F372777

General Info

Members Datasets Scaffolds Average Seq Length
264 125 528 132

Family's Representative Sequence

Representative Sequence 3300042134|Ga0450898_002867|Ga0450898_002867_1893_2369
Length 158
Sequence MHQANQREDAVAQRPFELRQIDHIVLRVRDVDAMQAFYCDVLGCSVERRQDGIGLLQLRAGGSLIDLVGVEGKLGRMGGAAPGTEGRNLDHLCLRVDPFDRDAIVTHLQAHGVRLGEFGSRYGAEGEGPSQYLFDPEDNMVELKGPPDASLNGSGRAG

Samples

Sample ID Description Type Environment
1 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
82 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
83 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 0.38
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450898_002867 3300042134 Bacteria 2427
2 JGI24736J21556_1073355 3300001904 Bacteria 535
3 JGI24740J21852_10028577 3300001979 Bacteria 1842
4 JGI24739J22299_10008636 3300001989 Bacteria 3801
5 JGI24743J22301_10037759 3300001991 Bacteria 963
6 JGI24735J21928_10023026 3300002067 Bacteria 1891
7 rootL2_10058100 3300003322 Bacteria 1890
8 Ga0070658_10068662 3300005327 Bacteria 2898
9 Ga0070658_10163290 3300005327 Bacteria 1869
10 Ga0070658_10341944 3300005327 Bacteria 1280
11 Ga0070658_10586838 3300005327 Bacteria 965
12 Ga0070683_100017099 3300005329 Bacteria 6402
13 Ga0070683_100073335 3300005329 Bacteria 3196
14 Ga0070683_100177703 3300005329 Bacteria 2021
15 Ga0070670_100031535 3300005331 Bacteria 4565
16 Ga0070666_10019899 3300005335 Bacteria 4336
17 Ga0070666_10029478 3300005335 Bacteria 3608
18 Ga0070666_10029943 3300005335 Bacteria 3582
19 Ga0070680_100206075 3300005336 Bacteria 1659
20 Ga0070680_100676210 3300005336 Bacteria 888
21 Ga0070682_100405233 3300005337 Bacteria 1032
22 Ga0070660_100015603 3300005339 Bacteria 5489
23 Ga0070660_100149869 3300005339 Bacteria 1875
24 Ga0070660_100250384 3300005339 Bacteria 1444
25 Ga0070660_101086825 3300005339 Bacteria 677
26 Ga0070660_101938834 3300005339 Bacteria 502
27 Ga0070691_10033323 3300005341 Bacteria 2424
28 Ga0070691_10229629 3300005341 Bacteria 987
29 Ga0070661_100092702 3300005344 Bacteria 2238
30 Ga0070661_100104361 3300005344 Bacteria 2111
31 Ga0070661_100370404 3300005344 Bacteria 1127
32 Ga0070692_10040908 3300005345 Bacteria 2372
33 Ga0070671_101040449 3300005355 Bacteria 718
34 Ga0070671_101341730 3300005355 Bacteria 631
35 Ga0070673_100177465 3300005364 Bacteria 1822
36 Ga0070659_100018972 3300005366 Bacteria 5200
37 Ga0070659_100197024 3300005366 Bacteria 1657
38 Ga0070667_100168452 3300005367 Bacteria 1932
39 Ga0070667_100309389 3300005367 Bacteria 1424
40 Ga0070711_101264784 3300005439 Bacteria 640
41 Ga0070663_100019716 3300005455 Bacteria 4453
42 Ga0070662_100744600 3300005457 Bacteria 831
43 Ga0070681_10603669 3300005458 Bacteria 1012
44 Ga0070679_100210956 3300005530 Bacteria 1906
45 Ga0070679_100371665 3300005530 Bacteria 1377
46 Ga0070684_100043153 3300005535 Bacteria 3893
47 Ga0070684_100122157 3300005535 Bacteria 2343
48 Ga0068853_100089536 3300005539 Bacteria 2703
49 Ga0068853_100231532 3300005539 Bacteria 1690
50 Ga0068853_100501480 3300005539 Bacteria 1146
51 Ga0070665_100119090 3300005548 Bacteria 2643
52 Ga0068855_100025874 3300005563 Bacteria 7018
53 Ga0068855_100272880 3300005563 Bacteria 1880
54 Ga0068855_100729282 3300005563 Bacteria 1058
55 Ga0068855_101044662 3300005563 Bacteria 856
56 Ga0070664_100019117 3300005564 Bacteria 5632
57 Ga0070664_100032962 3300005564 Bacteria 4334
58 Ga0070664_100080864 3300005564 Bacteria 2799
59 Ga0068857_100031529 3300005577 Bacteria 4684
60 Ga0068857_100247484 3300005577 Bacteria 1633
61 Ga0068854_100012333 3300005578 Bacteria 5594
62 Ga0068854_100751866 3300005578 Bacteria 846
63 Ga0068856_100089213 3300005614 Bacteria 3066
64 Ga0068856_100497114 3300005614 Bacteria 1240
65 Ga0068852_100171142 3300005616 Bacteria 2036
66 Ga0068852_101136928 3300005616 Bacteria 801
67 Ga0068852_101663667 3300005616 Bacteria 661
68 Ga0068851_10098658 3300005834 Bacteria 1547
69 Ga0068863_100339347 3300005841 Bacteria 1462
70 Ga0081455_10067087 3300005937 Bacteria 2991
71 Ga0105240_10105656 3300009093 Bacteria 3418
72 Ga0105240_10244345 3300009093 Bacteria 2079
73 Ga0105240_10444624 3300009093 Bacteria 1452
74 Ga0105241_10151973 3300009174 Bacteria 1895
75 Ga0105241_10351561 3300009174 Bacteria 1280
76 Ga0105237_10167521 3300009545 Bacteria 2196
77 Ga0105238_10128748 3300009551 Bacteria 2510
78 Ga0105238_10130749 3300009551 Bacteria 2488
79 Ga0105249_10866579 3300009553 Bacteria 969
80 Ga0157373_10183254 3300013100 Bacteria 1474
81 Ga0157373_10477717 3300013100 Bacteria 899
82 Ga0157373_11022072 3300013100 Bacteria 618
83 Ga0157371_10008583 3300013102 Bacteria 8122
84 Ga0157371_10010729 3300013102 Bacteria 7115
85 Ga0157371_10155387 3300013102 Bacteria 1632
86 Ga0157371_10418820 3300013102 Bacteria 982
87 Ga0157370_10197889 3300013104 Bacteria 1865
88 Ga0157370_10318955 3300013104 Bacteria 1434
89 Ga0157370_10543276 3300013104 Bacteria 1065
90 Ga0157370_11092028 3300013104 Bacteria 721
91 Ga0157369_11573609 3300013105 Bacteria 668
92 Ga0157369_12054439 3300013105 Bacteria 580
93 Ga0157372_10111971 3300013307 Bacteria 3127
94 Ga0157372_10226445 3300013307 Bacteria 2167
95 Ga0157372_11885171 3300013307 Bacteria 687
96 Ga0157372_12411653 3300013307 Bacteria 604
97 Ga0209676_1033637 3300025292 Bacteria 1525
98 Ga0209025_1032408 3300025294 Bacteria 2444
99 Ga0207656_10256510 3300025321 Bacteria 858
100 Ga0207680_10026892 3300025903 Bacteria 3194
101 Ga0207680_10245499 3300025903 Bacteria 1235
102 Ga0207647_10019469 3300025904 Bacteria 4564
103 Ga0207647_10039161 3300025904 Bacteria 2993
104 Ga0207647_10086817 3300025904 Bacteria 1869
105 Ga0207647_10098983 3300025904 Bacteria 1732
106 Ga0207647_10111552 3300025904 Bacteria 1617
107 Ga0207647_10327497 3300025904 Bacteria 869
108 Ga0207705_10003779 3300025909 Bacteria 11529
109 Ga0207705_10193185 3300025909 Bacteria 1540
110 Ga0207705_10400680 3300025909 Bacteria 1061
111 Ga0207705_10550919 3300025909 Bacteria 896
112 Ga0207705_11027676 3300025909 Bacteria 636
113 Ga0207654_10117537 3300025911 Bacteria 1664
114 Ga0207654_10647130 3300025911 Bacteria 757
115 Ga0207695_11247131 3300025913 Bacteria 624
116 Ga0207671_10143185 3300025914 Bacteria 1843
117 Ga0207663_10881449 3300025916 Bacteria 715
118 Ga0207660_10016781 3300025917 Bacteria 4855
119 Ga0207660_10644146 3300025917 Bacteria 864
120 Ga0207657_10004302 3300025919 Bacteria 15090
121 Ga0207657_10007384 3300025919 Bacteria 11273
122 Ga0207657_10012191 3300025919 Bacteria 8496
123 Ga0207657_11401194 3300025919 Bacteria 525
124 Ga0207649_10086875 3300025920 Bacteria 2039
125 Ga0207649_10178943 3300025920 Bacteria 1483
126 Ga0207652_10090440 3300025921 Bacteria 2690
127 Ga0207652_10293398 3300025921 Bacteria 1467
128 Ga0207694_10023394 3300025924 Bacteria 4689
129 Ga0207650_10032322 3300025925 Bacteria 3784
130 Ga0207644_10125064 3300025931 Bacteria 1962
131 Ga0207644_10186770 3300025931 Bacteria 1628
132 Ga0207690_10021827 3300025932 Bacteria 3976
133 Ga0207690_10040588 3300025932 Bacteria 3043
134 Ga0207706_10131823 3300025933 Bacteria 2198
135 Ga0207661_10018520 3300025944 Bacteria 5174
136 Ga0207661_11417190 3300025944 Bacteria 637
137 Ga0207661_11884907 3300025944 Bacteria 543
138 Ga0207679_10017676 3300025945 Bacteria 4761
139 Ga0207667_10047020 3300025949 Bacteria 4568
140 Ga0207667_10103154 3300025949 Bacteria 2942
141 Ga0207667_10131357 3300025949 Bacteria 2579
142 Ga0207667_10581456 3300025949 Bacteria 1131
143 Ga0207667_11182141 3300025949 Bacteria 745
144 Ga0207651_10047839 3300025960 Bacteria 2887
145 Ga0207712_10771635 3300025961 Bacteria 843
146 Ga0207658_10011213 3300025986 Bacteria 6106
147 Ga0207658_10134485 3300025986 Bacteria 1991
148 Ga0207639_10201272 3300026041 Bacteria 1708
149 Ga0207639_10321372 3300026041 Bacteria 1374
150 Ga0207678_10081460 3300026067 Bacteria 2770
151 Ga0207702_10131917 3300026078 Bacteria 2249
152 Ga0207641_10649884 3300026088 Bacteria 1036
153 Ga0207674_10057417 3300026116 Bacteria 3946
154 Ga0207674_10077504 3300026116 Bacteria 3329
155 Ga0207698_10034678 3300026142 Bacteria 3681
156 Ga0207698_10691993 3300026142 Bacteria 1014
157 Ga0268266_10012027 3300028379 Bacteria 7491
158 Ga0316177_1042892 3300030731 Bacteria 4763
159 Ga0316176_1212763 3300030732 Bacteria 895
160 Ga0316178_1009303 3300030735 Bacteria 3094
161 Ga0307413_10366655 3300031824 Bacteria 1117
162 Ga0307409_101091355 3300031995 Bacteria 819
163 Ga0307414_10099445 3300032004 Bacteria 2185
164 Ga0307414_10497083 3300032004 Bacteria 1078
165 Ga0395899_0000287 3300037312 Bacteria 64885
166 Ga0395899_0020021 3300037312 Bacteria 5076
167 Ga0395899_0055067 3300037312 Bacteria 2942
168 Ga0395899_0438160 3300037312 Bacteria 858
169 Ga0395899_0444170 3300037312 Bacteria 850
170 Ga0395899_0580523 3300037312 Bacteria 716
171 Ga0395900_0000031 3300037418 Bacteria 262393
172 Ga0395900_0012095 3300037418 Bacteria 8820
173 Ga0395900_0019006 3300037418 Bacteria 7008
174 Ga0395900_0020548 3300037418 Bacteria 6742
175 Ga0395900_0035044 3300037418 Bacteria 5169
176 Ga0395900_0035598 3300037418 Bacteria 5128
177 Ga0395900_0055655 3300037418 Bacteria 4073
178 Ga0395900_0059488 3300037418 Bacteria 3933
179 Ga0395900_0158334 3300037418 Bacteria 2312
180 Ga0395900_0174230 3300037418 Bacteria 2188
181 Ga0395900_0200510 3300037418 Bacteria 2019
182 Ga0395900_0252711 3300037418 Bacteria 1763
183 Ga0395900_0260433 3300037418 Bacteria 1732
184 Ga0395900_0287599 3300037418 Bacteria 1634
185 Ga0395898_0041010 3300037466 Bacteria 4574
186 Ga0395898_0053681 3300037466 Bacteria 3936
187 Ga0395898_0100943 3300037466 Bacteria 2771
188 Ga0395898_0131174 3300037466 Bacteria 2400
189 Ga0395898_0180193 3300037466 Bacteria 2019
190 Ga0395898_0202847 3300037466 Bacteria 1893
191 Ga0395898_0229380 3300037466 Bacteria 1771
192 Ga0395898_0728031 3300037466 Bacteria 933
193 Ga0395898_0794525 3300037466 Bacteria 887
194 Ga0395898_1404692 3300037466 Bacteria 626
195 Ga0395905_0002898 3300037471 Bacteria 18745
196 Ga0395905_0005759 3300037471 Bacteria 12594
197 Ga0395905_0040721 3300037471 Bacteria 4358
198 Ga0395905_0056951 3300037471 Bacteria 3656
199 Ga0395905_0059861 3300037471 Bacteria 3561
200 Ga0395905_0098681 3300037471 Bacteria 2743
201 Ga0395905_0111297 3300037471 Bacteria 2571
202 Ga0395905_0192758 3300037471 Bacteria 1911
203 Ga0395905_0441078 3300037471 Bacteria 1199
204 Ga0395905_0775022 3300037471 Bacteria 862
205 Ga0395901_0000035 3300038443 Bacteria 223888
206 Ga0395901_0009267 3300038443 Bacteria 9983
207 Ga0395901_0014220 3300038443 Bacteria 8103
208 Ga0395901_0258797 3300038443 Bacteria 1811
209 Ga0395901_0279293 3300038443 Bacteria 1735
210 Ga0395901_0734439 3300038443 Bacteria 982
211 Ga0395901_0948540 3300038443 Bacteria 839
212 Ga0395901_1300106 3300038443 Bacteria 689
213 Ga0395901_1345115 3300038443 Bacteria 674
214 Ga0439449_0016370 3300042007 Bacteria 2786
215 Ga0439455_0007339 3300042012 Bacteria 2329
216 Ga0450893_0001935 3300042532 Bacteria 3219
217 Ga0466963_0017397 3300044694 Bacteria 4481
218 Ga0466963_0116281 3300044694 Bacteria 1838
219 Ga0466963_0310395 3300044694 Bacteria 1109
220 Ga0466963_0902926 3300044694 Bacteria 622
221 Ga0466968_0036419 3300044735 Bacteria 2062
222 Ga0466957_0110117 3300044842 Bacteria 1746
223 Ga0466957_0296260 3300044842 Bacteria 1086
224 Ga0451576_1424256 3300045051 Unclassified 721
225 Ga0451576_2519608 3300045051 Bacteria 525
226 Ga0466958_0035552 3300045836 Bacteria 2977
227 Ga0466958_0507521 3300045836 Bacteria 782
228 Ga0466958_0715224 3300045836 Bacteria 652
229 Ga0466967_0014039 3300045976 Bacteria 6221
230 Ga0466967_0052615 3300045976 Bacteria 3575
231 Ga0466967_0308031 3300045976 Bacteria 1525
232 Ga0466967_2246079 3300045976 Bacteria 541
233 Ga0496108_0255574 3300048911 Bacteria 1524
234 Ga0501036_0754147 3300049572 Bacteria 803
235 Ga0501038_0053131 3300049574 Bacteria 3490
236 Ga0501039_0003932 3300049575 Bacteria 11168
237 Ga0501040_0268546 3300049576 Bacteria 1218
238 Ga0501042_0331953 3300049578 Bacteria 1099
239 Ga0501043_0010120 3300049579 Bacteria 7394
240 Ga0501043_0037610 3300049579 Bacteria 3806
241 Ga0501046_0214581 3300049580 Bacteria 1427
242 Ga0501046_0754987 3300049580 Bacteria 683
243 Ga0501047_0001127 3300049581 Bacteria 26540
244 Ga0501072_0253454 3300049588 Bacteria 1401
245 Ga0501076_0154650 3300049592 Bacteria 1866
246 Ga0501077_0819674 3300049593 Bacteria 598
247 Ga0501079_0008832 3300049741 Bacteria 7630
248 Ga0501079_0085097 3300049741 Bacteria 2447
249 Ga0501079_1483330 3300049741 Bacteria 533
250 Ga0501080_0309277 3300049742 Bacteria 1432
251 Ga0501081_0000696 3300049743 Bacteria 19414
252 Ga0501035_0130865 3300049822 Bacteria 2187
253 Ga0501044_0112392 3300049823 Bacteria 2731
254 Ga0501045_0012797 3300049824 Bacteria 5911
255 Ga0500610_0000158 3300053079 Bacteria 20255
256 Ga0500651_0660111 3300053093 Bacteria 562
257 Ga0501084_0018451 3300054114 Bacteria 5808
258 Ga0501084_0232832 3300054114 Bacteria 1555
259 Ga0501082_0000754 3300060353 Bacteria 28420
260 Ga0466962_0034123 3300061719 Bacteria 2435
261 Ga0466962_0100254 3300061719 Bacteria 1390
262 Ga0466962_0183910 3300061719 Bacteria 1019
263 Ga0530510_0877207 3300061734 Bacteria 685
264 2643895084 2643221577 Bacteria 3710843
265 Ga0450898_002867
266 JGI24736J21556_1073355
267 JGI24740J21852_10028577
268 JGI24739J22299_10008636
269 JGI24743J22301_10037759
270 JGI24735J21928_10023026
271 rootL2_10058100
272 Ga0070658_10068662
273 Ga0070658_10163290
274 Ga0070658_10341944
275 Ga0070658_10586838
276 Ga0070683_100017099
277 Ga0070683_100073335
278 Ga0070683_100177703
279 Ga0070670_100031535
280 Ga0070666_10019899
281 Ga0070666_10029478
282 Ga0070666_10029943
283 Ga0070680_100206075
284 Ga0070680_100676210
285 Ga0070682_100405233
286 Ga0070660_100015603
287 Ga0070660_100149869
288 Ga0070660_100250384
289 Ga0070660_101086825
290 Ga0070660_101938834
291 Ga0070691_10033323
292 Ga0070691_10229629
293 Ga0070661_100092702
294 Ga0070661_100104361
295 Ga0070661_100370404
296 Ga0070692_10040908
297 Ga0070671_101040449
298 Ga0070671_101341730
299 Ga0070673_100177465
300 Ga0070659_100018972
301 Ga0070659_100197024
302 Ga0070667_100168452
303 Ga0070667_100309389
304 Ga0070711_101264784
305 Ga0070663_100019716
306 Ga0070662_100744600
307 Ga0070681_10603669
308 Ga0070679_100210956
309 Ga0070679_100371665
310 Ga0070684_100043153
311 Ga0070684_100122157
312 Ga0068853_100089536
313 Ga0068853_100231532
314 Ga0068853_100501480
315 Ga0070665_100119090
316 Ga0068855_100025874
317 Ga0068855_100272880
318 Ga0068855_100729282
319 Ga0068855_101044662
320 Ga0070664_100019117
321 Ga0070664_100032962
322 Ga0070664_100080864
323 Ga0068857_100031529
324 Ga0068857_100247484
325 Ga0068854_100012333
326 Ga0068854_100751866
327 Ga0068856_100089213
328 Ga0068856_100497114
329 Ga0068852_100171142
330 Ga0068852_101136928
331 Ga0068852_101663667
332 Ga0068851_10098658
333 Ga0068863_100339347
334 Ga0081455_10067087
335 Ga0105240_10105656
336 Ga0105240_10244345
337 Ga0105240_10444624
338 Ga0105241_10151973
339 Ga0105241_10351561
340 Ga0105237_10167521
341 Ga0105238_10128748
342 Ga0105238_10130749
343 Ga0105249_10866579
344 Ga0157373_10183254
345 Ga0157373_10477717
346 Ga0157373_11022072
347 Ga0157371_10008583
348 Ga0157371_10010729
349 Ga0157371_10155387
350 Ga0157371_10418820
351 Ga0157370_10197889
352 Ga0157370_10318955
353 Ga0157370_10543276
354 Ga0157370_11092028
355 Ga0157369_11573609
356 Ga0157369_12054439
357 Ga0157372_10111971
358 Ga0157372_10226445
359 Ga0157372_11885171
360 Ga0157372_12411653
361 Ga0209676_1033637
362 Ga0209025_1032408
363 Ga0207656_10256510
364 Ga0207680_10026892
365 Ga0207680_10245499
366 Ga0207647_10019469
367 Ga0207647_10039161
368 Ga0207647_10086817
369 Ga0207647_10098983
370 Ga0207647_10111552
371 Ga0207647_10327497
372 Ga0207705_10003779
373 Ga0207705_10193185
374 Ga0207705_10400680
375 Ga0207705_10550919
376 Ga0207705_11027676
377 Ga0207654_10117537
378 Ga0207654_10647130
379 Ga0207695_11247131
380 Ga0207671_10143185
381 Ga0207663_10881449
382 Ga0207660_10016781
383 Ga0207660_10644146
384 Ga0207657_10004302
385 Ga0207657_10007384
386 Ga0207657_10012191
387 Ga0207657_11401194
388 Ga0207649_10086875
389 Ga0207649_10178943
390 Ga0207652_10090440
391 Ga0207652_10293398
392 Ga0207694_10023394
393 Ga0207650_10032322
394 Ga0207644_10125064
395 Ga0207644_10186770
396 Ga0207690_10021827
397 Ga0207690_10040588
398 Ga0207706_10131823
399 Ga0207661_10018520
400 Ga0207661_11417190
401 Ga0207661_11884907
402 Ga0207679_10017676
403 Ga0207667_10047020
404 Ga0207667_10103154
405 Ga0207667_10131357
406 Ga0207667_10581456
407 Ga0207667_11182141
408 Ga0207651_10047839
409 Ga0207712_10771635
410 Ga0207658_10011213
411 Ga0207658_10134485
412 Ga0207639_10201272
413 Ga0207639_10321372
414 Ga0207678_10081460
415 Ga0207702_10131917
416 Ga0207641_10649884
417 Ga0207674_10057417
418 Ga0207674_10077504
419 Ga0207698_10034678
420 Ga0207698_10691993
421 Ga0268266_10012027
422 Ga0316177_1042892
423 Ga0316176_1212763
424 Ga0316178_1009303
425 Ga0307413_10366655
426 Ga0307409_101091355
427 Ga0307414_10099445
428 Ga0307414_10497083
429 Ga0395899_0000287
430 Ga0395899_0020021
431 Ga0395899_0055067
432 Ga0395899_0438160
433 Ga0395899_0444170
434 Ga0395899_0580523
435 Ga0395900_0000031
436 Ga0395900_0012095
437 Ga0395900_0019006
438 Ga0395900_0020548
439 Ga0395900_0035044
440 Ga0395900_0035598
441 Ga0395900_0055655
442 Ga0395900_0059488
443 Ga0395900_0158334
444 Ga0395900_0174230
445 Ga0395900_0200510
446 Ga0395900_0252711
447 Ga0395900_0260433
448 Ga0395900_0287599
449 Ga0395898_0041010
450 Ga0395898_0053681
451 Ga0395898_0100943
452 Ga0395898_0131174
453 Ga0395898_0180193
454 Ga0395898_0202847
455 Ga0395898_0229380
456 Ga0395898_0728031
457 Ga0395898_0794525
458 Ga0395898_1404692
459 Ga0395905_0002898
460 Ga0395905_0005759
461 Ga0395905_0040721
462 Ga0395905_0056951
463 Ga0395905_0059861
464 Ga0395905_0098681
465 Ga0395905_0111297
466 Ga0395905_0192758
467 Ga0395905_0441078
468 Ga0395905_0775022
469 Ga0395901_0000035
470 Ga0395901_0009267
471 Ga0395901_0014220
472 Ga0395901_0258797
473 Ga0395901_0279293
474 Ga0395901_0734439
475 Ga0395901_0948540
476 Ga0395901_1300106
477 Ga0395901_1345115
478 Ga0439449_0016370
479 Ga0439455_0007339
480 Ga0450893_0001935
481 Ga0466963_0017397
482 Ga0466963_0116281
483 Ga0466963_0310395
484 Ga0466963_0902926
485 Ga0466968_0036419
486 Ga0466957_0110117
487 Ga0466957_0296260
488 Ga0451576_1424256
489 Ga0451576_2519608
490 Ga0466958_0035552
491 Ga0466958_0507521
492 Ga0466958_0715224
493 Ga0466967_0014039
494 Ga0466967_0052615
495 Ga0466967_0308031
496 Ga0466967_2246079
497 Ga0496108_0255574
498 Ga0501036_0754147
499 Ga0501038_0053131
500 Ga0501039_0003932
501 Ga0501040_0268546
502 Ga0501042_0331953
503 Ga0501043_0010120
504 Ga0501043_0037610
505 Ga0501046_0214581
506 Ga0501046_0754987
507 Ga0501047_0001127
508 Ga0501072_0253454
509 Ga0501076_0154650
510 Ga0501077_0819674
511 Ga0501079_0008832
512 Ga0501079_0085097
513 Ga0501079_1483330
514 Ga0501080_0309277
515 Ga0501081_0000696
516 Ga0501035_0130865
517 Ga0501044_0112392
518 Ga0501045_0012797
519 Ga0500610_0000158
520 Ga0500651_0660111
521 Ga0501084_0018451
522 Ga0501084_0232832
523 Ga0501082_0000754
524 Ga0466962_0034123
525 Ga0466962_0100254
526 Ga0466962_0183910
527 Ga0530510_0877207
528 2643895084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

143

0.85

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

131

0.84

PF18029

Glyoxalase_6

Glyoxalase-like domain

23

143

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.871 3 130
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8637 4 130
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.856 3 130
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8507 4 130
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8427 3 130
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.867 8 130 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.855 8 130 3.10.180.10
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8198 74 130 3.10.180.10
5cviA02 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8113 30 54 2.30.30.90
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8112 4 130 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A520G890-F1-model_v4 VOC family protein 0.9727 1 135
AF-A0A562PEL1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9691 1 133 GO:0051213
AF-A0A4R2W4V4-F1-model_v4 deleted 0.9647 2 134
AF-A0A0Q7FAU6-F1-model_v4 Lactoylglutathione lyase 0.964 1 134 GO:0016829
AF-A0A5E5A2S4-F1-model_v4 Lactoylglutathione lyase 0.9618 1 134 GO:0016829

Map