F372529

General Info

Members Datasets Scaffolds Average Seq Length
264 158 528 142

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100213980|Ga0070712_1002139802
Length 154
Sequence VPSAKISPPLRREFSAGGVLVRRLRGRWVVAAIRPAGKPAGVWALPKGRIDEGERGEATALREVAEETGAHGRSLGKLGDVRYWFAWEGARVFKVVSFFLVRYESGRLGAVPAAFRHEVAEVRWLPLEDAPQLLAYAGEREMAERALARLAEDV

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
69 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 2.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.58
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100213980 3300006175 Bacteria 1521
2 Ga0070658_10017313 3300005327 Bacteria 5768
3 Ga0070658_10480111 3300005327 Bacteria 1073
4 Ga0070658_10636042 3300005327 Bacteria 925
5 Ga0070658_10827160 3300005327 Bacteria 805
6 Ga0070683_100354276 3300005329 Bacteria 1398
7 Ga0070680_100007929 3300005336 Bacteria 8101
8 Ga0070682_100346876 3300005337 Bacteria 1105
9 Ga0070660_100035095 3300005339 Bacteria 3794
10 Ga0070660_100036350 3300005339 Bacteria 3730
11 Ga0070660_100264444 3300005339 Unclassified 1405
12 Ga0070660_100976320 3300005339 Bacteria 715
13 Ga0070660_101718086 3300005339 Bacteria 534
14 Ga0070661_100078934 3300005344 Bacteria 2428
15 Ga0070661_100214281 3300005344 Unclassified 1475
16 Ga0070661_100442202 3300005344 Bacteria 1033
17 Ga0070675_100936132 3300005354 Bacteria 795
18 Ga0070659_101505231 3300005366 Bacteria 600
19 Ga0070708_100263038 3300005445 Unclassified 1622
20 Ga0070706_101317821 3300005467 Bacteria 662
21 Ga0070707_100582120 3300005468 Bacteria 1082
22 Ga0070679_100459767 3300005530 Bacteria 1217
23 Ga0070684_100147393 3300005535 Bacteria 2131
24 Ga0070684_100329303 3300005535 Bacteria 1404
25 Ga0070684_100329967 3300005535 Unclassified 1402
26 Ga0070684_100404108 3300005535 Bacteria 1259
27 Ga0068853_101153628 3300005539 Bacteria 748
28 Ga0068855_100009327 3300005563 Bacteria 11852
29 Ga0068855_100540540 3300005563 Bacteria 1262
30 Ga0068854_100307449 3300005578 Bacteria 1285
31 Ga0068856_100785520 3300005614 Unclassified 972
32 Ga0068852_100402691 3300005616 Bacteria 1346
33 Ga0097621_101513203 3300006237 Archaea 637
34 Ga0068871_100368449 3300006358 Bacteria 1274
35 Ga0075433_10056211 3300006852 Bacteria 3436
36 Ga0075435_100590359 3300007076 Bacteria 963
37 Ga0105240_10168178 3300009093 Bacteria 2599
38 Ga0105240_10499912 3300009093 Unclassified 1352
39 Ga0105245_10913209 3300009098 Bacteria 920
40 Ga0105242_10465543 3300009176 Bacteria 1195
41 Ga0105248_10232932 3300009177 Bacteria 2073
42 Ga0105237_10787153 3300009545 Bacteria 958
43 Ga0157373_10315578 3300013100 Bacteria 1111
44 Ga0157370_10029576 3300013104 Bacteria 5373
45 Ga0157370_10320388 3300013104 Bacteria 1430
46 Ga0157370_11590958 3300013104 Bacteria 587
47 Ga0157369_10009001 3300013105 Bacteria 11437
48 Ga0157369_10016530 3300013105 Bacteria 8296
49 Ga0157369_10093222 3300013105 Bacteria 3215
50 Ga0157369_10391680 3300013105 Bacteria 1441
51 Ga0157374_11613028 3300013296 Bacteria 673
52 Ga0157372_10123850 3300013307 Bacteria 2972
53 Ga0157372_11525423 3300013307 Bacteria 770
54 Ga0157375_11298016 3300013308 Bacteria 856
55 Ga0157375_11409580 3300013308 Bacteria 821
56 Ga0206356_10095339 3300020070 Bacteria 1362
57 Ga0206356_10376018 3300020070 Bacteria 1260
58 Ga0206354_11353067 3300020081 Bacteria 788
59 Ga0206353_10480231 3300020082 Bacteria 2231
60 Ga0206353_11056406 3300020082 Bacteria 801
61 Ga0206353_11083754 3300020082 Bacteria 2292
62 Ga0224712_10559558 3300022467 Unclassified 556
63 Ga0207705_10008397 3300025909 Bacteria 7541
64 Ga0207705_11107280 3300025909 Bacteria 610
65 Ga0207707_10059968 3300025912 Bacteria 3310
66 Ga0207695_10224898 3300025913 Bacteria 1783
67 Ga0207693_10543634 3300025915 Bacteria 906
68 Ga0207663_10426803 3300025916 Bacteria 1018
69 Ga0207657_10019963 3300025919 Bacteria 6347
70 Ga0207657_10144545 3300025919 Bacteria 1941
71 Ga0207657_10225929 3300025919 Bacteria 1498
72 Ga0207649_10634547 3300025920 Bacteria 824
73 Ga0207652_10291416 3300025921 Bacteria 1472
74 Ga0207646_11831064 3300025922 Bacteria 518
75 Ga0207687_10121561 3300025927 Bacteria 1954
76 Ga0207700_10360422 3300025928 Bacteria 1268
77 Ga0207690_10227790 3300025932 Bacteria 1429
78 Ga0207661_10170430 3300025944 Bacteria 1895
79 Ga0207661_10182448 3300025944 Bacteria 1834
80 Ga0207661_10330068 3300025944 Bacteria 1373
81 Ga0207661_10342399 3300025944 Bacteria 1347
82 Ga0207667_10081478 3300025949 Bacteria 3352
83 Ga0207667_10173596 3300025949 Bacteria 2215
84 Ga0207667_10812256 3300025949 Bacteria 931
85 Ga0207640_11000871 3300025981 Bacteria 735
86 Ga0207639_10652006 3300026041 Bacteria 974
87 Ga0207678_10188191 3300026067 Bacteria 1763
88 Ga0207641_10191145 3300026088 Bacteria 1882
89 Ga0207641_10995451 3300026088 Bacteria 835
90 Ga0207674_10204369 3300026116 Bacteria 1925
91 Ga0265326_10047789 3300028558 Bacteria 1213
92 Ga0265319_1017487 3300028563 Bacteria 2726
93 Ga0265319_1138638 3300028563 Bacteria 755
94 Ga0265334_10024157 3300028573 Bacteria 2467
95 Ga0265336_10003007 3300028666 Bacteria 6715
96 Ga0265338_10008857 3300028800 Bacteria 12133
97 Ga0265338_10026938 3300028800 Bacteria 5782
98 Ga0265338_10090415 3300028800 Bacteria 2533
99 Ga0265324_10011167 3300029957 Bacteria 3432
100 Ga0265340_10025589 3300031247 Bacteria 2987
101 Ga0265316_10348830 3300031344 Bacteria 1072
102 Ga0265313_10023057 3300031595 Bacteria 3360
103 Ga0373926_0100494 3300035083 Bacteria 1081
104 Ga0373944_0012629 3300035089 Bacteria 2331
105 Ga0373949_0103994 3300035090 Bacteria 781
106 Ga0373936_0006438 3300035113 Bacteria 4428
107 Ga0373945_0009896 3300035116 Bacteria 3129
108 Ga0373945_0019270 3300035116 Bacteria 2328
109 Ga0373943_0000541 3300035170 Bacteria 16358
110 Ga0373943_0039285 3300035170 Bacteria 2279
111 Ga0373943_0055286 3300035170 Bacteria 1965
112 Ga0373946_0027790 3300035171 Bacteria 2240
113 Ga0373935_0011392 3300035692 Bacteria 5339
114 Ga0373935_0073888 3300035692 Bacteria 2203
115 Ga0373927_0089026 3300035695 Bacteria 2004
116 Ga0373947_0003334 3300035725 Bacteria 9514
117 Ga0373947_0005818 3300035725 Bacteria 7192
118 Ga0373925_0009189 3300037068 Bacteria 7196
119 Ga0373925_0023277 3300037068 Bacteria 4520
120 Ga0373925_0052065 3300037068 Bacteria 3058
121 Ga0395899_0066412 3300037312 Bacteria 2648
122 Ga0395899_0280265 3300037312 Bacteria 1134
123 Ga0395900_0041948 3300037418 Bacteria 4714
124 Ga0395900_0042792 3300037418 Bacteria 4666
125 Ga0395900_0152787 3300037418 Bacteria 2358
126 Ga0395900_0434041 3300037418 Bacteria 1272
127 Ga0395900_0723499 3300037418 Unclassified 927
128 Ga0395900_0757564 3300037418 Bacteria 901
129 Ga0395898_0014716 3300037466 Bacteria 8031
130 Ga0395898_0123804 3300037466 Bacteria 2477
131 Ga0395898_0445001 3300037466 Bacteria 1234
132 Ga0395905_0087027 3300037471 Bacteria 2929
133 Ga0395905_0463539 3300037471 Bacteria 1166
134 Ga0395905_0491970 3300037471 Bacteria 1126
135 Ga0395905_1097500 3300037471 Unclassified 699
136 Ga0395901_0001077 3300038443 Bacteria 29182
137 Ga0395901_0002248 3300038443 Bacteria 19701
138 Ga0395901_0028640 3300038443 Bacteria 5729
139 Ga0395901_0034699 3300038443 Bacteria 5211
140 Ga0395901_0050902 3300038443 Bacteria 4304
141 Ga0395901_0190175 3300038443 Bacteria 2153
142 Ga0436365_0824833 3300039437 Bacteria 587
143 Ga0436363_0163762 3300039450 Bacteria 1702
144 Ga0451853_3278648 3300041512 Bacteria 552
145 Ga0466966_0007848 3300044684 Bacteria 7063
146 Ga0466966_0021161 3300044684 Bacteria 4271
147 Ga0466966_0305544 3300044684 Bacteria 956
148 Ga0466966_0310826 3300044684 Bacteria 947
149 Ga0466961_0075617 3300044693 Bacteria 2135
150 Ga0466961_0352316 3300044693 Bacteria 896
151 Ga0466961_0401023 3300044693 Bacteria 832
152 Ga0466963_0528787 3300044694 Unclassified 833
153 Ga0466971_0063999 3300044719 Bacteria 1665
154 Ga0466971_0383975 3300044719 Unclassified 683
155 Ga0466957_0087093 3300044842 Bacteria 1952
156 Ga0466959_0015402 3300045049 Bacteria 5569
157 Ga0466959_0068565 3300045049 Bacteria 2570
158 Ga0466958_0119628 3300045836 Bacteria 1648
159 Ga0466967_0016430 3300045976 Bacteria 5837
160 Ga0466967_0060780 3300045976 Bacteria 3350
161 Ga0466967_0648132 3300045976 Bacteria 1044
162 Ga0466967_1048907 3300045976 Bacteria 812
163 Ga0466967_1431928 3300045976 Unclassified 688
164 Ga0495592_0626748 3300046454 Unclassified 653
165 Ga0495603_0079828 3300046455 Bacteria 1918
166 Ga0495603_0099070 3300046455 Bacteria 1702
167 Ga0495629_0000403 3300046459 Bacteria 36268
168 Ga0495629_0301352 3300046459 Bacteria 1098
169 Ga0495629_1141824 3300046459 Bacteria 502
170 Ga0495641_0000331 3300046461 Bacteria 38511
171 Ga0495641_0040978 3300046461 Bacteria 2152
172 Ga0495653_0027754 3300046463 Bacteria 4531
173 Ga0495653_0137743 3300046463 Bacteria 1720
174 Ga0495653_0611379 3300046463 Archaea 669
175 Ga0495580_0558332 3300046472 Bacteria 760
176 Ga0495582_0008284 3300046473 Bacteria 5740
177 Ga0495582_0067853 3300046473 Bacteria 1971
178 Ga0495582_0318722 3300046473 Bacteria 894
179 Ga0495639_0000619 3300046475 Bacteria 16494
180 Ga0495639_0363276 3300046475 Unclassified 728
181 Ga0495662_0044119 3300046476 Bacteria 2152
182 Ga0495664_0532690 3300046477 Bacteria 700
183 Ga0495608_0017025 3300046511 Bacteria 5029
184 Ga0495628_0153895 3300046516 Bacteria 1750
185 Ga0495630_0079931 3300046517 Bacteria 2466
186 Ga0495630_0159322 3300046517 Bacteria 1718
187 Ga0495665_0009010 3300046531 Bacteria 5415
188 Ga0495665_0237629 3300046531 Bacteria 940
189 Ga0495640_0019680 3300046533 Bacteria 4979
190 Ga0495640_0255374 3300046533 Bacteria 1096
191 Ga0495586_0609000 3300046535 Bacteria 631
192 Ga0495587_0068870 3300046536 Bacteria 2061
193 Ga0495645_0403760 3300046543 Bacteria 870
194 Ga0495622_0121407 3300046557 Bacteria 1193
195 Ga0495634_0412766 3300046642 Bacteria 800
196 Ga0495635_0103019 3300046663 Bacteria 1950
197 Ga0495635_0139199 3300046663 Bacteria 1653
198 Ga0495599_0105208 3300046678 Bacteria 1758
199 Ga0495647_0003081 3300046681 Bacteria 5326
200 Ga0495658_0000302 3300046683 Bacteria 27945
201 Ga0495658_0298345 3300046683 Bacteria 1019
202 Ga0495613_0002125 3300046689 Bacteria 15035
203 Ga0495613_0396645 3300046689 Bacteria 942
204 Ga0495624_0001304 3300046690 Bacteria 19574
205 Ga0495600_0379157 3300046809 Bacteria 882
206 Ga0495581_0003636 3300047315 Bacteria 8879
207 Ga0495581_0504277 3300047315 Unclassified 703
208 Ga0495604_0093510 3300047317 Bacteria 2224
209 Ga0495604_0339111 3300047317 Bacteria 1001
210 Ga0495674_0124473 3300047319 Bacteria 2176
211 Ga0495674_0200760 3300047319 Bacteria 1654
212 Ga0495676_0000268 3300047321 Bacteria 42236
213 Ga0495676_0126608 3300047321 Bacteria 1850
214 Ga0495676_0140534 3300047321 Bacteria 1731
215 Ga0495680_0009114 3300047322 Bacteria 8956
216 Ga0495680_0045984 3300047322 Bacteria 3444
217 Ga0495675_0139738 3300047444 Bacteria 1502
218 Ga0495684_0087671 3300047471 Bacteria 2358
219 Ga0495684_0487294 3300047471 Bacteria 850
220 Ga0495593_0017901 3300047673 Bacteria 3989
221 Ga0495602_0372265 3300048088 Bacteria 1025
222 Ga0495614_0087296 3300048089 Bacteria 1354
223 Ga0495614_0181915 3300048089 Bacteria 946
224 Ga0496100_0096361 3300048903 Bacteria 2030
225 Ga0496103_0099539 3300048906 Bacteria 1839
226 Ga0496104_0018765 3300048907 Bacteria 6316
227 Ga0496104_0157520 3300048907 Bacteria 2179
228 Ga0496105_0032754 3300048908 Bacteria 4266
229 Ga0496105_0469603 3300048908 Archaea 991
230 Ga0496105_0531176 3300048908 Bacteria 920
231 Ga0496107_0237771 3300048910 Bacteria 1355
232 Ga0496109_0043925 3300048912 Bacteria 4052
233 Ga0496110_0241038 3300048913 Bacteria 1645
234 Ga0496110_0540888 3300048913 Bacteria 1059
235 Ga0496111_0071893 3300048914 Bacteria 2518
236 Ga0496111_0135489 3300048914 Bacteria 1824
237 Ga0496112_0207083 3300048915 Bacteria 1919
238 Ga0496112_0294393 3300048915 Bacteria 1569
239 Ga0496114_0052233 3300048917 Bacteria 3405
240 Ga0496114_0323950 3300048917 Unclassified 1362
241 Ga0496114_0474027 3300048917 Bacteria 1107
242 Ga0496115_0053555 3300048918 Bacteria 3238
243 Ga0496115_0221916 3300048918 Bacteria 1560
244 Ga0501032_0356053 3300049569 Bacteria 943
245 Ga0501034_0048392 3300049571 Bacteria 4291
246 Ga0501038_0128130 3300049574 Bacteria 2087
247 Ga0501043_0305537 3300049579 Bacteria 1215
248 Ga0501047_0033344 3300049581 Bacteria 4970
249 Ga0501070_0084058 3300049586 Bacteria 2635
250 Ga0501073_0175334 3300049589 Bacteria 1484
251 Ga0501074_0066065 3300049590 Bacteria 2602
252 Ga0501080_0189955 3300049742 Bacteria 1888
253 Ga0501083_0124966 3300049744 Bacteria 1687
254 Ga0501044_0536941 3300049823 Bacteria 1068
255 nmdc:mga0rr50_650130_c1 3300050513 Bacteria 900
256 Ga0495601_0265836 3300053077 Bacteria 1119
257 Ga0495601_0343148 3300053077 Bacteria 971
258 Ga0495601_0705641 3300053077 Unclassified 643
259 Ga0495601_0787974 3300053077 Unclassified 604
260 Ga0495612_0070133 3300053078 Bacteria 1460
261 Ga0495595_0626010 3300053084 Unclassified 550
262 Ga0495619_0010548 3300053085 Bacteria 5813
263 Ga0495619_0026838 3300053085 Bacteria 3707
264 Ga0466962_0056937 3300061719 Bacteria 1866
265 Ga0070712_100213980
266 Ga0070658_10017313
267 Ga0070658_10480111
268 Ga0070658_10636042
269 Ga0070658_10827160
270 Ga0070683_100354276
271 Ga0070680_100007929
272 Ga0070682_100346876
273 Ga0070660_100035095
274 Ga0070660_100036350
275 Ga0070660_100264444
276 Ga0070660_100976320
277 Ga0070660_101718086
278 Ga0070661_100078934
279 Ga0070661_100214281
280 Ga0070661_100442202
281 Ga0070675_100936132
282 Ga0070659_101505231
283 Ga0070708_100263038
284 Ga0070706_101317821
285 Ga0070707_100582120
286 Ga0070679_100459767
287 Ga0070684_100147393
288 Ga0070684_100329303
289 Ga0070684_100329967
290 Ga0070684_100404108
291 Ga0068853_101153628
292 Ga0068855_100009327
293 Ga0068855_100540540
294 Ga0068854_100307449
295 Ga0068856_100785520
296 Ga0068852_100402691
297 Ga0097621_101513203
298 Ga0068871_100368449
299 Ga0075433_10056211
300 Ga0075435_100590359
301 Ga0105240_10168178
302 Ga0105240_10499912
303 Ga0105245_10913209
304 Ga0105242_10465543
305 Ga0105248_10232932
306 Ga0105237_10787153
307 Ga0157373_10315578
308 Ga0157370_10029576
309 Ga0157370_10320388
310 Ga0157370_11590958
311 Ga0157369_10009001
312 Ga0157369_10016530
313 Ga0157369_10093222
314 Ga0157369_10391680
315 Ga0157374_11613028
316 Ga0157372_10123850
317 Ga0157372_11525423
318 Ga0157375_11298016
319 Ga0157375_11409580
320 Ga0206356_10095339
321 Ga0206356_10376018
322 Ga0206354_11353067
323 Ga0206353_10480231
324 Ga0206353_11056406
325 Ga0206353_11083754
326 Ga0224712_10559558
327 Ga0207705_10008397
328 Ga0207705_11107280
329 Ga0207707_10059968
330 Ga0207695_10224898
331 Ga0207693_10543634
332 Ga0207663_10426803
333 Ga0207657_10019963
334 Ga0207657_10144545
335 Ga0207657_10225929
336 Ga0207649_10634547
337 Ga0207652_10291416
338 Ga0207646_11831064
339 Ga0207687_10121561
340 Ga0207700_10360422
341 Ga0207690_10227790
342 Ga0207661_10170430
343 Ga0207661_10182448
344 Ga0207661_10330068
345 Ga0207661_10342399
346 Ga0207667_10081478
347 Ga0207667_10173596
348 Ga0207667_10812256
349 Ga0207640_11000871
350 Ga0207639_10652006
351 Ga0207678_10188191
352 Ga0207641_10191145
353 Ga0207641_10995451
354 Ga0207674_10204369
355 Ga0265326_10047789
356 Ga0265319_1017487
357 Ga0265319_1138638
358 Ga0265334_10024157
359 Ga0265336_10003007
360 Ga0265338_10008857
361 Ga0265338_10026938
362 Ga0265338_10090415
363 Ga0265324_10011167
364 Ga0265340_10025589
365 Ga0265316_10348830
366 Ga0265313_10023057
367 Ga0373926_0100494
368 Ga0373944_0012629
369 Ga0373949_0103994
370 Ga0373936_0006438
371 Ga0373945_0009896
372 Ga0373945_0019270
373 Ga0373943_0000541
374 Ga0373943_0039285
375 Ga0373943_0055286
376 Ga0373946_0027790
377 Ga0373935_0011392
378 Ga0373935_0073888
379 Ga0373927_0089026
380 Ga0373947_0003334
381 Ga0373947_0005818
382 Ga0373925_0009189
383 Ga0373925_0023277
384 Ga0373925_0052065
385 Ga0395899_0066412
386 Ga0395899_0280265
387 Ga0395900_0041948
388 Ga0395900_0042792
389 Ga0395900_0152787
390 Ga0395900_0434041
391 Ga0395900_0723499
392 Ga0395900_0757564
393 Ga0395898_0014716
394 Ga0395898_0123804
395 Ga0395898_0445001
396 Ga0395905_0087027
397 Ga0395905_0463539
398 Ga0395905_0491970
399 Ga0395905_1097500
400 Ga0395901_0001077
401 Ga0395901_0002248
402 Ga0395901_0028640
403 Ga0395901_0034699
404 Ga0395901_0050902
405 Ga0395901_0190175
406 Ga0436365_0824833
407 Ga0436363_0163762
408 Ga0451853_3278648
409 Ga0466966_0007848
410 Ga0466966_0021161
411 Ga0466966_0305544
412 Ga0466966_0310826
413 Ga0466961_0075617
414 Ga0466961_0352316
415 Ga0466961_0401023
416 Ga0466963_0528787
417 Ga0466971_0063999
418 Ga0466971_0383975
419 Ga0466957_0087093
420 Ga0466959_0015402
421 Ga0466959_0068565
422 Ga0466958_0119628
423 Ga0466967_0016430
424 Ga0466967_0060780
425 Ga0466967_0648132
426 Ga0466967_1048907
427 Ga0466967_1431928
428 Ga0495592_0626748
429 Ga0495603_0079828
430 Ga0495603_0099070
431 Ga0495629_0000403
432 Ga0495629_0301352
433 Ga0495629_1141824
434 Ga0495641_0000331
435 Ga0495641_0040978
436 Ga0495653_0027754
437 Ga0495653_0137743
438 Ga0495653_0611379
439 Ga0495580_0558332
440 Ga0495582_0008284
441 Ga0495582_0067853
442 Ga0495582_0318722
443 Ga0495639_0000619
444 Ga0495639_0363276
445 Ga0495662_0044119
446 Ga0495664_0532690
447 Ga0495608_0017025
448 Ga0495628_0153895
449 Ga0495630_0079931
450 Ga0495630_0159322
451 Ga0495665_0009010
452 Ga0495665_0237629
453 Ga0495640_0019680
454 Ga0495640_0255374
455 Ga0495586_0609000
456 Ga0495587_0068870
457 Ga0495645_0403760
458 Ga0495622_0121407
459 Ga0495634_0412766
460 Ga0495635_0103019
461 Ga0495635_0139199
462 Ga0495599_0105208
463 Ga0495647_0003081
464 Ga0495658_0000302
465 Ga0495658_0298345
466 Ga0495613_0002125
467 Ga0495613_0396645
468 Ga0495624_0001304
469 Ga0495600_0379157
470 Ga0495581_0003636
471 Ga0495581_0504277
472 Ga0495604_0093510
473 Ga0495604_0339111
474 Ga0495674_0124473
475 Ga0495674_0200760
476 Ga0495676_0000268
477 Ga0495676_0126608
478 Ga0495676_0140534
479 Ga0495680_0009114
480 Ga0495680_0045984
481 Ga0495675_0139738
482 Ga0495684_0087671
483 Ga0495684_0487294
484 Ga0495593_0017901
485 Ga0495602_0372265
486 Ga0495614_0087296
487 Ga0495614_0181915
488 Ga0496100_0096361
489 Ga0496103_0099539
490 Ga0496104_0018765
491 Ga0496104_0157520
492 Ga0496105_0032754
493 Ga0496105_0469603
494 Ga0496105_0531176
495 Ga0496107_0237771
496 Ga0496109_0043925
497 Ga0496110_0241038
498 Ga0496110_0540888
499 Ga0496111_0071893
500 Ga0496111_0135489
501 Ga0496112_0207083
502 Ga0496112_0294393
503 Ga0496114_0052233
504 Ga0496114_0323950
505 Ga0496114_0474027
506 Ga0496115_0053555
507 Ga0496115_0221916
508 Ga0501032_0356053
509 Ga0501034_0048392
510 Ga0501038_0128130
511 Ga0501043_0305537
512 Ga0501047_0033344
513 Ga0501070_0084058
514 Ga0501073_0175334
515 Ga0501074_0066065
516 Ga0501080_0189955
517 Ga0501083_0124966
518 Ga0501044_0536941
519 nmdc:mga0rr50_650130_c1
520 Ga0495601_0265836
521 Ga0495601_0343148
522 Ga0495601_0705641
523 Ga0495601_0787974
524 Ga0495612_0070133
525 Ga0495595_0626010
526 Ga0495619_0010548
527 Ga0495619_0026838
528 Ga0466962_0056937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

12

146

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9313 1 145
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9246 1 145
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.8707 3 138
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.8669 3 138
1yzt-assembly2.cif.gz_B gppnhp-bound rab21 gtpase at 2.05 a resolution 0.8665 70 90
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9377 5 141 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9234 5 141 3.90.79.10
af_Q9TZE3_159_337_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.883 71 89 3.40.50.300
4fidB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8822 70 87 3.40.50.300
af_P9WIX7_56_205_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8761 1 143 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A538J6U8-F1-model_v4 NUDIX domain-containing protein 0.9958 1 144 GO:0016787
AF-A0A6I3BPS9-F1-model_v4 NUDIX domain-containing protein 0.9927 1 143 GO:0016787
AF-A0A538M1J0-F1-model_v4 NUDIX domain-containing protein 0.9857 1 144 GO:0016787
AF-A0A538M1J0-F1-model_v4 NUDIX domain-containing protein 0.979 1 144 GO:0016787
AF-A0A7W1BQD9-F1-model_v4 NUDIX domain-containing protein 0.9725 15 145 GO:0004081
GO:0006167
GO:0006754

Map