 Ga0097620_100001028
334 Ga0105247_10000009
335 Ga0105247_10008882
336 Ga0114129_10012445
337 Ga0114129_10054923
338 Ga0105241_10194810
339 Ga0105242_10000766
340 Ga0105248_10000207
341 Ga0105248_10004117
342 Ga0105248_10081392
343 Ga0105237_10011206
344 Ga0105237_10011273
345 Ga0105249_10000057
346 Ga0105249_10010089
347 Ga0099796_10017053
348 Ga0105239_10021300
349 Ga0105239_10023004
350 Ga0105239_10311443
351 Ga0157378_10000831
352 Ga0163162_10018675
353 Ga0157372_10005208
354 Ga0157375_10016100
355 Ga0163163_10025241
356 Ga0157379_10007816
357 Ga0157379_10090163
358 Ga0163161_10000872
359 Ga0213876_10001171
360 Ga0207642_10000415
361 Ga0207710_10000014
362 Ga0207710_10007319
363 Ga0207688_10001700
364 Ga0207699_10013205
365 Ga0207684_10054807
366 Ga0207671_10021214
367 Ga0207693_10000949
368 Ga0207693_10001079
369 Ga0207663_10000777
370 Ga0207663_10054594
371 Ga0207662_10032182
372 Ga0207681_10002380
373 Ga0207706_10011525
374 Ga0207686_10004275
375 Ga0207709_10007501
376 Ga0207670_10010825
377 Ga0207669_10000486
378 Ga0207704_10001580
379 Ga0207704_10070293
380 Ga0207665_10001980
381 Ga0207711_10000242
382 Ga0207689_10043353
383 Ga0207712_10000050
384 Ga0207668_10001030
385 Ga0207668_10001475
386 Ga0207658_10000065
387 Ga0207658_10013553
388 Ga0207703_10188855
389 Ga0207639_10018266
390 Ga0207708_10004173
391 Ga0207641_10000740
392 Ga0207648_10002377
393 Ga0207675_100001291
394 Ga0207683_10000738
395 Ga0268265_10000004
396 Ga0268265_10007324
397 Ga0268264_10000024
398 Ga0268264_10002508
399 Ga0265327_10003731
400 Ga0265327_10004031
401 Ga0316576_10017389
402 Ga0316578_10018302
403 Ga0316577_10049736
404 Ga0316574_0009546
405 Ga0316574_0016981
406 Ga0316584_0042755
407 Ga0436364_1038490
408 Ga0436364_1491030
409 Ga0436365_1149052
410 Ga0436363_1706154
411 Ga0466965_0011195
412 Ga0466966_0027462
413 Ga0466957_0115936
414 Ga0466960_0000518
415 Ga0466959_0087902
416 Ga0466967_0188523
417 Ga0495638_0000482
418 Ga0495628_0100589
419 Ga0495672_0041448
420 Ga0496100_0002861
421 Ga0496100_0011959
422 Ga0496101_0000381
423 Ga0496101_0166384
424 Ga0496102_0005520
425 Ga0496102_0037697
426 Ga0496102_0062993
427 Ga0496103_0000630
428 Ga0496103_0001260
429 Ga0496103_0025101
430 Ga0496103_0075224
431 Ga0496104_0000946
432 Ga0496104_0017574
433 Ga0496104_0106278
434 Ga0496105_0016361
435 Ga0496105_0069271
436 Ga0496106_0001931
437 Ga0496106_0002262
438 Ga0496106_0060625
439 Ga0496107_0007465
440 Ga0496107_0059207
441 Ga0496108_0007250
442 Ga0496108_0021022
443 Ga0496109_0043363
444 Ga0496110_0028100
445 Ga0496114_0000842
446 Ga0496114_0007738
447 Ga0496114_0012464
448 Ga0496114_0034661
449 Ga0496114_0257865
450 Ga0496115_0001478
451 Ga0496115_0001852
452 Ga0496115_0002158
453 Ga0496116_0009735
454 Ga0496117_0005321
455 Ga0496118_0000236
456 Ga0496118_0000514
457 Ga0496119_0013290
458 Ga0496120_0005989
459 Ga0496121_0003437
460 Ga0496125_0006870
461 Ga0496126_0000022
462 Ga0496126_0029127
463 Ga0496126_0051340
464 Ga0501032_0036387
465 Ga0501032_0048381
466 Ga0501034_0005030
467 Ga0501034_0009414
468 Ga0501034_0009551
469 Ga0501037_0001277
470 Ga0501037_0133236
471 Ga0501039_0011148
472 Ga0501043_0000206
473 Ga0501043_0021587
474 Ga0501046_0059008
475 Ga0501046_0077062
476 Ga0501047_0019184
477 Ga0501047_0297567
478 Ga0501069_0000044
479 Ga0501070_0000001
480 Ga0501070_0000386
481 Ga0501070_0002304
482 Ga0501071_0025825
483 Ga0501071_0030382
484 Ga0501072_0028129
485 Ga0501073_0175213
486 Ga0501076_0084479
487 Ga0501080_0003271
488 Ga0501080_0053514
489 Ga0501080_0079182
490 Ga0501080_0273745
491 Ga0501035_0000340
492 Ga0501044_0000380
493 Ga0501044_0024246
494 nmdc:mga00v17_1174_c1
495 nmdc:mga00v17_12537_c1
496 nmdc:mga0yw44_15967_c1
497 nmdc:mga05p37_121596_c1
498 nmdc:mga06r32_179493_c1
499 nmdc:mga06r32_46795_c1
500 nmdc:mga06r32_86395_c1
501 nmdc:mga08y16_213549_c1
502 Ga0500566_0001013
503 Ga0500652_000479
504 Ga0500616_0011541
505 Ga0500616_0030854
506 Ga0500645_000123
507 Ga0466962_0010873
508 2676205739
509 2508674786
510 2517759493
511 2548695613
512 2671839716
513 2686538505
514 2689964079
515 2689991749
516 2738667018
517 2738706280
518 2739145862
519 2739328769
520 2744955879
521 2774850314
522 2774857872
523 2842138688
524 2895890561
525 2902804059
526 2929214582
527 8002780243
528 8002791815

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

424

504

0.91

PF00501

AMP-binding

AMP-binding enzyme

12

385

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u5y-assembly1.cif.gz_D crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.896 390 477
5ja1-assembly1.cif.gz_A entf, a terminal nonribosomal peptide synthetase module bound to the mbth-like protein ybdz 0.8316 1 472
6h1b-assembly5.cif.gz_E structure of amide bond synthetase mcba k483a mutant from marinactinospora thermotolerans 0.8249 6 478
5x8f-assembly1.cif.gz_A ternary complex structure of a double mutant i454ra456k of o-succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with amp and its product analogue osb-ncoa at 1.76 angstrom 0.8203 9 474
5x8g-assembly2.cif.gz_D binary complex structure of a double mutant i454ra456k of o-succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with its product analogue osb-ncoa at 1.90 angstrom 0.8202 9 474
ID Description Score Start End Superfamily
af_P38137_433_538_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9608 380 477 3.30.300.30
5buqA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9597 380 458 3.30.300.30
af_P69451_456_557_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9554 381 475 3.30.300.30
af_P31552_422_517_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9534 381 473 3.30.300.30
af_K7VHQ0_441_545_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9501 381 480 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A2V5U7P8-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9078 375 477 GO:0016877
AF-A0A7W1E3G2-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9026 375 477 GO:0006631
GO:0031956
AF-A0A0D7KEW7-F1-model_v4 Carrier domain-containing protein 0.88 375 471 GO:0005829
GO:0017000
GO:0031177
GO:0043041
GO:0044550
AF-Q595S6-F1-model_v4 Non-ribosomal peptide synthetase 0.8654 316 471 GO:0005737
GO:0017000
GO:0031177
GO:0043041
GO:0044550
AF-A0A290ZI90-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.8609 366 477 GO:0016877

Map