F372524

General Info

Members Datasets Scaffolds Average Seq Length
264 250 170 202

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100270039|Ga0075363_1002700391
Length 228
Sequence MSVPVQWARGADAPGRMGQFAMAAVYVDPDKVLEFEDAASFYKWLGTNHGSQSEVWIKIHKVASGLRSITPKEAIDVALCWGWIDAVRKACDDKSYLQRYTPRGRKSTWSQINVGNVARLVQEGRMTAHGLREVEAAKADGRWDRAYASAKDMAIPEDLLAALEADPEARKALAKLNAQNRFAIAFRIHNMKTEAGRKRKIESFVHMLKSGGVIPPPAGKAAGRKKAS

Samples

Sample ID Description Type Environment
1 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
2 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
3 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
4 2643221591 Devosia sp. Root685 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221618 Ensifer sp. Root231 Isolate Unclassified
7 2643221626 Ensifer sp. Root31 Isolate Unclassified
8 2643221655 Ensifer sp. Root1252 Isolate Unclassified
9 2643221659 Ensifer sp. Root127 Isolate Unclassified
10 2643221698 Ensifer sp. Root142 Isolate Unclassified
11 2643221712 Ensifer sp. Root258 Isolate Unclassified
12 2643221723 Ensifer sp. Root278 Isolate Unclassified
13 2643221736 Bosea sp. Root483D1 Isolate Unclassified
14 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
15 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
16 2816332133 Acidovorax radicis 2721A Isolate Unclassified
17 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
18 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
19 2844163670 Ensifer sp. 1H6 Isolate Unclassified
20 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
21 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
22 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
23 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
24 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
25 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
26 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
27 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
28 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
29 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
30 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
31 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
32 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
33 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
34 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
35 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
36 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
37 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
38 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
39 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
40 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
41 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
42 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
43 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
44 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
45 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
46 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
47 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
48 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
49 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
50 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
51 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
52 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
53 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
54 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
55 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
56 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
57 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
58 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
59 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
60 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
61 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
62 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
63 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
64 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
65 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
66 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
67 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
68 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
69 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
70 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
71 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
72 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
73 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
74 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
75 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
76 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
77 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
78 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
79 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
80 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
81 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
82 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
83 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
84 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
85 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
86 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
87 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
88 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
89 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
90 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
91 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
96 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
99 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
103 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
104 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
105 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
110 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
242 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
245 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
246 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
247 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
248 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
249 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
250 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.39
Metatranscriptomes 0
Isolates 35.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 25
Rhizoplane 2.27
Rhizosphere 51.89
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10038275 3300002077 Bacteria 902
2 rootL2_10004982 3300003322 Bacteria 11329
3 Ga0055526_1000656 3300003771 Bacteria 26693
4 Ga0055536_1016106 3300003781 Bacteria 2518
5 Ga0055531_10020537 3300003794 Bacteria 2606
6 Ga0065707_10225057 3300005295 Bacteria 1210
7 Ga0070658_10265075 3300005327 Bacteria 1460
8 Ga0070676_10106432 3300005328 Bacteria 1740
9 Ga0070683_100106540 3300005329 Bacteria 2643
10 Ga0070670_100021303 3300005331 Bacteria 5576
11 Ga0068868_100007730 3300005338 Bacteria 7672
12 Ga0070687_100203407 3300005343 Unclassified 1201
13 Ga0070669_100464456 3300005353 Unclassified 1045
14 Ga0070675_100134826 3300005354 Bacteria 2107
15 Ga0070659_100070714 3300005366 Bacteria 2773
16 Ga0070709_10223168 3300005434 Unclassified 1345
17 Ga0070714_100000980 3300005435 Bacteria 20406
18 Ga0070713_100416743 3300005436 Bacteria 1256
19 Ga0070678_100189931 3300005456 Bacteria 1688
20 Ga0070681_10019492 3300005458 Bacteria 6791
21 Ga0068867_100753400 3300005459 Unclassified 864
22 Ga0070679_100177260 3300005530 Bacteria 2104
23 Ga0070684_100534825 3300005535 Unclassified 1087
24 Ga0068853_100154311 3300005539 Bacteria 2068
25 Ga0070672_100053791 3300005543 Bacteria 3149
26 Ga0070693_100207180 3300005547 Bacteria 1277
27 Ga0068855_100017182 3300005563 Bacteria 8706
28 Ga0070664_100007073 3300005564 Bacteria 9054
29 Ga0068857_100001669 3300005577 Bacteria 17823
30 Ga0068856_100001357 3300005614 Bacteria 25723
31 Ga0070702_100052498 3300005615 Bacteria 2338
32 Ga0068852_100082476 3300005616 Bacteria 2857
33 Ga0068859_100003538 3300005617 Bacteria 15905
34 Ga0068864_100012500 3300005618 Bacteria 7018
35 Ga0068866_10020379 3300005718 Bacteria 3037
36 Ga0068861_100100375 3300005719 Bacteria 2300
37 Ga0068870_10063980 3300005840 Bacteria 1985
38 Ga0068863_100052158 3300005841 Unclassified 3877
39 Ga0068858_100000863 3300005842 Bacteria 31399
40 Ga0068858_101436081 3300005842 Bacteria 680
41 Ga0068860_100014299 3300005843 Bacteria 7783
42 Ga0068862_100418061 3300005844 Bacteria 1258
43 Ga0075365_10382557 3300006038 Bacteria 993
44 Ga0075363_100270039 3300006048 Bacteria 982
45 Ga0097621_100012248 3300006237 Bacteria 6347
46 Ga0068871_100010695 3300006358 Bacteria 6709
47 Ga0068865_100070763 3300006881 Bacteria 2472
48 Ga0097620_100003538 3300006931 Bacteria 15905
49 Ga0105240_10263462 3300009093 Bacteria 1987
50 Ga0105240_10318687 3300009093 Bacteria 1773
51 Ga0105240_10778009 3300009093 Bacteria 1038
52 Ga0111539_11284276 3300009094 Bacteria 850
53 Ga0105245_10180411 3300009098 Bacteria 2017
54 Ga0114129_10430258 3300009147 Bacteria 1734
55 Ga0105243_10151331 3300009148 Bacteria 1991
56 Ga0105242_10182850 3300009176 Bacteria 1851
57 Ga0105248_10687074 3300009177 Bacteria 1155
58 Ga0105237_10054270 3300009545 Bacteria 4016
59 Ga0105237_10924249 3300009545 Unclassified 879
60 Ga0105238_10853327 3300009551 Bacteria 928
61 Ga0105249_10179246 3300009553 Bacteria 2060
62 Ga0105249_10316681 3300009553 Bacteria 1570
63 Ga0105239_10176556 3300010375 Bacteria 2389
64 Ga0105246_10071255 3300011119 Bacteria 2447
65 Ga0157370_10040856 3300013104 Bacteria 4477
66 Ga0157369_10082582 3300013105 Bacteria 3437
67 Ga0157374_10000804 3300013296 Bacteria 27523
68 Ga0157374_11173154 3300013296 Bacteria 789
69 Ga0157378_10000070 3300013297 Bacteria 91609
70 Ga0157372_10000211 3300013307 Bacteria 65258
71 Ga0157380_10122751 3300014326 Bacteria 2203
72 Ga0157376_10344242 3300014969 Bacteria 1425
73 Ga0157376_10584870 3300014969 Bacteria 1109
74 Ga0163161_10880439 3300017792 Bacteria 757
75 Ga0209676_1006937 3300025292 Bacteria 5464
76 Ga0209564_1000208 3300025295 Bacteria 134794
77 Ga0209564_1069460 3300025295 Bacteria 740
78 Ga0209050_1050129 3300025298 Bacteria 1064
79 Ga0209256_1001926 3300025299 Bacteria 18928
80 Ga0209256_1015790 3300025299 Bacteria 2618
81 Ga0209257_1012353 3300025304 Bacteria 3961
82 Ga0207699_10177606 3300025906 Unclassified 1429
83 Ga0207645_10161379 3300025907 Unclassified 1467
84 Ga0207705_10287776 3300025909 Bacteria 1259
85 Ga0207707_10425685 3300025912 Unclassified 1138
86 Ga0207695_10022425 3300025913 Bacteria 7166
87 Ga0207695_10333607 3300025913 Bacteria 1405
88 Ga0207671_10676748 3300025914 Bacteria 821
89 Ga0207662_10245145 3300025918 Unclassified 1174
90 Ga0207681_10257459 3300025923 Bacteria 1365
91 Ga0207694_10215721 3300025924 Bacteria 1564
92 Ga0207650_10015478 3300025925 Bacteria 5313
93 Ga0207659_10055812 3300025926 Bacteria 2827
94 Ga0207700_10171074 3300025928 Unclassified 1812
95 Ga0207686_10082410 3300025934 Bacteria 2103
96 Ga0207704_10013743 3300025938 Bacteria 4065
97 Ga0207661_10047689 3300025944 Bacteria 3402
98 Ga0207679_10090486 3300025945 Unclassified 2366
99 Ga0207667_10012321 3300025949 Bacteria 9862
100 Ga0207712_10275839 3300025961 Bacteria 1370
101 Ga0207677_10004744 3300026023 Bacteria 7330
102 Ga0207703_10194337 3300026035 Bacteria 1799
103 Ga0207703_10400764 3300026035 Bacteria 1273
104 Ga0207639_10080216 3300026041 Bacteria 2581
105 Ga0207648_10192223 3300026089 Bacteria 1809
106 Ga0207676_10017811 3300026095 Bacteria 5154
107 Ga0207674_10002087 3300026116 Bacteria 25284
108 Ga0207683_11147293 3300026121 Unclassified 721
109 Ga0207698_10092745 3300026142 Bacteria 2477
110 Ga0268266_10059823 3300028379 Bacteria 3282
111 Ga0268265_11070411 3300028380 Bacteria 799
112 Ga0268264_10048609 3300028381 Bacteria 3529
113 Ga0314311_1086943 3300030733 Bacteria 1511
114 Ga0307408_100580000 3300031548 Bacteria 994
115 Ga0307414_10120402 3300032004 Bacteria 2017
116 Ga0439453_0004653 3300041408 Bacteria 2049
117 Ga0451807_2557332 3300041486 Bacteria 1323
118 Ga0451853_0842657 3300041512 Bacteria 1634
119 Ga0439435_0012758 3300042436 Bacteria 2044
120 Ga0466965_0017881 3300044683 Bacteria 3391
121 Ga0466961_0030498 3300044693 Bacteria 3465
122 Ga0466964_0061537 3300044706 Bacteria 1563
123 Ga0466971_0061545 3300044719 Bacteria 1697
124 Ga0466968_0062286 3300044735 Bacteria 1611
125 Ga0466959_0133891 3300045049 Bacteria 1755
126 Ga0495638_0006683 3300046460 Bacteria 8359
127 Ga0495607_0097812 3300046501 Bacteria 1577
128 Ga0495606_0152742 3300046507 Bacteria 1353
129 Ga0495610_0141262 3300046512 Bacteria 1036
130 Ga0495616_0000160 3300046513 Bacteria 58888
131 Ga0495631_0135511 3300046518 Bacteria 1058
132 Ga0495632_0029783 3300046519 Bacteria 2839
133 Ga0495668_0008784 3300046616 Bacteria 6263
134 Ga0495636_0032845 3300047318 Bacteria 2130
135 Ga0495672_0029817 3300047320 Bacteria 3430
136 Ga0495683_0033845 3300047323 Bacteria 2599
137 Ga0496102_0013286 3300048905 Bacteria 7130
138 Ga0496110_0175478 3300048913 Bacteria 1945
139 Ga0496111_0014037 3300048914 Bacteria 5464
140 Ga0496118_0177210 3300048921 Bacteria 1293
141 Ga0496122_0003879 3300048925 Bacteria 19185
142 Ga0496122_0360336 3300048925 Bacteria 755
143 Ga0496123_0002344 3300048926 Bacteria 23748
144 Ga0496124_0172070 3300048927 Bacteria 1676
145 Ga0496125_0000270 3300048928 Bacteria 106118
146 Ga0496126_0497839 3300048929 Bacteria 974
147 Ga0501031_0015459 3300049568 Bacteria 4955
148 Ga0501032_0047919 3300049569 Bacteria 2885
149 Ga0501034_0302638 3300049571 Bacteria 1535
150 Ga0501034_0488743 3300049571 Bacteria 1145
151 Ga0501036_0252948 3300049572 Bacteria 1476
152 Ga0501037_0184023 3300049573 Bacteria 1481
153 Ga0501038_0117083 3300049574 Bacteria 2201
154 Ga0501043_0134434 3300049579 Bacteria 1937
155 Ga0501043_0149260 3300049579 Bacteria 1830
156 Ga0501225_0098589 3300049705 Bacteria 852
157 Ga0501035_0300126 3300049822 Bacteria 1353
158 Ga0501044_0111689 3300049823 Bacteria 2740
159 Ga0501045_0279704 3300049824 Bacteria 1242
160 nmdc:mga03n38_71545_c1 3300050490 Bacteria 1034
161 nmdc:mga0yw44_146242_c1 3300050492 Bacteria 1539
162 Ga0500646_0044971 3300053090 Bacteria 1255
163 Ga0500651_0009775 3300053093 Bacteria 5721
164 Ga0500641_0008626 3300053096 Bacteria 3644
165 Ga0500594_0151080 3300053118 Bacteria 746
166 Ga0500568_0000227 3300053139 Bacteria 48279
167 Ga0500577_0020453 3300053142 Bacteria 2165
168 Ga0500620_000908 3300053155 Bacteria 5147
169 Ga0500609_001840 3300053731 Bacteria 3074
170 Ga0466962_0008153 3300061719 Bacteria 5022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0177210 Ga0496118_0177210_176_745 189
2 iso_pu_bacteria 2643221591 2643966052 192
3 iso_pu_bacteria 2643221736 2644745420 193
4 iso_pu_bacteria 8057529695 8057530850 193
5 iso_pu_bacteria 2513237090 2513614004 194
6 iso_pu_bacteria 2847686936 2847687554 194
7 iso_pu_bacteria 2874102143 2874106209 194
8 iso_pu_bacteria 2937891427 2937897166 194
9 iso_pu_bacteria 2958115193 2958117464 194
10 iso_pu_bacteria 2968097103 2968102490 194
11 iso_pu_bacteria 2968128360 2968132092 194
12 iso_pu_bacteria 2979779861 2979786136 194
13 iso_pu_bacteria 8004445564 8004450948 194
14 iso_pu_bacteria 8004703790 8004711349 194
15 3300048927 Ga0496124_0172070 Ga0496124_0172070_476_1063 195
16 iso_pu_bacteria 2599185352 2600195746 195
17 iso_pu_bacteria 2602042107 2603859638 195
18 iso_pu_bacteria 2643221618 2644107609 195
19 iso_pu_bacteria 2643221626 2644150583 195
20 iso_pu_bacteria 2643221655 2644309005 195
21 iso_pu_bacteria 2643221659 2644332832 195
22 iso_pu_bacteria 2643221698 2644545995 195
23 iso_pu_bacteria 2643221712 2644614946 195
24 iso_pu_bacteria 2643221723 2644676456 195
25 iso_pu_bacteria 2687453392 2688598147 195
26 iso_pu_bacteria 2690316117 2692315837 195
27 iso_pu_bacteria 2838074704 2838079483 195
28 iso_pu_bacteria 2841734538 2841739003 195
29 iso_pu_bacteria 2844163670 2844167848 195
30 iso_pu_bacteria 2847417321 2847419098 195
31 iso_pu_bacteria 2847670302 2847671401 195
32 iso_pu_bacteria 2848992105 2848994127 195
33 iso_pu_bacteria 2855872281 2855876771 195
34 iso_pu_bacteria 2856314179 2856315431 195
35 iso_pu_bacteria 2856320880 2856327030 195
36 iso_pu_bacteria 2856328259 2856333860 195
37 iso_pu_bacteria 2856334872 2856335927 195
38 iso_pu_bacteria 2857367948 2857375563 195
39 iso_pu_bacteria 2869271264 2869276408 195
40 iso_pu_bacteria 2869278585 2869283421 195
41 iso_pu_bacteria 2871474448 2871477067 195
42 iso_pu_bacteria 2874162495 2874166319 195
43 iso_pu_bacteria 2876399893 2876406669 195
44 iso_pu_bacteria 2878035449 2878036505 195
45 iso_pu_bacteria 2878738818 2878744885 195
46 iso_pu_bacteria 2878774303 2878776877 195
47 iso_pu_bacteria 2878788777 2878790854 195
48 iso_pu_bacteria 2881161766 2881162398 195
49 iso_pu_bacteria 2889790730 2889790952 195
50 iso_pu_bacteria 2906386501 2906387126 195
51 iso_pu_bacteria 2906408224 2906413751 195
52 iso_pu_bacteria 2906414383 2906415426 195
53 iso_pu_bacteria 2919073203 2919076354 195
54 iso_pu_bacteria 2920760137 2920765811 195
55 iso_pu_bacteria 2922172374 2922178068 195
56 iso_pu_bacteria 2922178524 2922183623 195
57 iso_pu_bacteria 2924718760 2924725586 195
58 iso_pu_bacteria 2924748358 2924750839 195
59 iso_pu_bacteria 2924762789 2924765906 195
60 iso_pu_bacteria 2924776078 2924783022 195
61 iso_pu_bacteria 2937836603 2937843061 195
62 iso_pu_bacteria 2937877337 2937884033 195
63 iso_pu_bacteria 2937972304 2937975834 195
64 iso_pu_bacteria 2958034702 2958039934 195
65 iso_pu_bacteria 2958041894 2958054278 195
66 iso_pu_bacteria 2958084443 2958091344 195
67 iso_pu_bacteria 2958092219 2958094805 195
68 iso_pu_bacteria 2958122699 2958122901 195
69 iso_pu_bacteria 2958137437 2958137526 195
70 iso_pu_bacteria 2958144490 2958144521 195
71 iso_pu_bacteria 2958158011 2958163551 195
72 iso_pu_bacteria 2961136820 2961141540 195
73 iso_pu_bacteria 2965025482 2965028422 195
74 iso_pu_bacteria 2965032056 2965039429 195
75 iso_pu_bacteria 2965047637 2965052335 195
76 iso_pu_bacteria 2965102966 2965106466 195
77 iso_pu_bacteria 2968016561 2968018782 195
78 iso_pu_bacteria 2970469710 2970471045 195
79 iso_pu_bacteria 2970547951 2970553135 195
80 iso_pu_bacteria 2970593180 2970598153 195
81 iso_pu_bacteria 2977872689 2977877555 195
82 iso_pu_bacteria 2977935797 2977939666 195
83 iso_pu_bacteria 2977957713 2977961099 195
84 iso_pu_bacteria 2987645492 2987648843 195
85 iso_pu_bacteria 2987666974 2987673232 195
86 iso_pu_bacteria 3004239961 3004243587 195
87 iso_pu_bacteria 3004289098 3004296372 195
88 iso_pu_bacteria 649633066 649872685 195
89 iso_pu_bacteria 8004300914 8004305303 195
90 iso_pu_bacteria 8004633249 8004638509 195
91 iso_pu_bacteria 8004695233 8004696597 195
92 3300009093 Ga0105240_10263462 Ga0105240_102634623 196
93 3300009093 Ga0105240_10778009 Ga0105240_107780092 196
94 3300009545 Ga0105237_10054270 Ga0105237_100542702 196
95 3300013104 Ga0157370_10040856 Ga0157370_100408565 196
96 3300013105 Ga0157369_10082582 Ga0157369_100825821 196
97 3300025913 Ga0207695_10022425 Ga0207695_100224255 196
98 3300025914 Ga0207671_10676748 Ga0207671_106767481 196
99 3300025924 Ga0207694_10215721 Ga0207694_102157212 196
100 3300032004 Ga0307414_10120402 Ga0307414_101204022 196
101 3300048913 Ga0496110_0175478 Ga0496110_0175478_827_1417 196
102 3300048914 Ga0496111_0014037 Ga0496111_0014037_3317_3907 196
103 3300048925 Ga0496122_0360336 Ga0496122_0360336_155_745 196
104 3300048928 Ga0496125_0000270 Ga0496125_0000270_80870_81460 196
105 iso_pu_bacteria 2854916844 2854920623 196
106 iso_pu_bacteria 2928531327 2928532377 196
107 3300005295 Ga0065707_10225057 Ga0065707_102250571 197
108 3300005354 Ga0070675_100134826 Ga0070675_1001348262 197
109 3300005543 Ga0070672_100053791 Ga0070672_1000537912 197
110 3300005844 Ga0068862_100418061 Ga0068862_1004180612 197
111 3300009094 Ga0111539_11284276 Ga0111539_112842761 197
112 3300009553 Ga0105249_10179246 Ga0105249_101792461 197
113 3300014326 Ga0157380_10122751 Ga0157380_101227512 197
114 3300025923 Ga0207681_10257459 Ga0207681_102574591 197
115 3300028380 Ga0268265_11070411 Ga0268265_110704111 197
116 3300031548 Ga0307408_100580000 Ga0307408_1005800001 197
117 3300041408 Ga0439453_0004653 Ga0439453_0004653_332_925 197
118 3300042436 Ga0439435_0012758 Ga0439435_0012758_697_1290 197
119 3300049705 Ga0501225_0098589 Ga0501225_0098589_188_781 197
120 3300053093 Ga0500651_0009775 Ga0500651_0009775_1748_2359 197
121 3300053096 Ga0500641_0008626 Ga0500641_0008626_1377_1970 197
122 3300005436 Ga0070713_100416743 Ga0070713_1004167432 198
123 3300009148 Ga0105243_10151331 Ga0105243_101513313 198
124 3300030733 Ga0314311_1086943 Ga0314311_10869433 198
125 3300041486 Ga0451807_2557332 Ga0451807_2557332_96_692 198
126 3300053155 Ga0500620_000908 Ga0500620_000908_2349_2945 198
127 iso_pu_bacteria 2643221609 2644062051 198
128 iso_pu_bacteria 2816332133 2816472833 198
129 3300003322 rootL2_10004982 rootL2_1000498211 199
130 3300003771 Ga0055526_1000656 Ga0055526_100065610 199
131 3300003781 Ga0055536_1016106 Ga0055536_10161063 199
132 3300003794 Ga0055531_10020537 Ga0055531_100205375 199
133 3300005327 Ga0070658_10265075 Ga0070658_102650752 199
134 3300005434 Ga0070709_10223168 Ga0070709_102231682 199
135 3300005435 Ga0070714_100000980 Ga0070714_10000098018 199
136 3300005842 Ga0068858_101436081 Ga0068858_1014360811 199
137 3300006038 Ga0075365_10382557 Ga0075365_103825571 199
138 3300009093 Ga0105240_10318687 Ga0105240_103186872 199
139 3300009147 Ga0114129_10430258 Ga0114129_104302583 199
140 3300009177 Ga0105248_10687074 Ga0105248_106870742 199
141 3300009553 Ga0105249_10316681 Ga0105249_103166812 199
142 3300010375 Ga0105239_10176556 Ga0105239_101765563 199
143 3300013296 Ga0157374_11173154 Ga0157374_111731541 199
144 3300014969 Ga0157376_10584870 Ga0157376_105848701 199
145 3300017792 Ga0163161_10880439 Ga0163161_108804391 199
146 3300025292 Ga0209676_1006937 Ga0209676_10069375 199
147 3300025295 Ga0209564_1000208 Ga0209564_1000208111 199
148 3300025298 Ga0209050_1050129 Ga0209050_10501291 199
149 3300025299 Ga0209256_1001926 Ga0209256_10019262 199
150 3300025304 Ga0209257_1012353 Ga0209257_10123534 199
151 3300025906 Ga0207699_10177606 Ga0207699_101776062 199
152 3300025909 Ga0207705_10287776 Ga0207705_102877762 199
153 3300025913 Ga0207695_10333607 Ga0207695_103336072 199
154 3300025928 Ga0207700_10171074 Ga0207700_101710742 199
155 3300025961 Ga0207712_10275839 Ga0207712_102758392 199
156 3300026035 Ga0207703_10400764 Ga0207703_104007641 199
157 3300028379 Ga0268266_10059823 Ga0268266_100598232 199
158 3300041512 Ga0451853_0842657 Ga0451853_0842657_115_714 199
159 3300046460 Ga0495638_0006683 Ga0495638_0006683_4550_5149 199
160 3300046501 Ga0495607_0097812 Ga0495607_0097812_888_1487 199
161 3300046507 Ga0495606_0152742 Ga0495606_0152742_53_652 199
162 3300046512 Ga0495610_0141262 Ga0495610_0141262_139_738 199
163 3300046513 Ga0495616_0000160 Ga0495616_0000160_47362_47961 199
164 3300046518 Ga0495631_0135511 Ga0495631_0135511_118_717 199
165 3300046519 Ga0495632_0029783 Ga0495632_0029783_1092_1691 199
166 3300046616 Ga0495668_0008784 Ga0495668_0008784_485_1084 199
167 3300047318 Ga0495636_0032845 Ga0495636_0032845_1133_1732 199
168 3300047320 Ga0495672_0029817 Ga0495672_0029817_950_1549 199
169 3300047323 Ga0495683_0033845 Ga0495683_0033845_1111_1710 199
170 3300048905 Ga0496102_0013286 Ga0496102_0013286_1816_2415 199
171 3300048925 Ga0496122_0003879 Ga0496122_0003879_13839_14438 199
172 3300048926 Ga0496123_0002344 Ga0496123_0002344_8972_9571 199
173 3300048929 Ga0496126_0497839 Ga0496126_0497839_225_824 199
174 3300049571 Ga0501034_0488743 Ga0501034_0488743_308_907 199
175 3300049579 Ga0501043_0149260 Ga0501043_0149260_1192_1791 199
176 3300050492 nmdc:mga0yw44_146242_c1 nmdc:mga0yw44_146242_c1_780_1379 199
177 3300053090 Ga0500646_0044971 Ga0500646_0044971_457_1056 199
178 3300053118 Ga0500594_0151080 Ga0500594_0151080_132_731 199
179 3300053139 Ga0500568_0000227 Ga0500568_0000227_12305_12904 199
180 3300053142 Ga0500577_0020453 Ga0500577_0020453_495_1094 199
181 3300053731 Ga0500609_001840 Ga0500609_001840_1268_1867 199
182 3300005343 Ga0070687_100203407 Ga0070687_1002034073 200
183 3300009551 Ga0105238_10853327 Ga0105238_108533271 200
184 3300014969 Ga0157376_10344242 Ga0157376_103442422 200
185 iso_pu_bacteria 2854896431 2854897804 200
186 3300005328 Ga0070676_10106432 Ga0070676_101064322 201
187 3300005329 Ga0070683_100106540 Ga0070683_1001065402 201
188 3300005331 Ga0070670_100021303 Ga0070670_1000213034 201
189 3300005338 Ga0068868_100007730 Ga0068868_1000077304 201
190 3300005353 Ga0070669_100464456 Ga0070669_1004644561 201
191 3300005366 Ga0070659_100070714 Ga0070659_1000707142 201
192 3300005456 Ga0070678_100189931 Ga0070678_1001899311 201
193 3300005458 Ga0070681_10019492 Ga0070681_100194927 201
194 3300005459 Ga0068867_100753400 Ga0068867_1007534001 201
195 3300005530 Ga0070679_100177260 Ga0070679_1001772602 201
196 3300005535 Ga0070684_100534825 Ga0070684_1005348251 201
197 3300005539 Ga0068853_100154311 Ga0068853_1001543112 201
198 3300005547 Ga0070693_100207180 Ga0070693_1002071802 201
199 3300005563 Ga0068855_100017182 Ga0068855_1000171828 201
200 3300005564 Ga0070664_100007073 Ga0070664_1000070737 201
201 3300005577 Ga0068857_100001669 Ga0068857_10000166919 201
202 3300005614 Ga0068856_100001357 Ga0068856_10000135724 201
203 3300005615 Ga0070702_100052498 Ga0070702_1000524982 201
204 3300005616 Ga0068852_100082476 Ga0068852_1000824762 201
205 3300005617 Ga0068859_100003538 Ga0068859_10000353819 201
206 3300005618 Ga0068864_100012500 Ga0068864_1000125008 201
207 3300005718 Ga0068866_10020379 Ga0068866_100203792 201
208 3300005719 Ga0068861_100100375 Ga0068861_1001003752 201
209 3300005840 Ga0068870_10063980 Ga0068870_100639802 201
210 3300005841 Ga0068863_100052158 Ga0068863_1000521585 201
211 3300005842 Ga0068858_100000863 Ga0068858_10000086326 201
212 3300005843 Ga0068860_100014299 Ga0068860_1000142995 201
213 3300006237 Ga0097621_100012248 Ga0097621_1000122488 201
214 3300006358 Ga0068871_100010695 Ga0068871_1000106955 201
215 3300006881 Ga0068865_100070763 Ga0068865_1000707632 201
216 3300006931 Ga0097620_100003538 Ga0097620_10000353819 201
217 3300009098 Ga0105245_10180411 Ga0105245_101804111 201
218 3300009176 Ga0105242_10182850 Ga0105242_101828502 201
219 3300009545 Ga0105237_10924249 Ga0105237_109242491 201
220 3300011119 Ga0105246_10071255 Ga0105246_100712552 201
221 3300013296 Ga0157374_10000804 Ga0157374_1000080424 201
222 3300013297 Ga0157378_10000070 Ga0157378_1000007081 201
223 3300013307 Ga0157372_10000211 Ga0157372_1000021156 201
224 3300025907 Ga0207645_10161379 Ga0207645_101613791 201
225 3300025912 Ga0207707_10425685 Ga0207707_104256851 201
226 3300025918 Ga0207662_10245145 Ga0207662_102451451 201
227 3300025925 Ga0207650_10015478 Ga0207650_100154782 201
228 3300025926 Ga0207659_10055812 Ga0207659_100558122 201
229 3300025934 Ga0207686_10082410 Ga0207686_100824102 201
230 3300025938 Ga0207704_10013743 Ga0207704_100137433 201
231 3300025944 Ga0207661_10047689 Ga0207661_100476893 201
232 3300025945 Ga0207679_10090486 Ga0207679_100904862 201
233 3300025949 Ga0207667_10012321 Ga0207667_100123212 201
234 3300026023 Ga0207677_10004744 Ga0207677_100047445 201
235 3300026035 Ga0207703_10194337 Ga0207703_101943371 201
236 3300026041 Ga0207639_10080216 Ga0207639_100802162 201
237 3300026089 Ga0207648_10192223 Ga0207648_101922232 201
238 3300026095 Ga0207676_10017811 Ga0207676_100178112 201
239 3300026116 Ga0207674_10002087 Ga0207674_1000208722 201
240 3300026121 Ga0207683_11147293 Ga0207683_111472931 201
241 3300026142 Ga0207698_10092745 Ga0207698_100927451 201
242 3300028381 Ga0268264_10048609 Ga0268264_100486092 201
243 3300049568 Ga0501031_0015459 Ga0501031_0015459_2557_3162 201
244 3300049569 Ga0501032_0047919 Ga0501032_0047919_2200_2805 201
245 3300049571 Ga0501034_0302638 Ga0501034_0302638_605_1210 201
246 3300049572 Ga0501036_0252948 Ga0501036_0252948_595_1200 201
247 3300049573 Ga0501037_0184023 Ga0501037_0184023_299_904 201
248 3300049574 Ga0501038_0117083 Ga0501038_0117083_1421_2026 201
249 3300049579 Ga0501043_0134434 Ga0501043_0134434_496_1101 201
250 3300049822 Ga0501035_0300126 Ga0501035_0300126_253_858 201
251 3300049823 Ga0501044_0111689 Ga0501044_0111689_2088_2693 201
252 3300049824 Ga0501045_0279704 Ga0501045_0279704_286_891 201
253 3300002077 JGI24744J21845_10038275 JGI24744J21845_100382751 202
254 3300006048 Ga0075363_100270039 Ga0075363_1002700391 202
255 3300025295 Ga0209564_1069460 Ga0209564_10694601 202
256 3300025299 Ga0209256_1015790 Ga0209256_10157901 202
257 3300044683 Ga0466965_0017881 Ga0466965_0017881_108_752 202
258 3300044693 Ga0466961_0030498 Ga0466961_0030498_1489_2133 202
259 3300044706 Ga0466964_0061537 Ga0466964_0061537_257_901 202
260 3300044719 Ga0466971_0061545 Ga0466971_0061545_731_1375 202
261 3300044735 Ga0466968_0062286 Ga0466968_0062286_76_720 202
262 3300045049 Ga0466959_0133891 Ga0466959_0133891_1005_1649 202
263 3300050490 nmdc:mga03n38_71545_c1 nmdc:mga03n38_71545_c1_166_804 202
264 3300061719 Ga0466962_0008153 Ga0466962_0008153_2992_3636 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

152

211

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i5u-assembly1.cif.gz_A crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosylmethionine (sam) and 2-hydroxy-5-methyl naphthoic acid (mna) 0.7656 16 82
6ix3-assembly1.cif.gz_A the structure of lepi complex with sam 0.7643 17 82
8bif-assembly2.cif.gz_C o-methyltransferase plu4892 in complex with sah 0.7484 33 82
6c5b-assembly1.cif.gz_B crystal structure analysis of laphzm 0.7419 16 82
3i58-assembly1.cif.gz_A crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosyl-l-homocysteine (sah) and 2-hydroxy-7-methoxy-5-methyl naphthoic acid (na) 0.7394 16 82
ID Description Score Start End Superfamily
6clwA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7835 33 82 3.40.50.150
6c5bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7419 16 82 3.40.50.150
af_O95671_369_620_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7228 17 81 3.40.50.150
af_A0A0B4JCY2_46_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.721 12 80 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7058 17 83 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8MZK2-F1-model_v4 Bacteriocin-protection protein 0.9911 10 84
AF-A0A352S5L2-F1-model_v4 Bacteriocin-protection protein 0.9757 11 112
AF-A0A0B0HP10-F1-model_v4 deleted 0.9754 11 126
AF-A0A1Q7JCW6-F1-model_v4 Bacteriocin-protection protein 0.9748 10 115
AF-A0A4V2PCG6-F1-model_v4 OmdA domain containing protein 0.9723 11 122

Feature Viewer

pLDDT pTM Quality
88.02 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map