F372636

General Info

Members Datasets Scaffolds Average Seq Length
264 179 528 64

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10020410|Ga0213873_100204102
Length 77
Sequence LIAAPVLRELLRKAMLTFILWCLLFVFSWPLALAALVLYPLVWLILLPFRIVGITVHGALALVAAIIFLPVRLIRAI

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
165 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
173 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
174 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
175 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 0
Rhizoplane 0
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 22.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10020410 3300021358 Unclassified 1547
2 rootH1_10325220 3300003323 Bacteria 1479
3 Ga0055535_1000104 3300003761 Bacteria 90825
4 Ga0055529_1000242 3300003763 Bacteria 67874
5 Ga0070683_101615469 3300005329 Bacteria 623
6 Ga0070666_10723850 3300005335 Unclassified 730
7 Ga0070680_100003212 3300005336 Bacteria 12161
8 Ga0070680_100961477 3300005336 Bacteria 737
9 Ga0070680_101033420 3300005336 Bacteria 710
10 Ga0070660_100077872 3300005339 Bacteria 2599
11 Ga0070691_10989234 3300005341 Bacteria 524
12 Ga0070659_100436207 3300005366 Bacteria 1109
13 Ga0070703_10000916 3300005406 Bacteria 9389
14 Ga0070709_10086079 3300005434 Bacteria 2062
15 Ga0070709_10343774 3300005434 Unclassified 1101
16 Ga0070714_100240943 3300005435 Unclassified 1669
17 Ga0070713_100014769 3300005436 Bacteria 5811
18 Ga0070713_100375729 3300005436 Unclassified 1323
19 Ga0070710_10196815 3300005437 Unclassified 1270
20 Ga0070711_101104619 3300005439 Unclassified 683
21 Ga0070711_101107573 3300005439 Bacteria 682
22 Ga0070705_100030416 3300005440 Unclassified 2981
23 Ga0070694_100055742 3300005444 Bacteria 2682
24 Ga0070694_100744280 3300005444 Bacteria 800
25 Ga0070708_100000636 3300005445 Bacteria 26501
26 Ga0070663_100007301 3300005455 Bacteria 6717
27 Ga0070681_10061039 3300005458 Bacteria 3746
28 Ga0070681_10192294 3300005458 Bacteria 1960
29 Ga0070681_10790714 3300005458 Bacteria 866
30 Ga0070706_100016664 3300005467 Bacteria 6788
31 Ga0070706_100018522 3300005467 Bacteria 6419
32 Ga0070707_100022845 3300005468 Bacteria 5914
33 Ga0070707_100405364 3300005468 Bacteria 1324
34 Ga0070698_100043464 3300005471 Bacteria 4606
35 Ga0070699_100059722 3300005518 Bacteria 3303
36 Ga0070699_100512754 3300005518 Bacteria 1090
37 Ga0070699_100695783 3300005518 Bacteria 929
38 Ga0070679_100072964 3300005530 Bacteria 3425
39 Ga0070679_100135583 3300005530 Bacteria 2443
40 Ga0070679_100635459 3300005530 Bacteria 1010
41 Ga0070684_100296118 3300005535 Unclassified 1484
42 Ga0070697_100000243 3300005536 Bacteria 44295
43 Ga0070695_100002693 3300005545 Bacteria 10284
44 Ga0070695_100033427 3300005545 Bacteria 3217
45 Ga0070695_101088365 3300005545 Bacteria 654
46 Ga0070696_100001584 3300005546 Bacteria 14909
47 Ga0070693_100000115 3300005547 Bacteria 35873
48 Ga0070704_100043755 3300005549 Bacteria 3106
49 Ga0068855_100006351 3300005563 Bacteria 14402
50 Ga0068855_100018098 3300005563 Bacteria 8467
51 Ga0068855_100888487 3300005563 Unclassified 942
52 Ga0070664_101913845 3300005564 Bacteria 563
53 Ga0068857_100189706 3300005577 Unclassified 1872
54 Ga0068854_100177275 3300005578 Bacteria 1662
55 Ga0068856_100010570 3300005614 Bacteria 8963
56 Ga0068856_100090038 3300005614 Unclassified 3052
57 Ga0068852_100747101 3300005616 Bacteria 990
58 Ga0068859_100162126 3300005617 Unclassified 2315
59 Ga0068859_100339755 3300005617 Bacteria 1596
60 Ga0081455_10375200 3300005937 Bacteria 995
61 Ga0070717_10004198 3300006028 Bacteria 10389
62 Ga0070717_10006397 3300006028 Bacteria 8659
63 Ga0070717_10027569 3300006028 Bacteria 4541
64 Ga0070717_10573594 3300006028 Bacteria 1023
65 Ga0070715_10856636 3300006163 Unclassified 556
66 Ga0070716_101406593 3300006173 Bacteria 567
67 Ga0097620_100162113 3300006931 Unclassified 2315
68 Ga0097620_100339719 3300006931 Bacteria 1596
69 Ga0105240_10011624 3300009093 Bacteria 12244
70 Ga0105240_10193656 3300009093 Bacteria 2389
71 Ga0105240_11274018 3300009093 Bacteria 776
72 Ga0111539_11593944 3300009094 Bacteria 757
73 Ga0105245_12616778 3300009098 Bacteria 558
74 Ga0105241_11676350 3300009174 Bacteria 617
75 Ga0105237_11208349 3300009545 Bacteria 762
76 Ga0105238_10028824 3300009551 Bacteria 5654
77 Ga0099796_10095269 3300010159 Bacteria 1112
78 Ga0157373_10174341 3300013100 Bacteria 1513
79 Ga0157373_11447034 3300013100 Unclassified 523
80 Ga0157370_10005390 3300013104 Bacteria 14353
81 Ga0157370_10450874 3300013104 Bacteria 1183
82 Ga0157370_10771944 3300013104 Unclassified 875
83 Ga0157369_10011660 3300013105 Bacteria 9982
84 Ga0163162_13359116 3300013306 Unclassified 511
85 Ga0157372_10015071 3300013307 Bacteria 8275
86 Ga0157372_10170403 3300013307 Bacteria 2519
87 Ga0157372_11938189 3300013307 Bacteria 677
88 Ga0157380_10750596 3300014326 Bacteria 987
89 Ga0157376_11723275 3300014969 Bacteria 662
90 Ga0213873_10126848 3300021358 Unclassified 753
91 Ga0213873_10150606 3300021358 Unclassified 700
92 Ga0213872_10000604 3300021361 Bacteria 27278
93 Ga0213872_10282573 3300021361 Bacteria 692
94 Ga0213874_10404528 3300021377 Bacteria 532
95 Ga0213876_10017227 3300021384 Bacteria 3814
96 Ga0213875_10003744 3300021388 Bacteria 8566
97 Ga0213875_10010950 3300021388 Bacteria 4529
98 Ga0213875_10042727 3300021388 Bacteria 2129
99 Ga0213875_10058730 3300021388 Bacteria 1801
100 Ga0213875_10185093 3300021388 Unclassified 979
101 Ga0213875_10241009 3300021388 Unclassified 852
102 Ga0213875_10363864 3300021388 Bacteria 688
103 Ga0213875_10631091 3300021388 Unclassified 518
104 Ga0213871_10002892 3300021441 Bacteria 3232
105 Ga0209258_100110 3300025242 Bacteria 201322
106 Ga0209759_1000323 3300025256 Bacteria 63102
107 Ga0209759_1005890 3300025256 Bacteria 4196
108 Ga0209455_1000104 3300025272 Bacteria 201321
109 Ga0207653_10002742 3300025885 Bacteria 5602
110 Ga0207685_10574060 3300025905 Bacteria 602
111 Ga0207699_10281488 3300025906 Unclassified 1156
112 Ga0207699_10379195 3300025906 Unclassified 1003
113 Ga0207699_11244285 3300025906 Bacteria 551
114 Ga0207684_10013882 3300025910 Bacteria 6956
115 Ga0207707_10037245 3300025912 Bacteria 4250
116 Ga0207707_10116408 3300025912 Bacteria 2336
117 Ga0207707_10226001 3300025912 Unclassified 1629
118 Ga0207695_10002661 3300025913 Bacteria 26121
119 Ga0207695_10065009 3300025913 Bacteria 3752
120 Ga0207695_10515396 3300025913 Bacteria 1078
121 Ga0207695_10603426 3300025913 Unclassified 979
122 Ga0207695_10804846 3300025913 Bacteria 820
123 Ga0207671_10259901 3300025914 Bacteria 1366
124 Ga0207663_10814055 3300025916 Bacteria 744
125 Ga0207660_10866657 3300025917 Bacteria 737
126 Ga0207657_10178079 3300025919 Unclassified 1720
127 Ga0207657_10206855 3300025919 Bacteria 1576
128 Ga0207652_10038041 3300025921 Bacteria 4075
129 Ga0207652_10109512 3300025921 Bacteria 2449
130 Ga0207652_10537497 3300025921 Bacteria 1051
131 Ga0207646_10027699 3300025922 Bacteria 5166
132 Ga0207646_10208370 3300025922 Bacteria 1765
133 Ga0207687_11331626 3300025927 Unclassified 617
134 Ga0207700_10047696 3300025928 Bacteria 3176
135 Ga0207700_10455709 3300025928 Bacteria 1128
136 Ga0207664_10026342 3300025929 Bacteria 4394
137 Ga0207664_10220650 3300025929 Unclassified 1644
138 Ga0207690_10365256 3300025932 Bacteria 1144
139 Ga0207686_10846276 3300025934 Bacteria 736
140 Ga0207709_11615187 3300025935 Bacteria 538
141 Ga0207711_10238807 3300025941 Unclassified 1666
142 Ga0207667_10009749 3300025949 Bacteria 11293
143 Ga0207667_10043605 3300025949 Bacteria 4760
144 Ga0207640_10604300 3300025981 Bacteria 929
145 Ga0207639_12186363 3300026041 Unclassified 514
146 Ga0207678_10009976 3300026067 Bacteria 8334
147 Ga0207702_10074058 3300026078 Bacteria 2938
148 Ga0207702_10150008 3300026078 Bacteria 2120
149 Ga0207648_11382162 3300026089 Bacteria 662
150 Ga0207698_10004753 3300026142 Bacteria 8309
151 Ga0268264_11697718 3300028381 Unclassified 642
152 Ga0265338_10972537 3300028800 Bacteria 575
153 Ga0265770_1135959 3300030878 Bacteria 529
154 Ga0265770_1139135 3300030878 Bacteria 525
155 Ga0265330_10120594 3300031235 Unclassified 1117
156 Ga0265328_10012212 3300031239 Bacteria 3420
157 Ga0265328_10199444 3300031239 Bacteria 760
158 Ga0265339_10000026 3300031249 Bacteria 165764
159 Ga0265316_10452949 3300031344 Bacteria 920
160 Ga0265314_10291829 3300031711 Bacteria 918
161 Ga0265342_10001312 3300031712 Bacteria 23334
162 Ga0307413_11260364 3300031824 Unclassified 645
163 Ga0373954_0133329 3300035118 Bacteria 1210
164 Ga0373955_0155967 3300035172 Bacteria 1345
165 Ga0373937_0989007 3300036401 Unclassified 790
166 Ga0395899_0998471 3300037312 Unclassified 505
167 Ga0395900_1774206 3300037418 Unclassified 528
168 Ga0395898_0243770 3300037466 Unclassified 1714
169 Ga0395898_1904134 3300037466 Unclassified 515
170 Ga0436364_0093671 3300037853 Unclassified 2433
171 Ga0436364_0525588 3300037853 Bacteria 4121
172 Ga0436364_0633612 3300037853 Unclassified 561
173 Ga0436364_0723592 3300037853 Bacteria 2162
174 Ga0436364_0791089 3300037853 Bacteria 2437
175 Ga0436364_0856964 3300037853 Bacteria 1426
176 Ga0436364_0882204 3300037853 Unclassified 850
177 Ga0436364_0950501 3300037853 Bacteria 810
178 Ga0436364_1334562 3300037853 Bacteria 4410
179 Ga0436364_1495544 3300037853 Unclassified 518
180 Ga0436364_1536279 3300037853 Bacteria 15239
181 Ga0395901_0859683 3300038443 Bacteria 892
182 Ga0436365_0432110 3300039437 Unclassified 1061
183 Ga0436365_1190398 3300039437 Bacteria 538
184 Ga0436365_1393682 3300039437 Bacteria 5711
185 Ga0436365_1743357 3300039437 Bacteria 9594
186 Ga0436360_0206427 3300039438 Bacteria 13761
187 Ga0436360_1087261 3300039438 Unclassified 2043
188 Ga0436361_0434431 3300039447 Bacteria 90700
189 Ga0436361_0859300 3300039447 Bacteria 873
190 Ga0436361_1113307 3300039447 Unclassified 657
191 Ga0436363_0097113 3300039450 Bacteria 652
192 Ga0436363_0223382 3300039450 Unclassified 1290
193 Ga0436363_0264917 3300039450 Unclassified 1255
194 Ga0436362_0803212 3300039453 Bacteria 1968
195 Ga0436362_1016565 3300039453 Bacteria 4272
196 Ga0436362_1229735 3300039453 Bacteria 1825
197 Ga0466963_0601791 3300044694 Unclassified 776
198 Ga0466971_0246300 3300044719 Unclassified 851
199 Ga0466957_0676713 3300044842 Bacteria 727
200 Ga0466959_0807672 3300045049 Unclassified 627
201 Ga0466967_0141783 3300045976 Bacteria 2239
202 Ga0495651_0292527 3300046462 Bacteria 1096
203 Ga0495580_0032758 3300046472 Bacteria 3747
204 Ga0495580_0602166 3300046472 Bacteria 726
205 Ga0495582_0535278 3300046473 Unclassified 677
206 Ga0495606_0003697 3300046507 Bacteria 15990
207 Ga0495618_0611225 3300046514 Bacteria 648
208 Ga0495648_0281148 3300046524 Bacteria 789
209 Ga0495587_0081578 3300046536 Bacteria 1874
210 Ga0495635_0461346 3300046663 Unclassified 839
211 Ga0495599_0041903 3300046678 Bacteria 2873
212 Ga0495669_0061584 3300046684 Bacteria 1698
213 Ga0495649_0000946 3300046694 Bacteria 22945
214 Ga0495674_0047366 3300047319 Bacteria 3813
215 Ga0495684_0044933 3300047471 Unclassified 3381
216 Ga0495684_0330068 3300047471 Bacteria 1088
217 Ga0495602_0494407 3300048088 Bacteria 856
218 Ga0496126_0216166 3300048929 Bacteria 1612
219 Ga0496126_1365767 3300048929 Bacteria 513
220 Ga0501303_056882 3300049526 Unclassified 526
221 Ga0501031_0018109 3300049568 Bacteria 4582
222 Ga0501032_0006794 3300049569 Bacteria 8395
223 Ga0501033_0003571 3300049570 Bacteria 12724
224 Ga0501034_0059841 3300049571 Bacteria 3826
225 Ga0501036_0000295 3300049572 Bacteria 34600
226 Ga0501037_0012282 3300049573 Bacteria 6303
227 Ga0501038_0001014 3300049574 Bacteria 25267
228 Ga0501039_0004528 3300049575 Bacteria 10497
229 Ga0501040_0653552 3300049576 Unclassified 760
230 Ga0501043_0002917 3300049579 Bacteria 14273
231 Ga0501046_0020245 3300049580 Bacteria 5506
232 Ga0501048_0035094 3300049582 Unclassified 3612
233 Ga0501067_0100151 3300049583 Bacteria 1609
234 Ga0501068_0001097 3300049584 Bacteria 14341
235 Ga0501069_0000735 3300049585 Bacteria 15273
236 Ga0501072_0003952 3300049588 Bacteria 11214
237 Ga0501072_0806432 3300049588 Bacteria 735
238 Ga0501073_0120212 3300049589 Bacteria 1820
239 Ga0501074_0004689 3300049590 Bacteria 9791
240 Ga0501076_0233785 3300049592 Bacteria 1503
241 Ga0501077_0003719 3300049593 Bacteria 9177
242 Ga0501206_025139 3300049653 Bacteria 866
243 Ga0501217_082587 3300049661 Bacteria 891
244 Ga0501222_080016 3300049662 Bacteria 520
245 Ga0501249_041952 3300049679 Bacteria 1039
246 Ga0501079_0001799 3300049741 Bacteria 15314
247 Ga0501080_0000017 3300049742 Bacteria 96079
248 Ga0501083_0427753 3300049744 Unclassified 861
249 Ga0501268_021273 3300049765 Bacteria 1112
250 Ga0501270_045788 3300049767 Bacteria 777
251 Ga0501035_0150945 3300049822 Bacteria 2016
252 Ga0501044_0073554 3300049823 Bacteria 3473
253 Ga0501045_0148419 3300049824 Bacteria 1744
254 Ga0501212_091237 3300049851 Bacteria 562
255 Ga0500635_0012913 3300053080 Bacteria 2412
256 Ga0495619_0811637 3300053085 Bacteria 632
257 Ga0500578_0206219 3300053086 Bacteria 1201
258 Ga0500581_392310 3300053089 Bacteria 507
259 Ga0500652_230543 3300053131 Bacteria 741
260 Ga0500564_125044 3300053138 Bacteria 1117
261 Ga0500636_0006634 3300053177 Bacteria 6654
262 Ga0501084_0098995 3300054114 Bacteria 2448
263 Ga0587066_206141 3300059490 Bacteria 520
264 Ga0501082_0161275 3300060353 Bacteria 1948
265 Ga0213873_10020410
266 rootH1_10325220
267 Ga0055535_1000104
268 Ga0055529_1000242
269 Ga0070683_101615469
270 Ga0070666_10723850
271 Ga0070680_100003212
272 Ga0070680_100961477
273 Ga0070680_101033420
274 Ga0070660_100077872
275 Ga0070691_10989234
276 Ga0070659_100436207
277 Ga0070703_10000916
278 Ga0070709_10086079
279 Ga0070709_10343774
280 Ga0070714_100240943
281 Ga0070713_100014769
282 Ga0070713_100375729
283 Ga0070710_10196815
284 Ga0070711_101104619
285 Ga0070711_101107573
286 Ga0070705_100030416
287 Ga0070694_100055742
288 Ga0070694_100744280
289 Ga0070708_100000636
290 Ga0070663_100007301
291 Ga0070681_10061039
292 Ga0070681_10192294
293 Ga0070681_10790714
294 Ga0070706_100016664
295 Ga0070706_100018522
296 Ga0070707_100022845
297 Ga0070707_100405364
298 Ga0070698_100043464
299 Ga0070699_100059722
300 Ga0070699_100512754
301 Ga0070699_100695783
302 Ga0070679_100072964
303 Ga0070679_100135583
304 Ga0070679_100635459
305 Ga0070684_100296118
306 Ga0070697_100000243
307 Ga0070695_100002693
308 Ga0070695_100033427
309 Ga0070695_101088365
310 Ga0070696_100001584
311 Ga0070693_100000115
312 Ga0070704_100043755
313 Ga0068855_100006351
314 Ga0068855_100018098
315 Ga0068855_100888487
316 Ga0070664_101913845
317 Ga0068857_100189706
318 Ga0068854_100177275
319 Ga0068856_100010570
320 Ga0068856_100090038
321 Ga0068852_100747101
322 Ga0068859_100162126
323 Ga0068859_100339755
324 Ga0081455_10375200
325 Ga0070717_10004198
326 Ga0070717_10006397
327 Ga0070717_10027569
328 Ga0070717_10573594
329 Ga0070715_10856636
330 Ga0070716_101406593
331 Ga0097620_100162113
332 Ga0097620_100339719
333 Ga0105240_10011624
334 Ga0105240_10193656
335 Ga0105240_11274018
336 Ga0111539_11593944
337 Ga0105245_12616778
338 Ga0105241_11676350
339 Ga0105237_11208349
340 Ga0105238_10028824
341 Ga0099796_10095269
342 Ga0157373_10174341
343 Ga0157373_11447034
344 Ga0157370_10005390
345 Ga0157370_10450874
346 Ga0157370_10771944
347 Ga0157369_10011660
348 Ga0163162_13359116
349 Ga0157372_10015071
350 Ga0157372_10170403
351 Ga0157372_11938189
352 Ga0157380_10750596
353 Ga0157376_11723275
354 Ga0213873_10126848
355 Ga0213873_10150606
356 Ga0213872_10000604
357 Ga0213872_10282573
358 Ga0213874_10404528
359 Ga0213876_10017227
360 Ga0213875_10003744
361 Ga0213875_10010950
362 Ga0213875_10042727
363 Ga0213875_10058730
364 Ga0213875_10185093
365 Ga0213875_10241009
366 Ga0213875_10363864
367 Ga0213875_10631091
368 Ga0213871_10002892
369 Ga0209258_100110
370 Ga0209759_1000323
371 Ga0209759_1005890
372 Ga0209455_1000104
373 Ga0207653_10002742
374 Ga0207685_10574060
375 Ga0207699_10281488
376 Ga0207699_10379195
377 Ga0207699_11244285
378 Ga0207684_10013882
379 Ga0207707_10037245
380 Ga0207707_10116408
381 Ga0207707_10226001
382 Ga0207695_10002661
383 Ga0207695_10065009
384 Ga0207695_10515396
385 Ga0207695_10603426
386 Ga0207695_10804846
387 Ga0207671_10259901
388 Ga0207663_10814055
389 Ga0207660_10866657
390 Ga0207657_10178079
391 Ga0207657_10206855
392 Ga0207652_10038041
393 Ga0207652_10109512
394 Ga0207652_10537497
395 Ga0207646_10027699
396 Ga0207646_10208370
397 Ga0207687_11331626
398 Ga0207700_10047696
399 Ga0207700_10455709
400 Ga0207664_10026342
401 Ga0207664_10220650
402 Ga0207690_10365256
403 Ga0207686_10846276
404 Ga0207709_11615187
405 Ga0207711_10238807
406 Ga0207667_10009749
407 Ga0207667_10043605
408 Ga0207640_10604300
409 Ga0207639_12186363
410 Ga0207678_10009976
411 Ga0207702_10074058
412 Ga0207702_10150008
413 Ga0207648_11382162
414 Ga0207698_10004753
415 Ga0268264_11697718
416 Ga0265338_10972537
417 Ga0265770_1135959
418 Ga0265770_1139135
419 Ga0265330_10120594
420 Ga0265328_10012212
421 Ga0265328_10199444
422 Ga0265339_10000026
423 Ga0265316_10452949
424 Ga0265314_10291829
425 Ga0265342_10001312
426 Ga0307413_11260364
427 Ga0373954_0133329
428 Ga0373955_0155967
429 Ga0373937_0989007
430 Ga0395899_0998471
431 Ga0395900_1774206
432 Ga0395898_0243770
433 Ga0395898_1904134
434 Ga0436364_0093671
435 Ga0436364_0525588
436 Ga0436364_0633612
437 Ga0436364_0723592
438 Ga0436364_0791089
439 Ga0436364_0856964
440 Ga0436364_0882204
441 Ga0436364_0950501
442 Ga0436364_1334562
443 Ga0436364_1495544
444 Ga0436364_1536279
445 Ga0395901_0859683
446 Ga0436365_0432110
447 Ga0436365_1190398
448 Ga0436365_1393682
449 Ga0436365_1743357
450 Ga0436360_0206427
451 Ga0436360_1087261
452 Ga0436361_0434431
453 Ga0436361_0859300
454 Ga0436361_1113307
455 Ga0436363_0097113
456 Ga0436363_0223382
457 Ga0436363_0264917
458 Ga0436362_0803212
459 Ga0436362_1016565
460 Ga0436362_1229735
461 Ga0466963_0601791
462 Ga0466971_0246300
463 Ga0466957_0676713
464 Ga0466959_0807672
465 Ga0466967_0141783
466 Ga0495651_0292527
467 Ga0495580_0032758
468 Ga0495580_0602166
469 Ga0495582_0535278
470 Ga0495606_0003697
471 Ga0495618_0611225
472 Ga0495648_0281148
473 Ga0495587_0081578
474 Ga0495635_0461346
475 Ga0495599_0041903
476 Ga0495669_0061584
477 Ga0495649_0000946
478 Ga0495674_0047366
479 Ga0495684_0044933
480 Ga0495684_0330068
481 Ga0495602_0494407
482 Ga0496126_0216166
483 Ga0496126_1365767
484 Ga0501303_056882
485 Ga0501031_0018109
486 Ga0501032_0006794
487 Ga0501033_0003571
488 Ga0501034_0059841
489 Ga0501036_0000295
490 Ga0501037_0012282
491 Ga0501038_0001014
492 Ga0501039_0004528
493 Ga0501040_0653552
494 Ga0501043_0002917
495 Ga0501046_0020245
496 Ga0501048_0035094
497 Ga0501067_0100151
498 Ga0501068_0001097
499 Ga0501069_0000735
500 Ga0501072_0003952
501 Ga0501072_0806432
502 Ga0501073_0120212
503 Ga0501074_0004689
504 Ga0501076_0233785
505 Ga0501077_0003719
506 Ga0501206_025139
507 Ga0501217_082587
508 Ga0501222_080016
509 Ga0501249_041952
510 Ga0501079_0001799
511 Ga0501080_0000017
512 Ga0501083_0427753
513 Ga0501268_021273
514 Ga0501270_045788
515 Ga0501035_0150945
516 Ga0501044_0073554
517 Ga0501045_0148419
518 Ga0501212_091237
519 Ga0500635_0012913
520 Ga0495619_0811637
521 Ga0500578_0206219
522 Ga0500581_392310
523 Ga0500652_230543
524 Ga0500564_125044
525 Ga0500636_0006634
526 Ga0501084_0098995
527 Ga0587066_206141
528 Ga0501082_0161275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map