F372972
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 264 | 187 | 528 | 484 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2675902999|2676205739 |
| Length | 531 |
| Sequence | NAPSTLSSRIADTLVLDPAAPFLEFEGEWRTWGQLAMTADAVAAHVPVPGTRVGVLLRNRPAHVGLLVGLLRAGACVVTINPSRGVDRVRADLASLGLPVLAGTPDDIVAFAGEAGDGAVAAGEISETGSLAGDNDGIVTRLVLTATDLGEPVSVTGRLPDDLGVLRPGVAVEMLTSGTTGPPKRIPLGYEMLLRGLVGAKHYESNQDDTPRLRSGVAIVNAPLVHMGGLFRVLQCLHDGRALCLLERFALDTWADAVRRHRPRTISLVPAALRMVLEADLDPAIFATVRSVISGTAPLSPDDAEAFEARYGVPVLVSYAATEFGGGVAGWNLADHQQYGAAKRGSVGRAHAGCELRVVGTETFEPLPPDTEGLLEVRAHQFGDGAGWVRTTDLARLDADGFLWIVGRADQAIIRGGFKVIPDDVRAALERDPRVRGAAVVGRPDARLGAVPVAAVELRTAVDADEARAVAEALRADAARVLAAYELPVEIRVVDALPRTPSGKADLGAVRELLATPDQNQNRDQNQELEH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 104 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 105 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 111 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 112 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 123 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 124 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 125 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 126 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 127 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 128 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 131 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 134 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 135 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 136 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 137 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 140 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 141 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 158 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 163 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 164 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 165 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 166 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 167 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 168 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 169 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 170 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 171 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 172 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 173 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 174 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 175 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 176 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 177 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 178 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 179 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 180 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 181 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 182 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 183 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 184 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 185 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 186 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 187 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.05 |
| Metatranscriptomes | 0 |
| Isolates | 7.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 4.17 |
| Rhizoplane | 12.5 |
| Rhizosphere | 69.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10000527 | 3300002077 | Bacteria | 6831 |
| 2 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 3 | Ga0068869_100027549 | 3300005334 | Bacteria | 3963 |
| 4 | Ga0070666_10019835 | 3300005335 | Bacteria | 4343 |
| 5 | Ga0070682_100014065 | 3300005337 | Bacteria | 4619 |
| 6 | Ga0068868_100004202 | 3300005338 | Bacteria | 10070 |
| 7 | Ga0070689_100011814 | 3300005340 | Bacteria | 6267 |
| 8 | Ga0070691_10007751 | 3300005341 | Bacteria | 4916 |
| 9 | Ga0070687_100027412 | 3300005343 | Bacteria | 2752 |
| 10 | Ga0070692_10044876 | 3300005345 | Bacteria | 2279 |
| 11 | Ga0070668_100001102 | 3300005347 | Bacteria | 19064 |
| 12 | Ga0070668_100002764 | 3300005347 | Bacteria | 12900 |
| 13 | Ga0070668_100064739 | 3300005347 | Bacteria | 2835 |
| 14 | Ga0070669_100012898 | 3300005353 | Bacteria | 5936 |
| 15 | Ga0070674_100001747 | 3300005356 | Bacteria | 11779 |
| 16 | Ga0070674_100025360 | 3300005356 | Bacteria | 3859 |
| 17 | Ga0070688_100003291 | 3300005365 | Bacteria | 8285 |
| 18 | Ga0070667_100000087 | 3300005367 | Bacteria | 114528 |
| 19 | Ga0070667_100008925 | 3300005367 | Bacteria | 8297 |
| 20 | Ga0070709_10063017 | 3300005434 | Bacteria | 2366 |
| 21 | Ga0070711_100002316 | 3300005439 | Bacteria | 10815 |
| 22 | Ga0070700_100037617 | 3300005441 | Bacteria | 2945 |
| 23 | Ga0070708_100004513 | 3300005445 | Bacteria | 10953 |
| 24 | Ga0070708_100191476 | 3300005445 | Bacteria | 1913 |
| 25 | Ga0070678_100002488 | 3300005456 | Bacteria | 10102 |
| 26 | Ga0070662_100011521 | 3300005457 | Bacteria | 5835 |
| 27 | Ga0068867_100001718 | 3300005459 | Bacteria | 15254 |
| 28 | Ga0070706_100029175 | 3300005467 | Bacteria | 5084 |
| 29 | Ga0070707_100023135 | 3300005468 | Bacteria | 5878 |
| 30 | Ga0070698_100078065 | 3300005471 | Bacteria | 3310 |
| 31 | Ga0070699_100001586 | 3300005518 | Bacteria | 20766 |
| 32 | Ga0070697_100121708 | 3300005536 | Bacteria | 2183 |
| 33 | Ga0068853_100008861 | 3300005539 | Bacteria | 8094 |
| 34 | Ga0070672_100076191 | 3300005543 | Bacteria | 2679 |
| 35 | Ga0070693_100010871 | 3300005547 | Bacteria | 4571 |
| 36 | Ga0070704_100000113 | 3300005549 | Bacteria | 28575 |
| 37 | Ga0068854_100000637 | 3300005578 | Bacteria | 20747 |
| 38 | Ga0068856_100104137 | 3300005614 | Bacteria | 2831 |
| 39 | Ga0070702_100000639 | 3300005615 | Bacteria | 12985 |
| 40 | Ga0068859_100000291 | 3300005617 | Bacteria | 49882 |
| 41 | Ga0068859_100001028 | 3300005617 | Bacteria | 28595 |
| 42 | Ga0068866_10000435 | 3300005718 | Bacteria | 19346 |
| 43 | Ga0068861_100002086 | 3300005719 | Bacteria | 12955 |
| 44 | Ga0068863_100000179 | 3300005841 | Bacteria | 67666 |
| 45 | Ga0068863_100076427 | 3300005841 | Bacteria | 3168 |
| 46 | Ga0068863_100104082 | 3300005841 | Bacteria | 2700 |
| 47 | Ga0068858_100000362 | 3300005842 | Bacteria | 47914 |
| 48 | Ga0068858_100013045 | 3300005842 | Bacteria | 7839 |
| 49 | Ga0068858_100217687 | 3300005842 | Bacteria | 1808 |
| 50 | Ga0068860_100000020 | 3300005843 | Bacteria | 283324 |
| 51 | Ga0068862_100000013 | 3300005844 | Bacteria | 263115 |
| 52 | Ga0075365_10005331 | 3300006038 | Bacteria | 6924 |
| 53 | Ga0075363_100075615 | 3300006048 | Bacteria | 1835 |
| 54 | Ga0075364_10000404 | 3300006051 | Bacteria | 21507 |
| 55 | Ga0075364_10003659 | 3300006051 | Bacteria | 8763 |
| 56 | Ga0070715_10002704 | 3300006163 | Bacteria | 5499 |
| 57 | Ga0070716_100012497 | 3300006173 | Bacteria | 4306 |
| 58 | Ga0070712_100003765 | 3300006175 | Bacteria | 9344 |
| 59 | Ga0070712_100007418 | 3300006175 | Bacteria | 6844 |
| 60 | Ga0075428_100001458 | 3300006844 | Bacteria | 25308 |
| 61 | Ga0075428_100064298 | 3300006844 | Bacteria | 4018 |
| 62 | Ga0075428_100085074 | 3300006844 | Bacteria | 3449 |
| 63 | Ga0075430_100037873 | 3300006846 | Bacteria | 4088 |
| 64 | Ga0075430_100116951 | 3300006846 | Bacteria | 2222 |
| 65 | Ga0075431_100048890 | 3300006847 | Bacteria | 4362 |
| 66 | Ga0075429_100142282 | 3300006880 | Bacteria | 2100 |
| 67 | Ga0068865_100058469 | 3300006881 | Bacteria | 2693 |
| 68 | Ga0097620_100000291 | 3300006931 | Bacteria | 49882 |
| 69 | Ga0097620_100001028 | 3300006931 | Bacteria | 28595 |
| 70 | Ga0105247_10000009 | 3300009101 | Bacteria | 385991 |
| 71 | Ga0105247_10008882 | 3300009101 | Bacteria | 6123 |
| 72 | Ga0114129_10012445 | 3300009147 | Bacteria | 12112 |
| 73 | Ga0114129_10054923 | 3300009147 | Bacteria | 5583 |
| 74 | Ga0105241_10194810 | 3300009174 | Bacteria | 1689 |
| 75 | Ga0105242_10000766 | 3300009176 | Bacteria | 24993 |
| 76 | Ga0105248_10000207 | 3300009177 | Bacteria | 67863 |
| 77 | Ga0105248_10004117 | 3300009177 | Bacteria | 16088 |
| 78 | Ga0105248_10081392 | 3300009177 | Bacteria | 3640 |
| 79 | Ga0105237_10011206 | 3300009545 | Bacteria | 9502 |
| 80 | Ga0105237_10011273 | 3300009545 | Bacteria | 9459 |
| 81 | Ga0105249_10000057 | 3300009553 | Bacteria | 159358 |
| 82 | Ga0105249_10010089 | 3300009553 | Bacteria | 8291 |
| 83 | Ga0099796_10017053 | 3300010159 | Bacteria | 2155 |
| 84 | Ga0105239_10021300 | 3300010375 | Bacteria | 7148 |
| 85 | Ga0105239_10023004 | 3300010375 | Bacteria | 6871 |
| 86 | Ga0105239_10311443 | 3300010375 | Bacteria | 1774 |
| 87 | Ga0157378_10000831 | 3300013297 | Bacteria | 28691 |
| 88 | Ga0163162_10018675 | 3300013306 | Bacteria | 6793 |
| 89 | Ga0157372_10005208 | 3300013307 | Bacteria | 13818 |
| 90 | Ga0157375_10016100 | 3300013308 | Bacteria | 6708 |
| 91 | Ga0163163_10025241 | 3300014325 | Bacteria | 5665 |
| 92 | Ga0157379_10007816 | 3300014968 | Bacteria | 9260 |
| 93 | Ga0157379_10090163 | 3300014968 | Bacteria | 2751 |
| 94 | Ga0163161_10000872 | 3300017792 | Bacteria | 23503 |
| 95 | Ga0213876_10001171 | 3300021384 | Bacteria | 16573 |
| 96 | Ga0207642_10000415 | 3300025899 | Bacteria | 12873 |
| 97 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 98 | Ga0207710_10007319 | 3300025900 | Bacteria | 4676 |
| 99 | Ga0207688_10001700 | 3300025901 | Bacteria | 11678 |
| 100 | Ga0207699_10013205 | 3300025906 | Bacteria | 4221 |
| 101 | Ga0207684_10054807 | 3300025910 | Bacteria | 3383 |
| 102 | Ga0207671_10021214 | 3300025914 | Bacteria | 4933 |
| 103 | Ga0207693_10000949 | 3300025915 | Bacteria | 25987 |
| 104 | Ga0207693_10001079 | 3300025915 | Bacteria | 24466 |
| 105 | Ga0207663_10000777 | 3300025916 | Bacteria | 14291 |
| 106 | Ga0207663_10054594 | 3300025916 | Bacteria | 2502 |
| 107 | Ga0207662_10032182 | 3300025918 | Bacteria | 3051 |
| 108 | Ga0207681_10002380 | 3300025923 | Bacteria | 11960 |
| 109 | Ga0207706_10011525 | 3300025933 | Bacteria | 8052 |
| 110 | Ga0207686_10004275 | 3300025934 | Bacteria | 7657 |
| 111 | Ga0207709_10007501 | 3300025935 | Bacteria | 6071 |
| 112 | Ga0207670_10010825 | 3300025936 | Bacteria | 5263 |
| 113 | Ga0207669_10000486 | 3300025937 | Bacteria | 17262 |
| 114 | Ga0207704_10001580 | 3300025938 | Bacteria | 10221 |
| 115 | Ga0207704_10070293 | 3300025938 | Bacteria | 2216 |
| 116 | Ga0207665_10001980 | 3300025939 | Bacteria | 13800 |
| 117 | Ga0207711_10000242 | 3300025941 | Bacteria | 58458 |
| 118 | Ga0207689_10043353 | 3300025942 | Bacteria | 3719 |
| 119 | Ga0207712_10000050 | 3300025961 | Bacteria | 159469 |
| 120 | Ga0207668_10001030 | 3300025972 | Bacteria | 16627 |
| 121 | Ga0207668_10001475 | 3300025972 | Bacteria | 13792 |
| 122 | Ga0207658_10000065 | 3300025986 | Bacteria | 117079 |
| 123 | Ga0207658_10013553 | 3300025986 | Bacteria | 5573 |
| 124 | Ga0207703_10188855 | 3300026035 | Bacteria | 1823 |
| 125 | Ga0207639_10018266 | 3300026041 | Bacteria | 4982 |
| 126 | Ga0207708_10004173 | 3300026075 | Bacteria | 10619 |
| 127 | Ga0207641_10000740 | 3300026088 | Bacteria | 35113 |
| 128 | Ga0207648_10002377 | 3300026089 | Bacteria | 20269 |
| 129 | Ga0207675_100001291 | 3300026118 | Bacteria | 25101 |
| 130 | Ga0207683_10000738 | 3300026121 | Bacteria | 29767 |
| 131 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 132 | Ga0268265_10007324 | 3300028380 | Bacteria | 7448 |
| 133 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 134 | Ga0268264_10002508 | 3300028381 | Bacteria | 16141 |
| 135 | Ga0265327_10003731 | 3300031251 | Bacteria | 14168 |
| 136 | Ga0265327_10004031 | 3300031251 | Bacteria | 13350 |
| 137 | Ga0316576_10017389 | 3300031727 | Bacteria | 4882 |
| 138 | Ga0316578_10018302 | 3300031728 | Bacteria | 3835 |
| 139 | Ga0316577_10049736 | 3300031733 | Bacteria | 2339 |
| 140 | Ga0316574_0009546 | 3300035398 | Bacteria | 5439 |
| 141 | Ga0316574_0016981 | 3300035398 | Bacteria | 4250 |
| 142 | Ga0316584_0042755 | 3300036712 | Bacteria | 3377 |
| 143 | Ga0436364_1038490 | 3300037853 | Bacteria | 8940 |
| 144 | Ga0436364_1491030 | 3300037853 | Bacteria | 5128 |
| 145 | Ga0436365_1149052 | 3300039437 | Bacteria | 11795 |
| 146 | Ga0436363_1706154 | 3300039450 | Bacteria | 5596 |
| 147 | Ga0466965_0011195 | 3300044683 | Bacteria | 4198 |
| 148 | Ga0466966_0027462 | 3300044684 | Bacteria | 3712 |
| 149 | Ga0466957_0115936 | 3300044842 | Bacteria | 1704 |
| 150 | Ga0466960_0000518 | 3300044901 | Bacteria | 13215 |
| 151 | Ga0466959_0087902 | 3300045049 | Bacteria | 2235 |
| 152 | Ga0466967_0188523 | 3300045976 | Bacteria | 1948 |
| 153 | Ga0495638_0000482 | 3300046460 | Bacteria | 47851 |
| 154 | Ga0495628_0100589 | 3300046516 | Bacteria | 2232 |
| 155 | Ga0495672_0041448 | 3300047320 | Bacteria | 2784 |
| 156 | Ga0496100_0002861 | 3300048903 | Bacteria | 8840 |
| 157 | Ga0496100_0011959 | 3300048903 | Bacteria | 4957 |
| 158 | Ga0496101_0000381 | 3300048904 | Bacteria | 29356 |
| 159 | Ga0496101_0166384 | 3300048904 | Bacteria | 1693 |
| 160 | Ga0496102_0005520 | 3300048905 | Bacteria | 10739 |
| 161 | Ga0496102_0037697 | 3300048905 | Bacteria | 4362 |
| 162 | Ga0496102_0062993 | 3300048905 | Bacteria | 3395 |
| 163 | Ga0496103_0000630 | 3300048906 | Bacteria | 26992 |
| 164 | Ga0496103_0001260 | 3300048906 | Bacteria | 17289 |
| 165 | Ga0496103_0025101 | 3300048906 | Bacteria | 3600 |
| 166 | Ga0496103_0075224 | 3300048906 | Bacteria | 2118 |
| 167 | Ga0496104_0000946 | 3300048907 | Bacteria | 24980 |
| 168 | Ga0496104_0017574 | 3300048907 | Bacteria | 6516 |
| 169 | Ga0496104_0106278 | 3300048907 | Bacteria | 2690 |
| 170 | Ga0496105_0016361 | 3300048908 | Bacteria | 5921 |
| 171 | Ga0496105_0069271 | 3300048908 | Bacteria | 2915 |
| 172 | Ga0496106_0001931 | 3300048909 | Bacteria | 15545 |
| 173 | Ga0496106_0002262 | 3300048909 | Bacteria | 14361 |
| 174 | Ga0496106_0060625 | 3300048909 | Bacteria | 2868 |
| 175 | Ga0496107_0007465 | 3300048910 | Bacteria | 7537 |
| 176 | Ga0496107_0059207 | 3300048910 | Bacteria | 2772 |
| 177 | Ga0496108_0007250 | 3300048911 | Bacteria | 8991 |
| 178 | Ga0496108_0021022 | 3300048911 | Bacteria | 5365 |
| 179 | Ga0496109_0043363 | 3300048912 | Bacteria | 4078 |
| 180 | Ga0496110_0028100 | 3300048913 | Bacteria | 4827 |
| 181 | Ga0496114_0000842 | 3300048917 | Bacteria | 22978 |
| 182 | Ga0496114_0007738 | 3300048917 | Bacteria | 8502 |
| 183 | Ga0496114_0012464 | 3300048917 | Bacteria | 6806 |
| 184 | Ga0496114_0034661 | 3300048917 | Bacteria | 4165 |
| 185 | Ga0496114_0257865 | 3300048917 | Bacteria | 1535 |
| 186 | Ga0496115_0001478 | 3300048918 | Bacteria | 16885 |
| 187 | Ga0496115_0001852 | 3300048918 | Bacteria | 15124 |
| 188 | Ga0496115_0002158 | 3300048918 | Bacteria | 14069 |
| 189 | Ga0496116_0009735 | 3300048919 | Bacteria | 8160 |
| 190 | Ga0496117_0005321 | 3300048920 | Bacteria | 13588 |
| 191 | Ga0496118_0000236 | 3300048921 | Bacteria | 97321 |
| 192 | Ga0496118_0000514 | 3300048921 | Bacteria | 63548 |
| 193 | Ga0496119_0013290 | 3300048922 | Bacteria | 6577 |
| 194 | Ga0496120_0005989 | 3300048923 | Bacteria | 9471 |
| 195 | Ga0496121_0003437 | 3300048924 | Bacteria | 22625 |
| 196 | Ga0496125_0006870 | 3300048928 | Bacteria | 12192 |
| 197 | Ga0496126_0000022 | 3300048929 | Bacteria | 464393 |
| 198 | Ga0496126_0029127 | 3300048929 | Bacteria | 5248 |
| 199 | Ga0496126_0051340 | 3300048929 | Bacteria | 3754 |
| 200 | Ga0501032_0036387 | 3300049569 | Bacteria | 3359 |
| 201 | Ga0501032_0048381 | 3300049569 | Bacteria | 2871 |
| 202 | Ga0501034_0005030 | 3300049571 | Bacteria | 14530 |
| 203 | Ga0501034_0009414 | 3300049571 | Bacteria | 10227 |
| 204 | Ga0501034_0009551 | 3300049571 | Bacteria | 10154 |
| 205 | Ga0501037_0001277 | 3300049573 | Bacteria | 18552 |
| 206 | Ga0501037_0133236 | 3300049573 | Bacteria | 1781 |
| 207 | Ga0501039_0011148 | 3300049575 | Bacteria | 6851 |
| 208 | Ga0501043_0000206 | 3300049579 | Bacteria | 54177 |
| 209 | Ga0501043_0021587 | 3300049579 | Bacteria | 5049 |
| 210 | Ga0501046_0059008 | 3300049580 | Bacteria | 3007 |
| 211 | Ga0501046_0077062 | 3300049580 | Bacteria | 2582 |
| 212 | Ga0501047_0019184 | 3300049581 | Bacteria | 6559 |
| 213 | Ga0501047_0297567 | 3300049581 | Bacteria | 1456 |
| 214 | Ga0501069_0000044 | 3300049585 | Bacteria | 75705 |
| 215 | Ga0501070_0000001 | 3300049586 | Bacteria | 519187 |
| 216 | Ga0501070_0000386 | 3300049586 | Bacteria | 40434 |
| 217 | Ga0501070_0002304 | 3300049586 | Bacteria | 16749 |
| 218 | Ga0501071_0025825 | 3300049587 | Bacteria | 4117 |
| 219 | Ga0501071_0030382 | 3300049587 | Bacteria | 3821 |
| 220 | Ga0501072_0028129 | 3300049588 | Bacteria | 4389 |
| 221 | Ga0501073_0175213 | 3300049589 | Bacteria | 1484 |
| 222 | Ga0501076_0084479 | 3300049592 | Bacteria | 2550 |
| 223 | Ga0501080_0003271 | 3300049742 | Bacteria | 14304 |
| 224 | Ga0501080_0053514 | 3300049742 | Bacteria | 3759 |
| 225 | Ga0501080_0079182 | 3300049742 | Bacteria | 3055 |
| 226 | Ga0501080_0273745 | 3300049742 | Bacteria | 1536 |
| 227 | Ga0501035_0000340 | 3300049822 | Bacteria | 54226 |
| 228 | Ga0501044_0000380 | 3300049823 | Bacteria | 55272 |
| 229 | Ga0501044_0024246 | 3300049823 | Bacteria | 6446 |
| 230 | nmdc:mga00v17_1174_c1 | 3300050491 | Bacteria | 13777 |
| 231 | nmdc:mga00v17_12537_c1 | 3300050491 | Bacteria | 4680 |
| 232 | nmdc:mga0yw44_15967_c1 | 3300050492 | Bacteria | 4041 |
| 233 | nmdc:mga05p37_121596_c1 | 3300050507 | Bacteria | 3207 |
| 234 | nmdc:mga06r32_179493_c1 | 3300050510 | Bacteria | 2102 |
| 235 | nmdc:mga06r32_46795_c1 | 3300050510 | Bacteria | 4128 |
| 236 | nmdc:mga06r32_86395_c1 | 3300050510 | Bacteria | 3059 |
| 237 | nmdc:mga08y16_213549_c1 | 3300050511 | Bacteria | 1998 |
| 238 | Ga0500566_0001013 | 3300053094 | Bacteria | 16187 |
| 239 | Ga0500652_000479 | 3300053131 | Bacteria | 14179 |
| 240 | Ga0500616_0011541 | 3300053153 | Bacteria | 5210 |
| 241 | Ga0500616_0030854 | 3300053153 | Bacteria | 2940 |
| 242 | Ga0500645_000123 | 3300053730 | Bacteria | 61404 |
| 243 | Ga0466962_0010873 | 3300061719 | Bacteria | 4376 |
| 244 | 2676205739 | 2675902999 | Bacteria | 9438463 |
| 245 | 2508674786 | 2508501039 | Bacteria | 9978592 |
| 246 | 2517759493 | 2517572101 | Bacteria | 6884336 |
| 247 | 2548695613 | 2547132424 | Bacteria | 8348532 |
| 248 | 2671839716 | 2671180195 | Bacteria | 9757215 |
| 249 | 2686538505 | 2684623035 | Bacteria | 8032739 |
| 250 | 2689964079 | 2687453737 | Bacteria | 11203906 |
| 251 | 2689991749 | 2687453743 | Bacteria | 8361025 |
| 252 | 2738667018 | 2738541264 | Bacteria | 5935393 |
| 253 | 2738706280 | 2738541274 | Bacteria | 6909446 |
| 254 | 2739145862 | 2738541356 | Bacteria | 5935017 |
| 255 | 2739328769 | 2738543028 | Bacteria | 6917070 |
| 256 | 2744955879 | 2744054611 | Bacteria | 5611514 |
| 257 | 2774850314 | 2773857921 | Bacteria | 9435764 |
| 258 | 2774857872 | 2773857922 | Bacteria | 9757215 |
| 259 | 2842138688 | 2842134933 | Bacteria | 5847019 |
| 260 | 2895890561 | 2895880812 | Bacteria | 11255272 |
| 261 | 2902804059 | 2902799365 | Bacteria | 5419524 |
| 262 | 2929214582 | 2929212328 | Bacteria | 7708288 |
| 263 | 8002780243 | 8002775197 | Bacteria | 10728764 |
| 264 | 8002791815 | 8002784119 | Bacteria | 9788632 |
| 265 | JGI24744J21845_10000527 | |||
| 266 | Ga0055540_1000003 | |||
| 267 | Ga0068869_100027549 | |||
| 268 | Ga0070666_10019835 | |||
| 269 | Ga0070682_100014065 | |||
| 270 | Ga0068868_100004202 | |||
| 271 | Ga0070689_100011814 | |||
| 272 | Ga0070691_10007751 | |||
| 273 | Ga0070687_100027412 | |||
| 274 | Ga0070692_10044876 | |||
| 275 | Ga0070668_100001102 | |||
| 276 | Ga0070668_100002764 | |||
| 277 | Ga0070668_100064739 | |||
| 278 | Ga0070669_100012898 | |||
| 279 | Ga0070674_100001747 | |||
| 280 | Ga0070674_100025360 | |||
| 281 | Ga0070688_100003291 | |||
| 282 | Ga0070667_100000087 | |||
| 283 | Ga0070667_100008925 | |||
| 284 | Ga0070709_10063017 | |||
| 285 | Ga0070711_100002316 | |||
| 286 | Ga0070700_100037617 | |||
| 287 | Ga0070708_100004513 | |||
| 288 | Ga0070708_100191476 | |||
| 289 | Ga0070678_100002488 | |||
| 290 | Ga0070662_100011521 | |||
| 291 | Ga0068867_100001718 | |||
| 292 | Ga0070706_100029175 | |||
| 293 | Ga0070707_100023135 | |||
| 294 | Ga0070698_100078065 | |||
| 295 | Ga0070699_100001586 | |||
| 296 | Ga0070697_100121708 | |||
| 297 | Ga0068853_100008861 | |||
| 298 | Ga0070672_100076191 | |||
| 299 | Ga0070693_100010871 | |||
| 300 | Ga0070704_100000113 | |||
| 301 | Ga0068854_100000637 | |||
| 302 | Ga0068856_100104137 | |||
| 303 | Ga0070702_100000639 | |||
| 304 | Ga0068859_100000291 | |||
| 305 | Ga0068859_100001028 | |||
| 306 | Ga0068866_10000435 | |||
| 307 | Ga0068861_100002086 | |||
| 308 | Ga0068863_100000179 | |||
| 309 | Ga0068863_100076427 | |||
| 310 | Ga0068863_100104082 | |||
| 311 | Ga0068858_100000362 | |||
| 312 | Ga0068858_100013045 | |||
| 313 | Ga0068858_100217687 | |||
| 314 | Ga0068860_100000020 | |||
| 315 | Ga0068862_100000013 | |||
| 316 | Ga0075365_10005331 | |||
| 317 | Ga0075363_100075615 | |||
| 318 | Ga0075364_10000404 | |||
| 319 | Ga0075364_10003659 | |||
| 320 | Ga0070715_10002704 | |||
| 321 | Ga0070716_100012497 | |||
| 322 | Ga0070712_100003765 | |||
| 323 | Ga0070712_100007418 | |||
| 324 | Ga0075428_100001458 | |||
| 325 | Ga0075428_100064298 | |||
| 326 | Ga0075428_100085074 | |||
| 327 | Ga0075430_100037873 | |||
| 328 | Ga0075430_100116951 | |||
| 329 | Ga0075431_100048890 | |||
| 330 | Ga0075429_100142282 | |||
| 331 | Ga0068865_100058469 | |||
| 332 | Ga0097620_100000291 | |||
| 333 | Ga0097620_100001028 | |||
| 334 | Ga0105247_10000009 | |||
| 335 | Ga0105247_10008882 | |||
| 336 | Ga0114129_10012445 | |||
| 337 | Ga0114129_10054923 | |||
| 338 | Ga0105241_10194810 | |||
| 339 | Ga0105242_10000766 | |||
| 340 | Ga0105248_10000207 | |||
| 341 | Ga0105248_10004117 | |||
| 342 | Ga0105248_10081392 | |||
| 343 | Ga0105237_10011206 | |||
| 344 | Ga0105237_10011273 | |||
| 345 | Ga0105249_10000057 | |||
| 346 | Ga0105249_10010089 | |||
| 347 | Ga0099796_10017053 | |||
| 348 | Ga0105239_10021300 | |||
| 349 | Ga0105239_10023004 | |||
| 350 | Ga0105239_10311443 | |||
| 351 | Ga0157378_10000831 | |||
| 352 | Ga0163162_10018675 | |||
| 353 | Ga0157372_10005208 | |||
| 354 | Ga0157375_10016100 | |||
| 355 | Ga0163163_10025241 | |||
| 356 | Ga0157379_10007816 | |||
| 357 | Ga0157379_10090163 | |||
| 358 | Ga0163161_10000872 | |||
| 359 | Ga0213876_10001171 | |||
| 360 | Ga0207642_10000415 | |||
| 361 | Ga0207710_10000014 | |||
| 362 | Ga0207710_10007319 | |||
| 363 | Ga0207688_10001700 | |||
| 364 | Ga0207699_10013205 | |||
| 365 | Ga0207684_10054807 | |||
| 366 | Ga0207671_10021214 | |||
| 367 | Ga0207693_10000949 | |||
| 368 | Ga0207693_10001079 | |||
| 369 | Ga0207663_10000777 | |||
| 370 | Ga0207663_10054594 | |||
| 371 | Ga0207662_10032182 | |||
| 372 | Ga0207681_10002380 | |||
| 373 | Ga0207706_10011525 | |||
| 374 | Ga0207686_10004275 | |||
| 375 | Ga0207709_10007501 | |||
| 376 | Ga0207670_10010825 | |||
| 377 | Ga0207669_10000486 | |||
| 378 | Ga0207704_10001580 | |||
| 379 | Ga0207704_10070293 | |||
| 380 | Ga0207665_10001980 | |||
| 381 | Ga0207711_10000242 | |||
| 382 | Ga0207689_10043353 | |||
| 383 | Ga0207712_10000050 | |||
| 384 | Ga0207668_10001030 | |||
| 385 | Ga0207668_10001475 | |||
| 386 | Ga0207658_10000065 | |||
| 387 | Ga0207658_10013553 | |||
| 388 | Ga0207703_10188855 | |||
| 389 | Ga0207639_10018266 | |||
| 390 | Ga0207708_10004173 | |||
| 391 | Ga0207641_10000740 | |||
| 392 | Ga0207648_10002377 | |||
| 393 | Ga0207675_100001291 | |||
| 394 | Ga0207683_10000738 | |||
| 395 | Ga0268265_10000004 | |||
| 396 | Ga0268265_10007324 | |||
| 397 | Ga0268264_10000024 | |||
| 398 | Ga0268264_10002508 | |||
| 399 | Ga0265327_10003731 | |||
| 400 | Ga0265327_10004031 | |||
| 401 | Ga0316576_10017389 | |||
| 402 | Ga0316578_10018302 | |||
| 403 | Ga0316577_10049736 | |||
| 404 | Ga0316574_0009546 | |||
| 405 | Ga0316574_0016981 | |||
| 406 | Ga0316584_0042755 | |||
| 407 | Ga0436364_1038490 | |||
| 408 | Ga0436364_1491030 | |||
| 409 | Ga0436365_1149052 | |||
| 410 | Ga0436363_1706154 | |||
| 411 | Ga0466965_0011195 | |||
| 412 | Ga0466966_0027462 | |||
| 413 | Ga0466957_0115936 | |||
| 414 | Ga0466960_0000518 | |||
| 415 | Ga0466959_0087902 | |||
| 416 | Ga0466967_0188523 | |||
| 417 | Ga0495638_0000482 | |||
| 418 | Ga0495628_0100589 | |||
| 419 | Ga0495672_0041448 | |||
| 420 | Ga0496100_0002861 | |||
| 421 | Ga0496100_0011959 | |||
| 422 | Ga0496101_0000381 | |||
| 423 | Ga0496101_0166384 | |||
| 424 | Ga0496102_0005520 | |||
| 425 | Ga0496102_0037697 | |||
| 426 | Ga0496102_0062993 | |||
| 427 | Ga0496103_0000630 | |||
| 428 | Ga0496103_0001260 | |||
| 429 | Ga0496103_0025101 | |||
| 430 | Ga0496103_0075224 | |||
| 431 | Ga0496104_0000946 | |||
| 432 | Ga0496104_0017574 | |||
| 433 | Ga0496104_0106278 | |||
| 434 | Ga0496105_0016361 | |||
| 435 | Ga0496105_0069271 | |||
| 436 | Ga0496106_0001931 | |||
| 437 | Ga0496106_0002262 | |||
| 438 | Ga0496106_0060625 | |||
| 439 | Ga0496107_0007465 | |||
| 440 | Ga0496107_0059207 | |||
| 441 | Ga0496108_0007250 | |||
| 442 | Ga0496108_0021022 | |||
| 443 | Ga0496109_0043363 | |||
| 444 | Ga0496110_0028100 | |||
| 445 | Ga0496114_0000842 | |||
| 446 | Ga0496114_0007738 | |||
| 447 | Ga0496114_0012464 | |||
| 448 | Ga0496114_0034661 | |||
| 449 | Ga0496114_0257865 | |||
| 450 | Ga0496115_0001478 | |||
| 451 | Ga0496115_0001852 | |||
| 452 | Ga0496115_0002158 | |||
| 453 | Ga0496116_0009735 | |||
| 454 | Ga0496117_0005321 | |||
| 455 | Ga0496118_0000236 | |||
| 456 | Ga0496118_0000514 | |||
| 457 | Ga0496119_0013290 | |||
| 458 | Ga0496120_0005989 | |||
| 459 | Ga0496121_0003437 | |||
| 460 | Ga0496125_0006870 | |||
| 461 | Ga0496126_0000022 | |||
| 462 | Ga0496126_0029127 | |||
| 463 | Ga0496126_0051340 | |||
| 464 | Ga0501032_0036387 | |||
| 465 | Ga0501032_0048381 | |||
| 466 | Ga0501034_0005030 | |||
| 467 | Ga0501034_0009414 | |||
| 468 | Ga0501034_0009551 | |||
| 469 | Ga0501037_0001277 | |||
| 470 | Ga0501037_0133236 | |||
| 471 | Ga0501039_0011148 | |||
| 472 | Ga0501043_0000206 | |||
| 473 | Ga0501043_0021587 | |||
| 474 | Ga0501046_0059008 | |||
| 475 | Ga0501046_0077062 | |||
| 476 | Ga0501047_0019184 | |||
| 477 | Ga0501047_0297567 | |||
| 478 | Ga0501069_0000044 | |||
| 479 | Ga0501070_0000001 | |||
| 480 | Ga0501070_0000386 | |||
| 481 | Ga0501070_0002304 | |||
| 482 | Ga0501071_0025825 | |||
| 483 | Ga0501071_0030382 | |||
| 484 | Ga0501072_0028129 | |||
| 485 | Ga0501073_0175213 | |||
| 486 | Ga0501076_0084479 | |||
| 487 | Ga0501080_0003271 | |||
| 488 | Ga0501080_0053514 | |||
| 489 | Ga0501080_0079182 | |||
| 490 | Ga0501080_0273745 | |||
| 491 | Ga0501035_0000340 | |||
| 492 | Ga0501044_0000380 | |||
| 493 | Ga0501044_0024246 | |||
| 494 | nmdc:mga00v17_1174_c1 | |||
| 495 | nmdc:mga00v17_12537_c1 | |||
| 496 | nmdc:mga0yw44_15967_c1 | |||
| 497 | nmdc:mga05p37_121596_c1 | |||
| 498 | nmdc:mga06r32_179493_c1 | |||
| 499 | nmdc:mga06r32_46795_c1 | |||
| 500 | nmdc:mga06r32_86395_c1 | |||
| 501 | nmdc:mga08y16_213549_c1 | |||
| 502 | Ga0500566_0001013 | |||
| 503 | Ga0500652_000479 | |||
| 504 | Ga0500616_0011541 | |||
| 505 | Ga0500616_0030854 | |||
| 506 | Ga0500645_000123 | |||
| 507 | Ga0466962_0010873 | |||
| 508 | 2676205739 | |||
| 509 | 2508674786 | |||
| 510 | 2517759493 | |||
| 511 | 2548695613 | |||
| 512 | 2671839716 | |||
| 513 | 2686538505 | |||
| 514 | 2689964079 | |||
| 515 | 2689991749 | |||
| 516 | 2738667018 | |||
| 517 | 2738706280 | |||
| 518 | 2739145862 | |||
| 519 | 2739328769 | |||
| 520 | 2744955879 | |||
| 521 | 2774850314 | |||
| 522 | 2774857872 | |||
| 523 | 2842138688 | |||
| 524 | 2895890561 | |||
| 525 | 2902804059 | |||
| 526 | 2929214582 | |||
| 527 | 8002780243 | |||
| 528 | 8002791815 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u5y-assembly1.cif.gz_D | crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica | 0.896 | 390 | 477 |
| 5ja1-assembly1.cif.gz_A | entf, a terminal nonribosomal peptide synthetase module bound to the mbth-like protein ybdz | 0.8316 | 1 | 472 |
| 6h1b-assembly5.cif.gz_E | structure of amide bond synthetase mcba k483a mutant from marinactinospora thermotolerans | 0.8249 | 6 | 478 |
| 5x8f-assembly1.cif.gz_A | ternary complex structure of a double mutant i454ra456k of o-succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with amp and its product analogue osb-ncoa at 1.76 angstrom | 0.8203 | 9 | 474 |
| 5x8g-assembly2.cif.gz_D | binary complex structure of a double mutant i454ra456k of o-succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with its product analogue osb-ncoa at 1.90 angstrom | 0.8202 | 9 | 474 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38137_433_538_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9608 | 380 | 477 | 3.30.300.30 |
| 5buqA02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9597 | 380 | 458 | 3.30.300.30 |
| af_P69451_456_557_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9554 | 381 | 475 | 3.30.300.30 |
| af_P31552_422_517_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9534 | 381 | 473 | 3.30.300.30 |
| af_K7VHQ0_441_545_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9501 | 381 | 480 | 3.30.300.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5U7P8-F1-model_v4 | AMP-binding enzyme C-terminal domain-containing protein | 0.9078 | 375 | 477 |
GO:0016877
|
| AF-A0A7W1E3G2-F1-model_v4 | AMP-binding enzyme C-terminal domain-containing protein | 0.9026 | 375 | 477 |
GO:0006631
GO:0031956 |
| AF-A0A0D7KEW7-F1-model_v4 | Carrier domain-containing protein | 0.88 | 375 | 471 |
GO:0005829
GO:0017000 GO:0031177 GO:0043041 GO:0044550 |
| AF-Q595S6-F1-model_v4 | Non-ribosomal peptide synthetase | 0.8654 | 316 | 471 |
GO:0005737
GO:0017000 GO:0031177 GO:0043041 GO:0044550 |
| AF-A0A290ZI90-F1-model_v4 | AMP-binding enzyme C-terminal domain-containing protein | 0.8609 | 366 | 477 |
GO:0016877
|