F372611

General Info

Members Datasets Scaffolds Average Seq Length
264 130 528 225

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10096191|Ga0157374_100961912
Length 265
Sequence VIRGSILASFSVFRGCPFGHLIGIDIRVPASSSGVVKLEEARSEMDANVVEIELTLISIIQGVALTFLIERARDVASLKDAIYWPYVVSGLLVIFVFWSRSVLHIITVIRWPLEFGHNFLYITCALVEAVLFTNLTNPAAWFGLGAVFGAVGWILFTYDLKLIRAREIDSPGPASNQLIAIVRKDQLMNITFLVPGVAVCNLLCFFCLRLWPGFFVNRNFHVLLALAQCVGFSIYLSYVIRHFRTVAPLVARARAEWRTTPEPQT

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.58
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 18.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10096191 3300013296 Bacteria 2832
2 JGI25406J46586_10000146 3300003203 Bacteria 30853
3 JGI25405J52794_10001892 3300003911 Bacteria 3535
4 Ga0065704_10003026 3300005289 Bacteria 9226
5 Ga0065704_10021050 3300005289 Unclassified 1510
6 Ga0065712_10110896 3300005290 Bacteria 1819
7 Ga0065712_10121929 3300005290 Bacteria 1658
8 Ga0065712_10185027 3300005290 Unclassified 1174
9 Ga0065715_10003558 3300005293 Bacteria 6167
10 Ga0065715_10206803 3300005293 Bacteria 1274
11 Ga0065707_10014122 3300005295 Bacteria 1781
12 Ga0065707_10235965 3300005295 Bacteria 1172
13 Ga0070676_10069593 3300005328 Bacteria 2109
14 Ga0070676_10312652 3300005328 Bacteria 1069
15 Ga0070690_100017894 3300005330 Bacteria 4272
16 Ga0070670_100306506 3300005331 Bacteria 1390
17 Ga0070677_10089810 3300005333 Bacteria 1334
18 Ga0068868_100014482 3300005338 Bacteria 5813
19 Ga0070660_100437807 3300005339 Unclassified 1084
20 Ga0070668_100207721 3300005347 Bacteria 1609
21 Ga0070669_100018028 3300005353 Bacteria 5043
22 Ga0070675_100041926 3300005354 Bacteria 3739
23 Ga0070675_100113214 3300005354 Bacteria 2298
24 Ga0070675_100141890 3300005354 Bacteria 2054
25 Ga0070671_100068684 3300005355 Unclassified 2956
26 Ga0070671_100112961 3300005355 Bacteria 2282
27 Ga0070671_100199527 3300005355 Bacteria 1696
28 Ga0070671_100528974 3300005355 Bacteria 1016
29 Ga0070674_100000828 3300005356 Bacteria 15979
30 Ga0070674_100343211 3300005356 Bacteria 1204
31 Ga0070674_100478899 3300005356 Bacteria 1033
32 Ga0070673_100226151 3300005364 Bacteria 1622
33 Ga0070688_100051890 3300005365 Bacteria 2560
34 Ga0070667_100027619 3300005367 Bacteria 4722
35 Ga0070709_10127774 3300005434 Bacteria 1731
36 Ga0070714_100030216 3300005435 Unclassified 4508
37 Ga0070714_100194074 3300005435 Bacteria 1855
38 Ga0070711_100002450 3300005439 Bacteria 10589
39 Ga0070711_100248241 3300005439 Unclassified 1395
40 Ga0070711_100278981 3300005439 Bacteria 1321
41 Ga0070705_100351774 3300005440 Bacteria 1074
42 Ga0070708_100009894 3300005445 Bacteria 7705
43 Ga0070708_100086879 3300005445 Bacteria 2841
44 Ga0070708_100176485 3300005445 Unclassified 1996
45 Ga0070708_100195443 3300005445 Unclassified 1893
46 Ga0070708_100333330 3300005445 Unclassified 1430
47 Ga0070708_100370285 3300005445 Unclassified 1350
48 Ga0070663_100823267 3300005455 Unclassified 797
49 Ga0070678_100409037 3300005456 Bacteria 1180
50 Ga0070678_100803824 3300005456 Bacteria 854
51 Ga0070662_100043158 3300005457 Bacteria 3224
52 Ga0070662_100088934 3300005457 Bacteria 2316
53 Ga0070706_100008220 3300005467 Bacteria 9731
54 Ga0070706_100028851 3300005467 Bacteria 5111
55 Ga0070706_100029134 3300005467 Bacteria 5087
56 Ga0070706_100034147 3300005467 Bacteria 4697
57 Ga0070706_100078870 3300005467 Bacteria 3048
58 Ga0070706_100093326 3300005467 Bacteria 2793
59 Ga0070707_100001401 3300005468 Bacteria 23671
60 Ga0070707_100015183 3300005468 Bacteria 7227
61 Ga0070707_100024312 3300005468 Bacteria 5737
62 Ga0070707_100051121 3300005468 Bacteria 3962
63 Ga0070707_100051522 3300005468 Bacteria 3946
64 Ga0070707_100052560 3300005468 Unclassified 3907
65 Ga0070707_100077066 3300005468 Bacteria 3216
66 Ga0070707_100200641 3300005468 Bacteria 1944
67 Ga0070707_100332352 3300005468 Unclassified 1476
68 Ga0070698_100002012 3300005471 Bacteria 22587
69 Ga0070698_100006952 3300005471 Bacteria 12251
70 Ga0070698_100041989 3300005471 Bacteria 4693
71 Ga0070698_100112407 3300005471 Bacteria 2689
72 Ga0070698_100731519 3300005471 Unclassified 932
73 Ga0070699_100052630 3300005518 Unclassified 3522
74 Ga0070699_100103642 3300005518 Bacteria 2495
75 Ga0070699_100112746 3300005518 Unclassified 2389
76 Ga0070697_100008932 3300005536 Bacteria 7829
77 Ga0070697_100009527 3300005536 Bacteria 7591
78 Ga0070697_100014302 3300005536 Bacteria 6237
79 Ga0070697_100024041 3300005536 Bacteria 4850
80 Ga0070697_100147801 3300005536 Bacteria 1979
81 Ga0070697_100174603 3300005536 Bacteria 1820
82 Ga0070697_100182956 3300005536 Bacteria 1777
83 Ga0070697_100328575 3300005536 Bacteria 1318
84 Ga0070697_100621258 3300005536 Bacteria 950
85 Ga0070672_100007817 3300005543 Bacteria 7295
86 Ga0070686_100441829 3300005544 Bacteria 998
87 Ga0070686_100496988 3300005544 Unclassified 946
88 Ga0070695_100103527 3300005545 Bacteria 1921
89 Ga0070695_100151223 3300005545 Unclassified 1620
90 Ga0070696_100011097 3300005546 Bacteria 6029
91 Ga0070665_100478178 3300005548 Bacteria 1256
92 Ga0070665_100539097 3300005548 Bacteria 1179
93 Ga0070704_100120475 3300005549 Bacteria 2015
94 Ga0068856_100090499 3300005614 Bacteria 3043
95 Ga0070702_100365546 3300005615 Unclassified 1021
96 Ga0068866_10348881 3300005718 Unclassified 940
97 Ga0081455_10003460 3300005937 Bacteria 18150
98 Ga0081455_10003933 3300005937 Bacteria 16892
99 Ga0081455_10029059 3300005937 Bacteria 5044
100 Ga0081455_10139759 3300005937 Bacteria 1882
101 Ga0081538_10018446 3300005981 Bacteria 5239
102 Ga0081539_10001678 3300005985 Bacteria 35835
103 Ga0070717_10009782 3300006028 Bacteria 7220
104 Ga0070717_10083788 3300006028 Unclassified 2682
105 Ga0070717_10101088 3300006028 Bacteria 2448
106 Ga0070717_10510626 3300006028 Unclassified 1087
107 Ga0070715_10131129 3300006163 Bacteria 1206
108 Ga0070716_100064111 3300006173 Bacteria 2135
109 Ga0070716_100157223 3300006173 Unclassified 1469
110 Ga0070712_100009266 3300006175 Bacteria 6201
111 Ga0070712_100307759 3300006175 Bacteria 1284
112 Ga0070712_100313383 3300006175 Bacteria 1274
113 Ga0070712_100446150 3300006175 Bacteria 1076
114 Ga0070712_100600370 3300006175 Unclassified 932
115 Ga0070712_100707148 3300006175 Bacteria 859
116 Ga0075433_10195420 3300006852 Bacteria 1800
117 Ga0075434_100531815 3300006871 Bacteria 1196
118 Ga0075434_100574967 3300006871 Bacteria 1146
119 Ga0068865_100007514 3300006881 Bacteria 6705
120 Ga0075436_100075920 3300006914 Unclassified 2327
121 Ga0075436_100265964 3300006914 Bacteria 1224
122 Ga0075435_100124688 3300007076 Bacteria 2152
123 Ga0075435_100393015 3300007076 Unclassified 1192
124 Ga0105245_10006778 3300009098 Bacteria 10042
125 Ga0105245_10022509 3300009098 Bacteria 5532
126 Ga0114129_10000992 3300009147 Bacteria 37127
127 Ga0105241_10520719 3300009174 Bacteria 1063
128 Ga0105242_10019359 3300009176 Bacteria 5333
129 Ga0099796_10003024 3300010159 Bacteria 3820
130 Ga0105239_10428169 3300010375 Bacteria 1500
131 Ga0157371_10021586 3300013102 Bacteria 4726
132 Ga0157374_10015278 3300013296 Bacteria 6732
133 Ga0157374_10132819 3300013296 Unclassified 2410
134 Ga0157374_10175591 3300013296 Bacteria 2091
135 Ga0157374_10611261 3300013296 Bacteria 1100
136 Ga0157378_10119158 3300013297 Bacteria 2431
137 Ga0157378_10143623 3300013297 Bacteria 2218
138 Ga0157378_10172257 3300013297 Bacteria 2031
139 Ga0157378_10255166 3300013297 Bacteria 1680
140 Ga0163162_10008422 3300013306 Bacteria 10056
141 Ga0163162_10017405 3300013306 Bacteria 7030
142 Ga0157372_10013865 3300013307 Bacteria 8608
143 Ga0157375_10286879 3300013308 Bacteria 1809
144 Ga0157375_10317485 3300013308 Bacteria 1722
145 Ga0157375_11051580 3300013308 Bacteria 952
146 Ga0163163_10314121 3300014325 Bacteria 1620
147 Ga0163161_10001918 3300017792 Bacteria 15189
148 Ga0213872_10002631 3300021361 Bacteria 10437
149 Ga0213876_10000751 3300021384 Bacteria 22428
150 Ga0213876_10128969 3300021384 Unclassified 1344
151 Ga0207697_10000303 3300025315 Bacteria 27542
152 Ga0207697_10000939 3300025315 Bacteria 16416
153 Ga0207645_10001206 3300025907 Bacteria 21314
154 Ga0207645_10142210 3300025907 Bacteria 1564
155 Ga0207684_10011380 3300025910 Bacteria 7787
156 Ga0207684_10043404 3300025910 Bacteria 3812
157 Ga0207684_10044349 3300025910 Bacteria 3770
158 Ga0207684_10045820 3300025910 Bacteria 3709
159 Ga0207684_10191956 3300025910 Bacteria 1762
160 Ga0207684_10203387 3300025910 Bacteria 1708
161 Ga0207684_10232063 3300025910 Bacteria 1592
162 Ga0207684_10258218 3300025910 Bacteria 1503
163 Ga0207684_10259121 3300025910 Bacteria 1500
164 Ga0207693_10001222 3300025915 Bacteria 22910
165 Ga0207693_10011506 3300025915 Bacteria 7155
166 Ga0207693_10087050 3300025915 Bacteria 2448
167 Ga0207663_10040706 3300025916 Bacteria 2827
168 Ga0207663_10062148 3300025916 Bacteria 2373
169 Ga0207663_10202558 3300025916 Unclassified 1433
170 Ga0207657_10295568 3300025919 Unclassified 1284
171 Ga0207646_10000386 3300025922 Bacteria 59216
172 Ga0207646_10000411 3300025922 Bacteria 57429
173 Ga0207646_10001992 3300025922 Bacteria 24543
174 Ga0207646_10027680 3300025922 Bacteria 5167
175 Ga0207646_10163024 3300025922 Unclassified 2012
176 Ga0207646_10177193 3300025922 Bacteria 1926
177 Ga0207646_10368182 3300025922 Unclassified 1298
178 Ga0207646_10427466 3300025922 Unclassified 1195
179 Ga0207646_10510448 3300025922 Bacteria 1083
180 Ga0207659_10005255 3300025926 Bacteria 7841
181 Ga0207664_10176546 3300025929 Bacteria 1832
182 Ga0207644_10026780 3300025931 Bacteria 3978
183 Ga0207644_10129585 3300025931 Bacteria 1930
184 Ga0207706_10002165 3300025933 Bacteria 19175
185 Ga0207686_10232497 3300025934 Bacteria 1337
186 Ga0207665_10009575 3300025939 Bacteria 6362
187 Ga0207665_10074944 3300025939 Bacteria 2317
188 Ga0207665_10160742 3300025939 Bacteria 1615
189 Ga0207665_10179882 3300025939 Unclassified 1531
190 Ga0207665_10429454 3300025939 Unclassified 1011
191 Ga0207691_10002024 3300025940 Bacteria 19846
192 Ga0207691_10342599 3300025940 Bacteria 1279
193 Ga0207651_10131193 3300025960 Bacteria 1919
194 Ga0207668_10001336 3300025972 Bacteria 14648
195 Ga0207677_10037656 3300026023 Bacteria 3163
196 Ga0207677_10164569 3300026023 Bacteria 1727
197 Ga0207702_10136567 3300026078 Bacteria 2213
198 Ga0207683_10017593 3300026121 Bacteria 6094
199 Ga0207683_10051335 3300026121 Bacteria 3613
200 Ga0268266_10402227 3300028379 Bacteria 1295
201 Ga0268266_10742658 3300028379 Unclassified 947
202 Ga0373939_0068246 3300035114 Unclassified 1151
203 Ga0373931_0058998 3300035691 Bacteria 2063
204 Ga0373935_0300545 3300035692 Bacteria 1134
205 Ga0373933_0298397 3300035724 Unclassified 1043
206 Ga0373947_0114192 3300035725 Bacteria 1710
207 Ga0373947_0150354 3300035725 Bacteria 1499
208 Ga0373937_0252629 3300036401 Bacteria 1662
209 Ga0373925_0022759 3300037068 Bacteria 4573
210 Ga0373925_0761272 3300037068 Bacteria 798
211 Ga0395899_0128069 3300037312 Bacteria 1815
212 Ga0395900_0019736 3300037418 Bacteria 6870
213 Ga0395900_0019812 3300037418 Bacteria 6855
214 Ga0395900_0763447 3300037418 Unclassified 897
215 Ga0395898_0016462 3300037466 Bacteria 7567
216 Ga0395898_0105297 3300037466 Bacteria 2705
217 Ga0395905_0206456 3300037471 Bacteria 1841
218 Ga0395905_0443347 3300037471 Unclassified 1196
219 Ga0395905_0678418 3300037471 Unclassified 933
220 Ga0436364_0196404 3300037853 Bacteria 1843
221 Ga0395901_0110488 3300038443 Bacteria 2886
222 Ga0395901_0123014 3300038443 Bacteria 2727
223 Ga0395901_0964850 3300038443 Unclassified 830
224 Ga0436365_0653208 3300039437 Bacteria 1123
225 Ga0436365_0825468 3300039437 Unclassified 1150
226 Ga0436365_1132176 3300039437 Bacteria 7005
227 Ga0436365_1676478 3300039437 Unclassified 1891
228 Ga0436360_0645529 3300039438 Unclassified 986
229 Ga0436361_1001661 3300039447 Bacteria 1793
230 Ga0436361_1087123 3300039447 Bacteria 7822
231 Ga0436363_1679959 3300039450 Bacteria 6610
232 Ga0436362_0831703 3300039453 Unclassified 958
233 Ga0495580_0388447 3300046472 Bacteria 942
234 Ga0495684_0444819 3300047471 Unclassified 902
235 Ga0496101_0207321 3300048904 Bacteria 1517
236 Ga0496102_0009374 3300048905 Bacteria 8409
237 Ga0496103_0285120 3300048906 Bacteria 1062
238 Ga0496104_0149045 3300048907 Bacteria 2246
239 Ga0496105_0446316 3300048908 Bacteria 1022
240 Ga0496106_0026129 3300048909 Bacteria 4344
241 Ga0496107_0005807 3300048910 Bacteria 8448
242 Ga0496108_0309598 3300048911 Bacteria 1376
243 Ga0496109_0269451 3300048912 Bacteria 1604
244 Ga0496109_0291805 3300048912 Bacteria 1538
245 Ga0496111_0094668 3300048914 Bacteria 2191
246 Ga0496111_0351703 3300048914 Bacteria 1091
247 Ga0496112_0197249 3300048915 Bacteria 1973
248 Ga0496112_0547912 3300048915 Bacteria 1091
249 Ga0496112_0904558 3300048915 Bacteria 804
250 Ga0496112_1027368 3300048915 Bacteria 744
251 Ga0496113_0034049 3300048916 Bacteria 3714
252 Ga0496113_0664079 3300048916 Bacteria 833
253 Ga0496114_0042934 3300048917 Bacteria 3749
254 Ga0496115_0008228 3300048918 Bacteria 7706
255 Ga0501044_0379703 3300049823 Unclassified 1328
256 nmdc:mga05p37_56695_c1 3300050507 Bacteria 4824
257 nmdc:mga0n895_1039232_c1 3300050512 Bacteria 799
258 nmdc:mga0n895_550626_c1 3300050512 Bacteria 1159
259 nmdc:mga0rr50_173712_c1 3300050513 Bacteria 1757
260 nmdc:mga0rr50_524605_c1 3300050513 Bacteria 1008
261 nmdc:mga08x19_298396_c1 3300050514 Bacteria 1119
262 nmdc:mga08x19_63558_c1 3300050514 Unclassified 2395
263 nmdc:mga0a205_330743_c1 3300050515 Bacteria 1393
264 nmdc:mga0a205_410359_c1 3300050515 Unclassified 1217
265 Ga0157374_10096191
266 JGI25406J46586_10000146
267 JGI25405J52794_10001892
268 Ga0065704_10003026
269 Ga0065704_10021050
270 Ga0065712_10110896
271 Ga0065712_10121929
272 Ga0065712_10185027
273 Ga0065715_10003558
274 Ga0065715_10206803
275 Ga0065707_10014122
276 Ga0065707_10235965
277 Ga0070676_10069593
278 Ga0070676_10312652
279 Ga0070690_100017894
280 Ga0070670_100306506
281 Ga0070677_10089810
282 Ga0068868_100014482
283 Ga0070660_100437807
284 Ga0070668_100207721
285 Ga0070669_100018028
286 Ga0070675_100041926
287 Ga0070675_100113214
288 Ga0070675_100141890
289 Ga0070671_100068684
290 Ga0070671_100112961
291 Ga0070671_100199527
292 Ga0070671_100528974
293 Ga0070674_100000828
294 Ga0070674_100343211
295 Ga0070674_100478899
296 Ga0070673_100226151
297 Ga0070688_100051890
298 Ga0070667_100027619
299 Ga0070709_10127774
300 Ga0070714_100030216
301 Ga0070714_100194074
302 Ga0070711_100002450
303 Ga0070711_100248241
304 Ga0070711_100278981
305 Ga0070705_100351774
306 Ga0070708_100009894
307 Ga0070708_100086879
308 Ga0070708_100176485
309 Ga0070708_100195443
310 Ga0070708_100333330
311 Ga0070708_100370285
312 Ga0070663_100823267
313 Ga0070678_100409037
314 Ga0070678_100803824
315 Ga0070662_100043158
316 Ga0070662_100088934
317 Ga0070706_100008220
318 Ga0070706_100028851
319 Ga0070706_100029134
320 Ga0070706_100034147
321 Ga0070706_100078870
322 Ga0070706_100093326
323 Ga0070707_100001401
324 Ga0070707_100015183
325 Ga0070707_100024312
326 Ga0070707_100051121
327 Ga0070707_100051522
328 Ga0070707_100052560
329 Ga0070707_100077066
330 Ga0070707_100200641
331 Ga0070707_100332352
332 Ga0070698_100002012
333 Ga0070698_100006952
334 Ga0070698_100041989
335 Ga0070698_100112407
336 Ga0070698_100731519
337 Ga0070699_100052630
338 Ga0070699_100103642
339 Ga0070699_100112746
340 Ga0070697_100008932
341 Ga0070697_100009527
342 Ga0070697_100014302
343 Ga0070697_100024041
344 Ga0070697_100147801
345 Ga0070697_100174603
346 Ga0070697_100182956
347 Ga0070697_100328575
348 Ga0070697_100621258
349 Ga0070672_100007817
350 Ga0070686_100441829
351 Ga0070686_100496988
352 Ga0070695_100103527
353 Ga0070695_100151223
354 Ga0070696_100011097
355 Ga0070665_100478178
356 Ga0070665_100539097
357 Ga0070704_100120475
358 Ga0068856_100090499
359 Ga0070702_100365546
360 Ga0068866_10348881
361 Ga0081455_10003460
362 Ga0081455_10003933
363 Ga0081455_10029059
364 Ga0081455_10139759
365 Ga0081538_10018446
366 Ga0081539_10001678
367 Ga0070717_10009782
368 Ga0070717_10083788
369 Ga0070717_10101088
370 Ga0070717_10510626
371 Ga0070715_10131129
372 Ga0070716_100064111
373 Ga0070716_100157223
374 Ga0070712_100009266
375 Ga0070712_100307759
376 Ga0070712_100313383
377 Ga0070712_100446150
378 Ga0070712_100600370
379 Ga0070712_100707148
380 Ga0075433_10195420
381 Ga0075434_100531815
382 Ga0075434_100574967
383 Ga0068865_100007514
384 Ga0075436_100075920
385 Ga0075436_100265964
386 Ga0075435_100124688
387 Ga0075435_100393015
388 Ga0105245_10006778
389 Ga0105245_10022509
390 Ga0114129_10000992
391 Ga0105241_10520719
392 Ga0105242_10019359
393 Ga0099796_10003024
394 Ga0105239_10428169
395 Ga0157371_10021586
396 Ga0157374_10015278
397 Ga0157374_10132819
398 Ga0157374_10175591
399 Ga0157374_10611261
400 Ga0157378_10119158
401 Ga0157378_10143623
402 Ga0157378_10172257
403 Ga0157378_10255166
404 Ga0163162_10008422
405 Ga0163162_10017405
406 Ga0157372_10013865
407 Ga0157375_10286879
408 Ga0157375_10317485
409 Ga0157375_11051580
410 Ga0163163_10314121
411 Ga0163161_10001918
412 Ga0213872_10002631
413 Ga0213876_10000751
414 Ga0213876_10128969
415 Ga0207697_10000303
416 Ga0207697_10000939
417 Ga0207645_10001206
418 Ga0207645_10142210
419 Ga0207684_10011380
420 Ga0207684_10043404
421 Ga0207684_10044349
422 Ga0207684_10045820
423 Ga0207684_10191956
424 Ga0207684_10203387
425 Ga0207684_10232063
426 Ga0207684_10258218
427 Ga0207684_10259121
428 Ga0207693_10001222
429 Ga0207693_10011506
430 Ga0207693_10087050
431 Ga0207663_10040706
432 Ga0207663_10062148
433 Ga0207663_10202558
434 Ga0207657_10295568
435 Ga0207646_10000386
436 Ga0207646_10000411
437 Ga0207646_10001992
438 Ga0207646_10027680
439 Ga0207646_10163024
440 Ga0207646_10177193
441 Ga0207646_10368182
442 Ga0207646_10427466
443 Ga0207646_10510448
444 Ga0207659_10005255
445 Ga0207664_10176546
446 Ga0207644_10026780
447 Ga0207644_10129585
448 Ga0207706_10002165
449 Ga0207686_10232497
450 Ga0207665_10009575
451 Ga0207665_10074944
452 Ga0207665_10160742
453 Ga0207665_10179882
454 Ga0207665_10429454
455 Ga0207691_10002024
456 Ga0207691_10342599
457 Ga0207651_10131193
458 Ga0207668_10001336
459 Ga0207677_10037656
460 Ga0207677_10164569
461 Ga0207702_10136567
462 Ga0207683_10017593
463 Ga0207683_10051335
464 Ga0268266_10402227
465 Ga0268266_10742658
466 Ga0373939_0068246
467 Ga0373931_0058998
468 Ga0373935_0300545
469 Ga0373933_0298397
470 Ga0373947_0114192
471 Ga0373947_0150354
472 Ga0373937_0252629
473 Ga0373925_0022759
474 Ga0373925_0761272
475 Ga0395899_0128069
476 Ga0395900_0019736
477 Ga0395900_0019812
478 Ga0395900_0763447
479 Ga0395898_0016462
480 Ga0395898_0105297
481 Ga0395905_0206456
482 Ga0395905_0443347
483 Ga0395905_0678418
484 Ga0436364_0196404
485 Ga0395901_0110488
486 Ga0395901_0123014
487 Ga0395901_0964850
488 Ga0436365_0653208
489 Ga0436365_0825468
490 Ga0436365_1132176
491 Ga0436365_1676478
492 Ga0436360_0645529
493 Ga0436361_1001661
494 Ga0436361_1087123
495 Ga0436363_1679959
496 Ga0436362_0831703
497 Ga0495580_0388447
498 Ga0495684_0444819
499 Ga0496101_0207321
500 Ga0496102_0009374
501 Ga0496103_0285120
502 Ga0496104_0149045
503 Ga0496105_0446316
504 Ga0496106_0026129
505 Ga0496107_0005807
506 Ga0496108_0309598
507 Ga0496109_0269451
508 Ga0496109_0291805
509 Ga0496111_0094668
510 Ga0496111_0351703
511 Ga0496112_0197249
512 Ga0496112_0547912
513 Ga0496112_0904558
514 Ga0496112_1027368
515 Ga0496113_0034049
516 Ga0496113_0664079
517 Ga0496114_0042934
518 Ga0496115_0008228
519 Ga0501044_0379703
520 nmdc:mga05p37_56695_c1
521 nmdc:mga0n895_1039232_c1
522 nmdc:mga0n895_550626_c1
523 nmdc:mga0rr50_173712_c1
524 nmdc:mga0rr50_524605_c1
525 nmdc:mga08x19_298396_c1
526 nmdc:mga08x19_63558_c1
527 nmdc:mga0a205_330743_c1
528 nmdc:mga0a205_410359_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l0c-assembly2.cif.gz_D-3 human metavinculin (residues 959-1134) in complex with pip2 0.5478 48 194
4pr9-assembly3.cif.gz_F human vinculin (residues 891-1066) in complex with pip 0.5248 48 206
4pr9-assembly1.cif.gz_A human vinculin (residues 891-1066) in complex with pip 0.5053 48 194
5l0c-assembly2.cif.gz_B human metavinculin (residues 959-1134) in complex with pip2 0.5028 48 194
5l0f-assembly2.cif.gz_B human metavinculin quadruple mutant (residues 959-1134) 0.4964 48 209
ID Description Score Start End Superfamily
af_Q9VEH2_23_247_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6113 69 206 1.20.1070.10
4pr9F00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5248 48 206 1.20.120.230
af_Q22921_1_161_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5208 15 163 1.20.1070.10
af_H2L011_542_722_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5106 33 158 1.20.120.230
af_Q54HR7_1_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5103 38 163 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V5PGJ7-F1-model_v4 Uncharacterized protein 0.9924 2 207 GO:0016020
AF-A0A7V3FLH8-F1-model_v4 Uncharacterized protein 0.9846 2 208 GO:0016020
AF-A0A516V5D5-F1-model_v4 Uncharacterized protein 0.9804 2 205 GO:0016020
AF-A0A2V5RFL1-F1-model_v4 Uncharacterized protein 0.9757 49 205 GO:0016020
AF-A0A2V6GJ56-F1-model_v4 Uncharacterized protein 0.9736 2 163 GO:0016020

Map