F372545

General Info

Members Datasets Scaffolds Average Seq Length
264 160 528 270

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100231259|Ga0075430_1002312592
Length 286
Sequence VTPSTPAARSEQAPPDPVFLATAVEIVLQAGAIQLARRASGFHVDKKGTIDLVTEVDLECERMCRGILGERFPDHDILAEEMSRDPRQPSASKYRWIYDPLDGTTNYAHGLPIFCSSLALQIDGRTDVGAVYDPTRAELFTAERGAGAFLNGQRLHVSAAGELIDAMLVTGFPYDVHKQTADLVTMFAAFLGRARAVRRLGSAALDLCYVAAGRFDGYWEQHLWPWDVAAGALIVTEAGGRVTGMDGSAFDPSAAHLAASNGRVHDAMLDVIAEVGAQQRSLNRTN

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.38
Rhizosphere 99.62
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100231259 3300006846 Bacteria 1533
2 Ga0065714_10082727 3300005288 Bacteria 2290
3 Ga0065712_10072939 3300005290 Bacteria 4560
4 Ga0065715_10105591 3300005293 Unclassified 2865
5 Ga0065715_10140701 3300005293 Bacteria 1858
6 Ga0070676_10082549 3300005328 Bacteria 1953
7 Ga0070683_100026558 3300005329 Bacteria 5216
8 Ga0070690_100021108 3300005330 Bacteria 3973
9 Ga0070690_100115117 3300005330 Unclassified 1799
10 Ga0070670_100202715 3300005331 Bacteria 1724
11 Ga0068869_100470593 3300005334 Bacteria 1045
12 Ga0068869_100493036 3300005334 Unclassified 1022
13 Ga0070666_10212186 3300005335 Unclassified 1364
14 Ga0070666_10379040 3300005335 Unclassified 1015
15 Ga0070689_100010660 3300005340 Bacteria 6556
16 Ga0070689_100147496 3300005340 Unclassified 1896
17 Ga0070687_100017437 3300005343 Bacteria 3301
18 Ga0070687_100257116 3300005343 Bacteria 1088
19 Ga0070669_100003273 3300005353 Bacteria 11639
20 Ga0070669_100067716 3300005353 Bacteria 2634
21 Ga0070675_100030726 3300005354 Bacteria 4338
22 Ga0070675_100166442 3300005354 Bacteria 1899
23 Ga0070675_100330074 3300005354 Bacteria 1349
24 Ga0070673_100004067 3300005364 Bacteria 9211
25 Ga0070673_100457487 3300005364 Bacteria 1149
26 Ga0070688_100004078 3300005365 Bacteria 7579
27 Ga0070688_100026518 3300005365 Bacteria 3443
28 Ga0070688_100040653 3300005365 Bacteria 2851
29 Ga0070688_100136560 3300005365 Bacteria 1661
30 Ga0070703_10028135 3300005406 Bacteria 1679
31 Ga0070714_100013709 3300005435 Bacteria 6501
32 Ga0070701_10000734 3300005438 Bacteria 11634
33 Ga0070701_10026986 3300005438 Bacteria 2808
34 Ga0070705_100000276 3300005440 Bacteria 30782
35 Ga0070705_100034283 3300005440 Bacteria 2836
36 Ga0070705_100293151 3300005440 Bacteria 1162
37 Ga0070694_100008826 3300005444 Bacteria 6174
38 Ga0070694_100011865 3300005444 Bacteria 5405
39 Ga0070694_100176420 3300005444 Bacteria 1578
40 Ga0070694_100180453 3300005444 Bacteria 1561
41 Ga0070694_100535529 3300005444 Bacteria 936
42 Ga0070708_100655541 3300005445 Bacteria 989
43 Ga0070678_100156115 3300005456 Unclassified 1843
44 Ga0068867_100002236 3300005459 Bacteria 13593
45 Ga0068867_100409707 3300005459 Bacteria 1145
46 Ga0068867_100456445 3300005459 Bacteria 1090
47 Ga0070685_10035005 3300005466 Bacteria 2831
48 Ga0070685_10119481 3300005466 Bacteria 1635
49 Ga0070706_100582457 3300005467 Unclassified 1040
50 Ga0070707_100256996 3300005468 Bacteria 1700
51 Ga0070698_100033765 3300005471 Bacteria 5300
52 Ga0070698_100284139 3300005471 Bacteria 1586
53 Ga0070699_100195821 3300005518 Unclassified 1796
54 Ga0070699_100520638 3300005518 Bacteria 1081
55 Ga0070684_100293124 3300005535 Bacteria 1492
56 Ga0070672_100175483 3300005543 Bacteria 1784
57 Ga0070686_100444690 3300005544 Unclassified 995
58 Ga0070695_100000101 3300005545 Bacteria 37427
59 Ga0070696_100001806 3300005546 Bacteria 14044
60 Ga0070704_100001514 3300005549 Bacteria 12530
61 Ga0070704_100145429 3300005549 Bacteria 1857
62 Ga0070664_100069258 3300005564 Bacteria 3018
63 Ga0068857_100012801 3300005577 Bacteria 7312
64 Ga0068856_100092931 3300005614 Bacteria 3002
65 Ga0070702_100012441 3300005615 Bacteria 4265
66 Ga0068859_100002521 3300005617 Bacteria 18586
67 Ga0068859_100043536 3300005617 Bacteria 4512
68 Ga0068859_100321485 3300005617 Bacteria 1641
69 Ga0068864_100006373 3300005618 Bacteria 9671
70 Ga0068864_100069523 3300005618 Bacteria 3061
71 Ga0068861_100007482 3300005719 Bacteria 7486
72 Ga0068870_10002672 3300005840 Bacteria 7468
73 Ga0068863_100282570 3300005841 Unclassified 1608
74 Ga0068858_100041618 3300005842 Bacteria 4259
75 Ga0068858_100563546 3300005842 Bacteria 1103
76 Ga0068860_100763466 3300005843 Bacteria 979
77 Ga0068862_100003532 3300005844 Bacteria 13413
78 Ga0068862_100289166 3300005844 Bacteria 1505
79 Ga0068862_100760207 3300005844 Bacteria 944
80 Ga0081539_10008987 3300005985 Bacteria 8496
81 Ga0081539_10028398 3300005985 Bacteria 3519
82 Ga0070716_100032634 3300006173 Bacteria 2842
83 Ga0097621_100517093 3300006237 Bacteria 1083
84 Ga0068871_100155405 3300006358 Unclassified 1953
85 Ga0075428_100000010 3300006844 Bacteria 213631
86 Ga0075428_100020817 3300006844 Bacteria 7262
87 Ga0075430_100080308 3300006846 Bacteria 2732
88 Ga0075430_100203598 3300006846 Bacteria 1643
89 Ga0075431_100091233 3300006847 Bacteria 3145
90 Ga0075433_10111007 3300006852 Unclassified 2433
91 Ga0075434_100196302 3300006871 Bacteria 2038
92 Ga0075429_100037880 3300006880 Unclassified 4197
93 Ga0075429_100232182 3300006880 Bacteria 1616
94 Ga0075429_100321856 3300006880 Bacteria 1353
95 Ga0068865_100088200 3300006881 Bacteria 2244
96 Ga0097620_100002521 3300006931 Bacteria 18586
97 Ga0097620_100043539 3300006931 Bacteria 4512
98 Ga0097620_100321506 3300006931 Bacteria 1641
99 Ga0111539_10000001 3300009094 Bacteria 1035431
100 Ga0111539_10004734 3300009094 Bacteria 17780
101 Ga0111539_10008265 3300009094 Bacteria 13245
102 Ga0111539_10019411 3300009094 Bacteria 8390
103 Ga0111539_10026153 3300009094 Bacteria 7142
104 Ga0111539_10170925 3300009094 Bacteria 2539
105 Ga0111539_10563391 3300009094 Unclassified 1327
106 Ga0114129_10006934 3300009147 Bacteria 16117
107 Ga0114129_10008010 3300009147 Bacteria 15046
108 Ga0114129_10481248 3300009147 Bacteria 1624
109 Ga0114129_10519826 3300009147 Bacteria 1552
110 Ga0105243_10126486 3300009148 Bacteria 2163
111 Ga0105243_10171053 3300009148 Bacteria 1881
112 Ga0105241_10511496 3300009174 Bacteria 1072
113 Ga0105242_10054402 3300009176 Bacteria 3271
114 Ga0105248_10063926 3300009177 Bacteria 4131
115 Ga0105248_10308823 3300009177 Unclassified 1781
116 Ga0157374_10120472 3300013296 Bacteria 2532
117 Ga0157375_10041486 3300013308 Bacteria 4444
118 Ga0157375_10147551 3300013308 Bacteria 2484
119 Ga0163163_10040617 3300014325 Bacteria 4543
120 Ga0157380_10045407 3300014326 Bacteria 3448
121 Ga0157380_10053324 3300014326 Bacteria 3206
122 Ga0157377_10010193 3300014745 Bacteria 4640
123 Ga0157377_10044710 3300014745 Unclassified 2470
124 Ga0157377_10056201 3300014745 Unclassified 2234
125 Ga0157379_10011022 3300014968 Bacteria 7882
126 Ga0207680_10205106 3300025903 Unclassified 1345
127 Ga0207645_10028491 3300025907 Bacteria 3605
128 Ga0207643_10005814 3300025908 Bacteria 6592
129 Ga0207662_10028350 3300025918 Bacteria 3236
130 Ga0207681_10001955 3300025923 Bacteria 13227
131 Ga0207650_10110417 3300025925 Bacteria 2128
132 Ga0207659_10000688 3300025926 Bacteria 20099
133 Ga0207659_10026455 3300025926 Bacteria 3914
134 Ga0207659_10037169 3300025926 Bacteria 3379
135 Ga0207659_10486677 3300025926 Bacteria 1043
136 Ga0207664_10200921 3300025929 Bacteria 1720
137 Ga0207706_10524333 3300025933 Bacteria 1021
138 Ga0207686_10027147 3300025934 Bacteria 3350
139 Ga0207709_10085485 3300025935 Bacteria 2045
140 Ga0207670_10014285 3300025936 Unclassified 4708
141 Ga0207670_10101691 3300025936 Unclassified 2054
142 Ga0207669_10264694 3300025937 Bacteria 1288
143 Ga0207704_10052063 3300025938 Bacteria 2480
144 Ga0207665_10042404 3300025939 Bacteria 3041
145 Ga0207691_10063617 3300025940 Bacteria 3345
146 Ga0207691_10100174 3300025940 Bacteria 2586
147 Ga0207691_10175595 3300025940 Bacteria 1874
148 Ga0207711_10055597 3300025941 Bacteria 3398
149 Ga0207711_10191313 3300025941 Unclassified 1865
150 Ga0207689_10154476 3300025942 Bacteria 1892
151 Ga0207651_10035624 3300025960 Bacteria 3239
152 Ga0207651_10097172 3300025960 Bacteria 2174
153 Ga0207703_10048059 3300026035 Bacteria 3442
154 Ga0207702_10061832 3300026078 Bacteria 3196
155 Ga0207648_10000447 3300026089 Bacteria 45676
156 Ga0207648_10221853 3300026089 Bacteria 1680
157 Ga0207648_10293598 3300026089 Bacteria 1456
158 Ga0207648_10423659 3300026089 Unclassified 1209
159 Ga0207648_10532573 3300026089 Bacteria 1077
160 Ga0207674_10089616 3300026116 Bacteria 3068
161 Ga0207675_100007739 3300026118 Bacteria 10137
162 Ga0207683_10655724 3300026121 Unclassified 972
163 Ga0209983_1051193 3300027665 Bacteria 904
164 Ga0207428_10000002 3300027907 Bacteria 854851
165 Ga0207428_10001013 3300027907 Bacteria 31161
166 Ga0207428_10024296 3300027907 Bacteria 5091
167 Ga0207428_10093978 3300027907 Bacteria 2325
168 Ga0268266_10137099 3300028379 Bacteria 2193
169 Ga0268265_10000792 3300028380 Bacteria 30109
170 Ga0268265_10398487 3300028380 Bacteria 1271
171 Ga0307405_10006566 3300031731 Bacteria 5732
172 Ga0307413_10110856 3300031824 Bacteria 1837
173 Ga0307410_10001376 3300031852 Bacteria 10938
174 Ga0307407_10009044 3300031903 Bacteria 4616
175 Ga0307412_10111362 3300031911 Bacteria 1955
176 Ga0307409_100059770 3300031995 Bacteria 2968
177 Ga0307416_100008544 3300032002 Bacteria 6617
178 Ga0307411_10046362 3300032005 Bacteria 2801
179 Ga0307415_100130997 3300032126 Bacteria 1898
180 Ga0373925_0131909 3300037068 Bacteria 1949
181 Ga0439442_021053 3300042002 Bacteria 1352
182 Ga0451577_0051997 3300042876 Bacteria 3658
183 Ga0451577_0404669 3300042876 Bacteria 1239
184 Ga0453683_0000665 3300044673 Bacteria 36771
185 Ga0453684_0761214 3300044712 Bacteria 1047
186 Ga0451576_0196779 3300045051 Bacteria 2105
187 Ga0495603_0003984 3300046455 Bacteria 8791
188 Ga0495629_0002858 3300046459 Bacteria 13190
189 Ga0495584_0076616 3300046491 Bacteria 1682
190 Ga0495642_0031014 3300046528 Bacteria 2142
191 Ga0495586_0133099 3300046535 Bacteria 1392
192 Ga0495598_0013190 3300046537 Bacteria 2044
193 Ga0495656_0015234 3300046615 Bacteria 2900
194 Ga0495659_0003083 3300046664 Bacteria 5354
195 Ga0495659_0025905 3300046664 Bacteria 2010
196 Ga0495646_0230770 3300046680 Bacteria 998
197 Ga0495658_0025402 3300046683 Unclassified 3166
198 Ga0495658_0118684 3300046683 Bacteria 1598
199 Ga0495658_0132077 3300046683 Bacteria 1520
200 Ga0495636_0019290 3300047318 Bacteria 2740
201 Ga0495676_0013996 3300047321 Bacteria 7186
202 Ga0495677_0012037 3300047445 Bacteria 3158
203 Ga0495684_0261848 3300047471 Bacteria 1254
204 Ga0496110_0288752 3300048913 Bacteria 1494
205 Ga0501040_0012741 3300049576 Bacteria 5518
206 Ga0501040_0286991 3300049576 Bacteria 1176
207 Ga0501041_0078401 3300049577 Bacteria 2033
208 Ga0501042_0024406 3300049578 Unclassified 4241
209 Ga0501046_0148768 3300049580 Unclassified 1767
210 Ga0501048_0067452 3300049582 Unclassified 2529
211 Ga0501068_0010278 3300049584 Bacteria 5254
212 Ga0501068_0064370 3300049584 Bacteria 2232
213 Ga0501071_0008245 3300049587 Bacteria 6878
214 Ga0501071_0008898 3300049587 Bacteria 6660
215 Ga0501071_0330032 3300049587 Bacteria 1159
216 Ga0501071_0331310 3300049587 Bacteria 1157
217 Ga0501072_0031326 3300049588 Bacteria 4162
218 Ga0501072_0168011 3300049588 Bacteria 1750
219 Ga0501074_0030820 3300049590 Bacteria 3886
220 Ga0501074_0553769 3300049590 Bacteria 814
221 Ga0501075_0023937 3300049591 Bacteria 4473
222 Ga0501075_0439448 3300049591 Bacteria 995
223 Ga0501076_0000562 3300049592 Bacteria 23674
224 Ga0501076_0232686 3300049592 Unclassified 1506
225 Ga0501077_0017502 3300049593 Bacteria 4525
226 Ga0501077_0113108 3300049593 Bacteria 1721
227 Ga0501079_0040060 3300049741 Bacteria 3614
228 Ga0501080_0020011 3300049742 Bacteria 6195
229 Ga0501081_0000246 3300049743 Bacteria 27807
230 Ga0501083_0013003 3300049744 Bacteria 5817
231 Ga0501045_0036928 3300049824 Bacteria 3550
232 nmdc:mga05p37_171489_c1 3300050507 Bacteria 2645
233 nmdc:mga05p37_302502_c1 3300050507 Unclassified 1900
234 nmdc:mga05p37_33805_c1 3300050507 Bacteria 6263
235 nmdc:mga09592_14492_c1 3300050508 Unclassified 4484
236 nmdc:mga0qj67_292938_c1 3300050509 Bacteria 1319
237 nmdc:mga0qj67_72172_c1 3300050509 Bacteria 2756
238 nmdc:mga06r32_12484_c1 3300050510 Bacteria 7667
239 nmdc:mga06r32_722995_c1 3300050510 Bacteria 960
240 nmdc:mga06r32_82119_c1 3300050510 Bacteria 3139
241 nmdc:mga08y16_14594_c1 3300050511 Bacteria 8263
242 nmdc:mga08y16_168231_c1 3300050511 Unclassified 2278
243 nmdc:mga08y16_299539_c1 3300050511 Bacteria 1658
244 nmdc:mga08y16_339328_c1 3300050511 Bacteria 1545
245 nmdc:mga08y16_3783_c1 3300050511 Bacteria 15762
246 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
247 nmdc:mga08y16_68601_c1 3300050511 Bacteria 3697
248 nmdc:mga0n895_28113_c2 3300050512 Bacteria 1538
249 nmdc:mga0a205_101944_c1 3300050515 Bacteria 2769
250 nmdc:mga0a205_144993_c1 3300050515 Bacteria 2274
251 nmdc:mga0a205_473065_c1 3300050515 Bacteria 1112
252 Ga0501084_0002743 3300054114 Bacteria 14212
253 Ga0501084_0017103 3300054114 Bacteria 6024
254 Ga0501084_0365971 3300054114 Bacteria 1218
255 Ga0501084_0388208 3300054114 Bacteria 1180
256 Ga0501084_0587407 3300054114 Bacteria 941
257 Ga0590071_000752 3300059421 Bacteria 9067
258 Ga0590074_000560 3300059423 Bacteria 5557
259 Ga0590075_000724 3300059424 Bacteria 8763
260 Ga0590077_000579 3300059426 Bacteria 10124
261 Ga0501082_0008967 3300060353 Bacteria 8634
262 Ga0501082_0611023 3300060353 Bacteria 954
263 Ga0530510_0013509 3300061734 Bacteria 5742
264 Ga0530510_0068204 3300061734 Unclassified 2580
265 Ga0075430_100231259
266 Ga0065714_10082727
267 Ga0065712_10072939
268 Ga0065715_10105591
269 Ga0065715_10140701
270 Ga0070676_10082549
271 Ga0070683_100026558
272 Ga0070690_100021108
273 Ga0070690_100115117
274 Ga0070670_100202715
275 Ga0068869_100470593
276 Ga0068869_100493036
277 Ga0070666_10212186
278 Ga0070666_10379040
279 Ga0070689_100010660
280 Ga0070689_100147496
281 Ga0070687_100017437
282 Ga0070687_100257116
283 Ga0070669_100003273
284 Ga0070669_100067716
285 Ga0070675_100030726
286 Ga0070675_100166442
287 Ga0070675_100330074
288 Ga0070673_100004067
289 Ga0070673_100457487
290 Ga0070688_100004078
291 Ga0070688_100026518
292 Ga0070688_100040653
293 Ga0070688_100136560
294 Ga0070703_10028135
295 Ga0070714_100013709
296 Ga0070701_10000734
297 Ga0070701_10026986
298 Ga0070705_100000276
299 Ga0070705_100034283
300 Ga0070705_100293151
301 Ga0070694_100008826
302 Ga0070694_100011865
303 Ga0070694_100176420
304 Ga0070694_100180453
305 Ga0070694_100535529
306 Ga0070708_100655541
307 Ga0070678_100156115
308 Ga0068867_100002236
309 Ga0068867_100409707
310 Ga0068867_100456445
311 Ga0070685_10035005
312 Ga0070685_10119481
313 Ga0070706_100582457
314 Ga0070707_100256996
315 Ga0070698_100033765
316 Ga0070698_100284139
317 Ga0070699_100195821
318 Ga0070699_100520638
319 Ga0070684_100293124
320 Ga0070672_100175483
321 Ga0070686_100444690
322 Ga0070695_100000101
323 Ga0070696_100001806
324 Ga0070704_100001514
325 Ga0070704_100145429
326 Ga0070664_100069258
327 Ga0068857_100012801
328 Ga0068856_100092931
329 Ga0070702_100012441
330 Ga0068859_100002521
331 Ga0068859_100043536
332 Ga0068859_100321485
333 Ga0068864_100006373
334 Ga0068864_100069523
335 Ga0068861_100007482
336 Ga0068870_10002672
337 Ga0068863_100282570
338 Ga0068858_100041618
339 Ga0068858_100563546
340 Ga0068860_100763466
341 Ga0068862_100003532
342 Ga0068862_100289166
343 Ga0068862_100760207
344 Ga0081539_10008987
345 Ga0081539_10028398
346 Ga0070716_100032634
347 Ga0097621_100517093
348 Ga0068871_100155405
349 Ga0075428_100000010
350 Ga0075428_100020817
351 Ga0075430_100080308
352 Ga0075430_100203598
353 Ga0075431_100091233
354 Ga0075433_10111007
355 Ga0075434_100196302
356 Ga0075429_100037880
357 Ga0075429_100232182
358 Ga0075429_100321856
359 Ga0068865_100088200
360 Ga0097620_100002521
361 Ga0097620_100043539
362 Ga0097620_100321506
363 Ga0111539_10000001
364 Ga0111539_10004734
365 Ga0111539_10008265
366 Ga0111539_10019411
367 Ga0111539_10026153
368 Ga0111539_10170925
369 Ga0111539_10563391
370 Ga0114129_10006934
371 Ga0114129_10008010
372 Ga0114129_10481248
373 Ga0114129_10519826
374 Ga0105243_10126486
375 Ga0105243_10171053
376 Ga0105241_10511496
377 Ga0105242_10054402
378 Ga0105248_10063926
379 Ga0105248_10308823
380 Ga0157374_10120472
381 Ga0157375_10041486
382 Ga0157375_10147551
383 Ga0163163_10040617
384 Ga0157380_10045407
385 Ga0157380_10053324
386 Ga0157377_10010193
387 Ga0157377_10044710
388 Ga0157377_10056201
389 Ga0157379_10011022
390 Ga0207680_10205106
391 Ga0207645_10028491
392 Ga0207643_10005814
393 Ga0207662_10028350
394 Ga0207681_10001955
395 Ga0207650_10110417
396 Ga0207659_10000688
397 Ga0207659_10026455
398 Ga0207659_10037169
399 Ga0207659_10486677
400 Ga0207664_10200921
401 Ga0207706_10524333
402 Ga0207686_10027147
403 Ga0207709_10085485
404 Ga0207670_10014285
405 Ga0207670_10101691
406 Ga0207669_10264694
407 Ga0207704_10052063
408 Ga0207665_10042404
409 Ga0207691_10063617
410 Ga0207691_10100174
411 Ga0207691_10175595
412 Ga0207711_10055597
413 Ga0207711_10191313
414 Ga0207689_10154476
415 Ga0207651_10035624
416 Ga0207651_10097172
417 Ga0207703_10048059
418 Ga0207702_10061832
419 Ga0207648_10000447
420 Ga0207648_10221853
421 Ga0207648_10293598
422 Ga0207648_10423659
423 Ga0207648_10532573
424 Ga0207674_10089616
425 Ga0207675_100007739
426 Ga0207683_10655724
427 Ga0209983_1051193
428 Ga0207428_10000002
429 Ga0207428_10001013
430 Ga0207428_10024296
431 Ga0207428_10093978
432 Ga0268266_10137099
433 Ga0268265_10000792
434 Ga0268265_10398487
435 Ga0307405_10006566
436 Ga0307413_10110856
437 Ga0307410_10001376
438 Ga0307407_10009044
439 Ga0307412_10111362
440 Ga0307409_100059770
441 Ga0307416_100008544
442 Ga0307411_10046362
443 Ga0307415_100130997
444 Ga0373925_0131909
445 Ga0439442_021053
446 Ga0451577_0051997
447 Ga0451577_0404669
448 Ga0453683_0000665
449 Ga0453684_0761214
450 Ga0451576_0196779
451 Ga0495603_0003984
452 Ga0495629_0002858
453 Ga0495584_0076616
454 Ga0495642_0031014
455 Ga0495586_0133099
456 Ga0495598_0013190
457 Ga0495656_0015234
458 Ga0495659_0003083
459 Ga0495659_0025905
460 Ga0495646_0230770
461 Ga0495658_0025402
462 Ga0495658_0118684
463 Ga0495658_0132077
464 Ga0495636_0019290
465 Ga0495676_0013996
466 Ga0495677_0012037
467 Ga0495684_0261848
468 Ga0496110_0288752
469 Ga0501040_0012741
470 Ga0501040_0286991
471 Ga0501041_0078401
472 Ga0501042_0024406
473 Ga0501046_0148768
474 Ga0501048_0067452
475 Ga0501068_0010278
476 Ga0501068_0064370
477 Ga0501071_0008245
478 Ga0501071_0008898
479 Ga0501071_0330032
480 Ga0501071_0331310
481 Ga0501072_0031326
482 Ga0501072_0168011
483 Ga0501074_0030820
484 Ga0501074_0553769
485 Ga0501075_0023937
486 Ga0501075_0439448
487 Ga0501076_0000562
488 Ga0501076_0232686
489 Ga0501077_0017502
490 Ga0501077_0113108
491 Ga0501079_0040060
492 Ga0501080_0020011
493 Ga0501081_0000246
494 Ga0501083_0013003
495 Ga0501045_0036928
496 nmdc:mga05p37_171489_c1
497 nmdc:mga05p37_302502_c1
498 nmdc:mga05p37_33805_c1
499 nmdc:mga09592_14492_c1
500 nmdc:mga0qj67_292938_c1
501 nmdc:mga0qj67_72172_c1
502 nmdc:mga06r32_12484_c1
503 nmdc:mga06r32_722995_c1
504 nmdc:mga06r32_82119_c1
505 nmdc:mga08y16_14594_c1
506 nmdc:mga08y16_168231_c1
507 nmdc:mga08y16_299539_c1
508 nmdc:mga08y16_339328_c1
509 nmdc:mga08y16_3783_c1
510 nmdc:mga08y16_3_c1
511 nmdc:mga08y16_68601_c1
512 nmdc:mga0n895_28113_c2
513 nmdc:mga0a205_101944_c1
514 nmdc:mga0a205_144993_c1
515 nmdc:mga0a205_473065_c1
516 Ga0501084_0002743
517 Ga0501084_0017103
518 Ga0501084_0365971
519 Ga0501084_0388208
520 Ga0501084_0587407
521 Ga0590071_000752
522 Ga0590074_000560
523 Ga0590075_000724
524 Ga0590077_000579
525 Ga0501082_0008967
526 Ga0501082_0611023
527 Ga0530510_0013509
528 Ga0530510_0068204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

17

278

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhh-assembly1.cif.gz_D structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9672 15 272
5zhh-assembly1.cif.gz_C structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9666 15 271
5zhh-assembly1.cif.gz_B structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9608 15 271
2pcr-assembly1.cif.gz_A crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.9462 15 272
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9406 15 270
ID Description Score Start End Superfamily
af_A0A1D6KWE2_194_310_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9644 175 269 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9639 15 151 3.30.540.10
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9582 153 270 3.40.190.80
af_Q54U72_147_270_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9549 154 269 3.40.190.80
5zhhD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9435 154 269 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A1Q7ALU8-F1-model_v4 inositol-phosphate phosphatase (EC 3.1.3.25) 0.9798 12 277 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A355E5B8-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9746 95 273 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A7S1DV82-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9732 97 273 GO:0006021
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A832CHG0-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9706 22 277 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A6L7KVV5-F1-model_v4 deleted 0.9699 97 272

Map