F372313

General Info

Members Datasets Scaffolds Average Seq Length
264 184 195 235

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10005998|JGI25151J46595_100059983
Length 246
Sequence MKIEVWSDFVCPFCYIGKRRLEQALQQFAHKDDVQVEFKSFELDPNAPVNTGKTINEALAAKYGMTIEQAKQANEGIGQQAAGVGLSFNFDDMKPTNTFDAHRLAKFAKAQGKEAAMTEKLLYAYFTESKHLGEEETLVALAEDAGLDREEARQILADKTAYANEVRSDEAMAQQYGISGVPYFVVNQKYAISGAQPVETFVGALQQVWEEEHPTPALKSLSPEGADDAFCADGQCAVPDSSKKPQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
4 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
5 2643221729 Bacillus sp. Root11 Isolate Unclassified
6 2643221730 Bacillus sp. Root131 Isolate Unclassified
7 2643221731 Bacillus sp. Root147 Isolate Unclassified
8 2643221732 Bacillus sp. Root239 Isolate Unclassified
9 2684622632 Bacillus cereus 905 Isolate Unclassified
10 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
11 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
12 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
13 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
14 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
15 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
16 2738541358 Bacillus sp. OV752 Isolate Unclassified
17 2738543006 Bacillus sp. OK077 Isolate Unclassified
18 2739367898 Nocardioides sp. CF479 Isolate Unclassified
19 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
20 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
21 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
22 2818991441 Niallia circulans 3243 Isolate Rhizosphere
23 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
24 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
25 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
26 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
27 2842882022 Bacillus sp. R-71893 Isolate Unclassified
28 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
29 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
30 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
31 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
32 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
33 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
34 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
35 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
36 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
37 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
38 2919720352 Priestia megaterium 4340 Isolate Unclassified
39 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
40 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
41 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
42 2929004312 Priestia megaterium 1104 Isolate Unclassified
43 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
44 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
45 2938917290 Bacillus sp. CR71 Isolate Unclassified
46 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
47 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
48 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
49 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
50 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
51 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
52 2965761152 Bacillus sp. COPE52 Isolate Unclassified
53 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
54 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
55 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
56 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
57 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
58 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
59 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
60 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
61 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
62 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
63 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
66 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
178 8022792930 Bacillus sp. Xin Isolate Rhizosphere
179 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
180 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
181 8023438354 Bacillus sp. BH2 Isolate Unclassified
182 8023444577 Bacillus sp. BH32 Isolate Unclassified
183 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
184 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 71.59
Metatranscriptomes 2.27
Isolates 26.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.29
Nodule 0
Rhizoplane 4.92
Rhizosphere 46.97
Stem 0
Stem Tuber 0
Unclassified 31.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC10653_g1 2010549000 Bacteria 863
2 JGI25162J39368_1007373 3300002737 Bacteria 1727
3 JGI25159J45721_1009463 3300002987 Bacteria 2568
4 JGI25159J45721_1011017 3300002987 Bacteria 2250
5 JGI25151J46595_10003817 3300003187 Bacteria 8166
6 JGI25151J46595_10005998 3300003187 Bacteria 6187
7 JGI25151J46595_10006893 3300003187 Bacteria 5641
8 JGI25151J46595_10023546 3300003187 Bacteria 2534
9 JGI25151J46595_10045137 3300003187 Bacteria 1558
10 JGI25151J46595_10066897 3300003187 Bacteria 1110
11 rootH1_10001198 3300003316 Bacteria 64881
12 rootH2_10134014 3300003320 Bacteria 1672
13 rootL2_10020976 3300003322 Bacteria 16491
14 Ga0006562J51391_1008264 3300003578 Bacteria 6420
15 Ga0006562J51391_1012747 3300003578 Bacteria 3270
16 Ga0055538_1000101 3300003751 Bacteria 68738
17 Ga0055538_1000427 3300003751 Bacteria 16284
18 Ga0055532_1000256 3300003758 Bacteria 36331
19 Ga0055536_1017480 3300003781 Bacteria 2344
20 Ga0055536_1018971 3300003781 Bacteria 2181
21 Ga0055528_1002289 3300003790 Bacteria 10373
22 Ga0070658_10378577 3300005327 Bacteria 1214
23 Ga0070660_100079440 3300005339 Bacteria 2574
24 Ga0070671_100141785 3300005355 Bacteria 2028
25 Ga0068855_100015397 3300005563 Bacteria 9207
26 Ga0068852_100086200 3300005616 Bacteria 2799
27 Ga0068852_100101682 3300005616 Bacteria 2596
28 Ga0075363_100176055 3300006048 Bacteria 1216
29 Ga0075370_10228706 3300006353 Bacteria 1100
30 Ga0105251_10034779 3300009011 Bacteria 2491
31 Ga0105251_10036445 3300009011 Bacteria 2420
32 Ga0105251_10071901 3300009011 Bacteria 1609
33 Ga0105244_10019481 3300009036 Bacteria 3786
34 Ga0105244_10037676 3300009036 Bacteria 2527
35 Ga0105244_10040163 3300009036 Bacteria 2431
36 Ga0105244_10061440 3300009036 Bacteria 1891
37 Ga0105244_10061903 3300009036 Bacteria 1882
38 Ga0105250_10022494 3300009092 Bacteria 2541
39 Ga0105250_10034212 3300009092 Bacteria 2039
40 Ga0105240_10085339 3300009093 Bacteria 3868
41 Ga0105243_10034103 3300009148 Bacteria 3939
42 Ga0105243_10381502 3300009148 Bacteria 1304
43 Ga0105242_10881173 3300009176 Bacteria 893
44 Ga0105239_10906212 3300010375 Bacteria 1012
45 Ga0105246_10150890 3300011119 Bacteria 1759
46 Ga0157371_10005745 3300013102 Bacteria 10391
47 Ga0157370_10006943 3300013104 Bacteria 12374
48 Ga0157369_10041072 3300013105 Bacteria 5050
49 Ga0157369_10136441 3300013105 Bacteria 2597
50 Ga0157372_10400313 3300013307 Bacteria 1600
51 Ga0157375_10956659 3300013308 Bacteria 998
52 Ga0157377_10021646 3300014745 Bacteria 3384
53 Ga0206353_10927906 3300020082 Bacteria 2962
54 Ga0224712_10029813 3300022467 Bacteria 1963
55 Ga0209784_100165 3300025224 Bacteria 57266
56 Ga0209147_100324 3300025229 Bacteria 36391
57 Ga0209147_100599 3300025229 Bacteria 19855
58 Ga0209147_103980 3300025229 Bacteria 2618
59 Ga0209437_100455 3300025233 Bacteria 33243
60 Ga0209130_1010020 3300025284 Bacteria 2642
61 Ga0209130_1010757 3300025284 Bacteria 2498
62 Ga0209676_1000533 3300025292 Bacteria 59159
63 Ga0209676_1008742 3300025292 Bacteria 4464
64 Ga0209025_1001718 3300025294 Bacteria 26578
65 Ga0209025_1003510 3300025294 Bacteria 14738
66 Ga0209025_1003985 3300025294 Bacteria 13257
67 Ga0209025_1013726 3300025294 Bacteria 5061
68 Ga0209025_1026995 3300025294 Bacteria 2862
69 Ga0209025_1028940 3300025294 Bacteria 2697
70 Ga0209025_1029023 3300025294 Bacteria 2691
71 Ga0209025_1029396 3300025294 Bacteria 2659
72 Ga0209025_1029406 3300025294 Bacteria 2659
73 Ga0209025_1029824 3300025294 Bacteria 2627
74 Ga0209025_1030129 3300025294 Bacteria 2605
75 Ga0209025_1031741 3300025294 Bacteria 2489
76 Ga0209025_1039981 3300025294 Bacteria 2036
77 Ga0209025_1040094 3300025294 Bacteria 2031
78 Ga0209025_1070396 3300025294 Bacteria 1245
79 Ga0207426_1004770 3300025302 Bacteria 6452
80 Ga0207696_1013738 3300025711 Bacteria 2805
81 Ga0207696_1017644 3300025711 Bacteria 2359
82 Ga0207696_1022483 3300025711 Bacteria 2002
83 Ga0207696_1037480 3300025711 Bacteria 1435
84 Ga0207696_1039618 3300025711 Bacteria 1385
85 Ga0207655_1030086 3300025728 Bacteria 2531
86 Ga0207655_1058117 3300025728 Bacteria 1514
87 Ga0207713_1020956 3300025735 Bacteria 3146
88 Ga0207713_1041472 3300025735 Bacteria 1920
89 Ga0207713_1106647 3300025735 Bacteria 958
90 Ga0207705_10092270 3300025909 Bacteria 2219
91 Ga0207695_10033348 3300025913 Bacteria 5617
92 Ga0207657_10118888 3300025919 Bacteria 2175
93 Ga0207709_10023231 3300025935 Bacteria 3527
94 Ga0207678_10154959 3300026067 Bacteria 1956
95 Ga0207698_10175417 3300026142 Bacteria 1892
96 Ga0209371_1022038 3300027312 Bacteria 1532
97 Ga0265338_10328748 3300028800 Bacteria 1105
98 Ga0237817_10743 3300030083 Bacteria 2617
99 Ga0237817_10754 3300030083 Bacteria 2565
100 Ga0268256_1015856 3300030500 Bacteria 2182
101 Ga0265331_10054189 3300031250 Bacteria 1910
102 Ga0265327_10000439 3300031251 Bacteria 75504
103 Ga0307408_100073088 3300031548 Bacteria 2540
104 Ga0307406_10576945 3300031901 Bacteria 924
105 Ga0307416_100068820 3300032002 Bacteria 2927
106 Ga0395900_0226162 3300037418 Bacteria 1884
107 Ga0395898_0034514 3300037466 Bacteria 5041
108 Ga0237819_03867 3300038705 Bacteria 2564
109 Ga0237819_03924 3300038705 Bacteria 2535
110 Ga0451577_0003078 3300042876 Bacteria 18857
111 Ga0451577_0033631 3300042876 Bacteria 4622
112 Ga0451577_0960595 3300042876 Bacteria 768
113 Ga0453684_0118113 3300044712 Bacteria 3208
114 Ga0453684_0342349 3300044712 Bacteria 1688
115 Ga0466970_0111850 3300044765 Bacteria 1492
116 Ga0451576_0030390 3300045051 Bacteria 5773
117 Ga0466967_0106384 3300045976 Bacteria 2571
118 Ga0495603_0043678 3300046455 Bacteria 2675
119 Ga0495585_0097776 3300046492 Bacteria 1574
120 Ga0495621_0008240 3300046539 Bacteria 3117
121 Ga0495670_0070980 3300046691 Bacteria 1763
122 Ga0496100_0214551 3300048903 Bacteria 1409
123 Ga0496101_0014035 3300048904 Bacteria 5380
124 Ga0496102_0008258 3300048905 Bacteria 8917
125 Ga0496103_0024018 3300048906 Bacteria 3677
126 Ga0496104_0013928 3300048907 Bacteria 7256
127 Ga0496105_0010157 3300048908 Bacteria 7396
128 Ga0496106_0000564 3300048909 Bacteria 26417
129 Ga0496107_0000196 3300048910 Bacteria 31649
130 Ga0496108_0002965 3300048911 Bacteria 13647
131 Ga0496109_0002204 3300048912 Bacteria 16159
132 Ga0496110_0553269 3300048913 Bacteria 1045
133 Ga0496112_0006001 3300048915 Bacteria 10602
134 Ga0496113_0001817 3300048916 Bacteria 12127
135 Ga0496116_0000253 3300048919 Bacteria 95032
136 Ga0496116_0004859 3300048919 Bacteria 12680
137 Ga0496116_0005382 3300048919 Bacteria 11911
138 Ga0496116_0011993 3300048919 Bacteria 7116
139 Ga0496116_0021194 3300048919 Bacteria 4907
140 Ga0496116_0031215 3300048919 Bacteria 3818
141 Ga0496119_0013101 3300048922 Bacteria 6644
142 Ga0496119_0023718 3300048922 Bacteria 4339
143 Ga0496119_0051036 3300048922 Bacteria 2545
144 Ga0496119_0095809 3300048922 Bacteria 1676
145 Ga0496120_0002652 3300048923 Bacteria 17658
146 Ga0496120_0018683 3300048923 Bacteria 4459
147 Ga0496120_0126235 3300048923 Bacteria 1316
148 Ga0496120_0181651 3300048923 Bacteria 1032
149 Ga0496121_0234279 3300048924 Bacteria 1284
150 Ga0496122_0007874 3300048925 Bacteria 11698
151 Ga0496122_0010299 3300048925 Bacteria 9673
152 Ga0496122_0011657 3300048925 Bacteria 8864
153 Ga0496122_0040635 3300048925 Bacteria 3692
154 Ga0496122_0059456 3300048925 Bacteria 2821
155 Ga0496122_0180122 3300048925 Bacteria 1262
156 Ga0496122_0181095 3300048925 Bacteria 1256
157 Ga0496122_0255760 3300048925 Bacteria 976
158 Ga0496123_0096676 3300048926 Bacteria 1733
159 Ga0496124_0000358 3300048927 Bacteria 83124
160 Ga0496124_0001985 3300048927 Bacteria 27898
161 Ga0496125_0022467 3300048928 Bacteria 5858
162 Ga0496125_0043732 3300048928 Bacteria 3797
163 Ga0496126_0001637 3300048929 Bacteria 33873
164 Ga0496126_0001968 3300048929 Bacteria 29114
165 Ga0496126_0002645 3300048929 Bacteria 23759
166 Ga0496126_0007050 3300048929 Bacteria 12391
167 Ga0496126_0399566 3300048929 Unclassified 1115
168 Ga0501305_010515 3300049161 Bacteria 1237
169 Ga0501300_020566 3300049523 Bacteria 964
170 Ga0501031_0021901 3300049568 Bacteria 4164
171 Ga0501032_0030296 3300049569 Bacteria 3712
172 Ga0501033_0331285 3300049570 Bacteria 1068
173 Ga0501034_0395455 3300049571 Bacteria 1305
174 Ga0501036_0033743 3300049572 Bacteria 4328
175 Ga0501038_0005504 3300049574 Bacteria 11758
176 Ga0501038_0071081 3300049574 Bacteria 2953
177 Ga0501039_0140830 3300049575 Bacteria 1895
178 Ga0501042_0159727 3300049578 Bacteria 1626
179 Ga0501043_0022386 3300049579 Bacteria 4957
180 Ga0501046_0131449 3300049580 Bacteria 1898
181 Ga0501047_0011046 3300049581 Bacteria 8545
182 Ga0501048_0000038 3300049582 Bacteria 63639
183 Ga0501048_0220196 3300049582 Bacteria 1346
184 Ga0501070_0024928 3300049586 Bacteria 5016
185 Ga0501072_0051805 3300049588 Bacteria 3232
186 Ga0501077_0214690 3300049593 Bacteria 1223
187 Ga0501221_024750 3300049704 Bacteria 1208
188 Ga0501079_0493632 3300049741 Bacteria 962
189 Ga0501081_0384042 3300049743 Bacteria 1038
190 Ga0501035_0013965 3300049822 Bacteria 7409
191 Ga0501035_0259317 3300049822 Bacteria 1474
192 Ga0501044_0041363 3300049823 Bacteria 4797
193 Ga0501044_0548924 3300049823 Bacteria 1053
194 Ga0587088_018606 3300059508 Bacteria 1133
195 Ga0501082_0130132 3300060353 Bacteria 2184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0399566 Ga0496126_0399566_22_660 197
2 iso_pu_bacteria 2791355222 2793183192 205
3 iso_pu_bacteria 2988225383 2988227261 205
4 iso_pu_bacteria 8056060235 8056066203 206
5 iso_pu_bacteria 2928510474 2928512855 208
6 3300002737 JGI25162J39368_1007373 JGI25162J39368_10073733 209
7 3300025233 Ga0209437_100455 Ga0209437_1004558 209
8 3300048919 Ga0496116_0004859 Ga0496116_0004859_3647_4279 209
9 3300048925 Ga0496122_0059456 Ga0496122_0059456_537_1169 209
10 3300048925 Ga0496122_0180122 Ga0496122_0180122_215_847 209
11 3300048928 Ga0496125_0022467 Ga0496125_0022467_1567_2199 209
12 3300048929 Ga0496126_0002645 Ga0496126_0002645_5424_6056 209
13 iso_pu_bacteria 2852673933 2852676756 209
14 3300048919 Ga0496116_0031215 Ga0496116_0031215_1503_2138 210
15 3300031250 Ga0265331_10054189 Ga0265331_100541894 211
16 3300031251 Ga0265327_10000439 Ga0265327_1000043949 211
17 3300042876 Ga0451577_0003078 Ga0451577_0003078_14887_15522 211
18 3300042876 Ga0451577_0033631 Ga0451577_0033631_3323_3958 211
19 3300044712 Ga0453684_0118113 Ga0453684_0118113_706_1341 211
20 3300045051 Ga0451576_0030390 Ga0451576_0030390_3331_3966 211
21 3300042876 Ga0451577_0960595 Ga0451577_0960595_47_685 212
22 3300044712 Ga0453684_0342349 Ga0453684_0342349_750_1388 212
23 iso_pu_bacteria 3006969106 3006973549 212
24 3300009036 Ga0105244_10019481 Ga0105244_100194812 213
25 3300009148 Ga0105243_10381502 Ga0105243_103815022 213
26 3300046539 Ga0495621_0008240 Ga0495621_0008240_2246_2890 214
27 3300049568 Ga0501031_0021901 Ga0501031_0021901_2464_3114 216
28 3300049569 Ga0501032_0030296 Ga0501032_0030296_2647_3297 216
29 3300049570 Ga0501033_0331285 Ga0501033_0331285_215_865 216
30 3300049571 Ga0501034_0395455 Ga0501034_0395455_333_983 216
31 3300049574 Ga0501038_0005504 Ga0501038_0005504_4857_5507 216
32 3300049579 Ga0501043_0022386 Ga0501043_0022386_2588_3238 216
33 3300049580 Ga0501046_0131449 Ga0501046_0131449_220_870 216
34 3300049581 Ga0501047_0011046 Ga0501047_0011046_1457_2107 216
35 3300049582 Ga0501048_0000038 Ga0501048_0000038_42332_42982 216
36 3300049586 Ga0501070_0024928 Ga0501070_0024928_1270_1920 216
37 3300049822 Ga0501035_0013965 Ga0501035_0013965_3974_4624 216
38 3300049823 Ga0501044_0041363 Ga0501044_0041363_3599_4249 216
39 3300013102 Ga0157371_10005745 Ga0157371_100057454 217
40 3300013308 Ga0157375_10956659 Ga0157375_109566591 217
41 3300026067 Ga0207678_10154959 Ga0207678_101549594 217
42 3300005327 Ga0070658_10378577 Ga0070658_103785772 218
43 3300005616 Ga0068852_100101682 Ga0068852_1001016823 218
44 3300013105 Ga0157369_10136441 Ga0157369_101364412 218
45 3300020082 Ga0206353_10927906 Ga0206353_109279063 218
46 3300022467 Ga0224712_10029813 Ga0224712_100298133 218
47 3300049822 Ga0501035_0259317 Ga0501035_0259317_34_696 220
48 3300049823 Ga0501044_0548924 Ga0501044_0548924_199_861 220
49 3300046691 Ga0495670_0070980 Ga0495670_0070980_20_739 226
50 iso_pu_bacteria 2907202186 2907206564 226
51 iso_pu_bacteria 2956897341 2956900283 226
52 3300006048 Ga0075363_100176055 Ga0075363_1001760552 227
53 3300006353 Ga0075370_10228706 Ga0075370_102287062 227
54 3300049572 Ga0501036_0033743 Ga0501036_0033743_1794_2483 227
55 3300049574 Ga0501038_0071081 Ga0501038_0071081_1661_2350 227
56 3300049575 Ga0501039_0140830 Ga0501039_0140830_164_853 227
57 3300049578 Ga0501042_0159727 Ga0501042_0159727_544_1233 227
58 3300049582 Ga0501048_0220196 Ga0501048_0220196_321_1010 227
59 3300049588 Ga0501072_0051805 Ga0501072_0051805_528_1217 227
60 3300049593 Ga0501077_0214690 Ga0501077_0214690_143_832 227
61 3300049741 Ga0501079_0493632 Ga0501079_0493632_160_849 227
62 3300049743 Ga0501081_0384042 Ga0501081_0384042_322_1011 227
63 3300060353 Ga0501082_0130132 Ga0501082_0130132_1050_1739 227
64 iso_pu_bacteria 2512564039 2512732997 227
65 iso_pu_bacteria 3006826541 3006831802 227
66 iso_pu_bacteria 2739367898 2740166691 228
67 iso_pu_bacteria 2791355222 2793182898 228
68 iso_pu_bacteria 2808606364 2808868946 228
69 iso_pu_bacteria 2904113452 2904114449 228
70 iso_pu_bacteria 2904113452 2904115465 228
71 3300059508 Ga0587088_018606 Ga0587088_018606_114_815 229
72 iso_pu_bacteria 2738541299 2738838506 229
73 iso_pu_bacteria 2788500588 2791215596 229
74 iso_pu_bacteria 2818991451 2819627206 229
75 iso_pu_bacteria 2904606771 2904609276 229
76 iso_pu_bacteria 2936361878 2936366800 229
77 iso_pu_bacteria 2939593269 2939595769 229
78 iso_pu_bacteria 3006984091 3006987528 230
79 iso_pu_bacteria 3006988479 3006991758 230
80 iso_pu_bacteria 8055531788 8055536776 230
81 3300005339 Ga0070660_100079440 Ga0070660_1000794404 231
82 3300005563 Ga0068855_100015397 Ga0068855_1000153973 231
83 3300005616 Ga0068852_100086200 Ga0068852_1000862003 231
84 3300009093 Ga0105240_10085339 Ga0105240_100853392 231
85 3300013104 Ga0157370_10006943 Ga0157370_100069436 231
86 3300013105 Ga0157369_10041072 Ga0157369_100410724 231
87 3300025909 Ga0207705_10092270 Ga0207705_100922701 231
88 3300025913 Ga0207695_10033348 Ga0207695_100333485 231
89 3300025919 Ga0207657_10118888 Ga0207657_101188881 231
90 3300026142 Ga0207698_10175417 Ga0207698_101754172 231
91 3300037466 Ga0395898_0034514 Ga0395898_0034514_1270_1977 231
92 3300048923 Ga0496120_0181651 Ga0496120_0181651_259_984 231
93 3300048925 Ga0496122_0011657 Ga0496122_0011657_6802_7527 231
94 3300048925 Ga0496122_0040635 Ga0496122_0040635_1014_1739 231
95 iso_pu_bacteria 2551306519 2553397231 231
96 iso_pu_bacteria 2593339131 2595089461 231
97 iso_pu_bacteria 2643221729 2644707117 231
98 iso_pu_bacteria 2643221730 2644714333 231
99 iso_pu_bacteria 2643221731 2644719263 231
100 iso_pu_bacteria 2643221732 2644722310 231
101 iso_pu_bacteria 2684622632 2685153669 231
102 iso_pu_bacteria 2684623153 2686996986 231
103 iso_pu_bacteria 2687453109 2687498293 231
104 iso_pu_bacteria 2695420987 2698319501 231
105 iso_pu_bacteria 2703719227 2705992169 231
106 iso_pu_bacteria 2718218445 2721503601 231
107 iso_pu_bacteria 2738541358 2739160669 231
108 iso_pu_bacteria 2738543006 2739213387 231
109 iso_pu_bacteria 2818991441 2819570697 231
110 iso_pu_bacteria 2818991443 2819585461 231
111 iso_pu_bacteria 2818991465 2819708003 231
112 iso_pu_bacteria 2823526263 2823528142 231
113 iso_pu_bacteria 2842882022 2842885200 231
114 iso_pu_bacteria 2904524088 2904527638 231
115 iso_pu_bacteria 2908665501 2908665589 231
116 iso_pu_bacteria 2919093281 2919094305 231
117 iso_pu_bacteria 2919143609 2919143717 231
118 iso_pu_bacteria 2919517244 2919520747 231
119 iso_pu_bacteria 2919720352 2919724529 231
120 iso_pu_bacteria 2925326138 2925333551 231
121 iso_pu_bacteria 2928093941 2928097437 231
122 iso_pu_bacteria 2929004312 2929004584 231
123 iso_pu_bacteria 2929233124 2929233454 231
124 iso_pu_bacteria 2938917290 2938917649 231
125 iso_pu_bacteria 2947426588 2947426916 231
126 iso_pu_bacteria 2954773129 2954774343 231
127 iso_pu_bacteria 2960319331 2960323048 231
128 iso_pu_bacteria 2960319331 2960324326 231
129 iso_pu_bacteria 2960375949 2960381614 231
130 iso_pu_bacteria 2965761152 2965767187 231
131 iso_pu_bacteria 2979083700 2979083929 231
132 iso_pu_bacteria 3006978542 3006982723 231
133 iso_pu_bacteria 8022621104 8022621379 231
134 iso_pu_bacteria 8022792930 8022799179 231
135 iso_pu_bacteria 8022893055 8022893760 231
136 iso_pu_bacteria 8022914991 8022915506 231
137 iso_pu_bacteria 8023438354 8023441676 231
138 iso_pu_bacteria 8023444577 8023448565 231
139 3300028800 Ga0265338_10328748 Ga0265338_103287482 232
140 3300037418 Ga0395900_0226162 Ga0395900_0226162_298_1011 232
141 3300048919 Ga0496116_0011993 Ga0496116_0011993_710_1414 232
142 3300048919 Ga0496116_0021194 Ga0496116_0021194_3930_4673 232
143 3300048922 Ga0496119_0013101 Ga0496119_0013101_1494_2198 232
144 3300048922 Ga0496119_0023718 Ga0496119_0023718_127_831 232
145 3300048922 Ga0496119_0095809 Ga0496119_0095809_658_1401 232
146 3300048923 Ga0496120_0002652 Ga0496120_0002652_16699_17403 232
147 3300048923 Ga0496120_0018683 Ga0496120_0018683_3500_4204 232
148 3300048923 Ga0496120_0126235 Ga0496120_0126235_524_1267 232
149 3300048924 Ga0496121_0234279 Ga0496121_0234279_174_917 232
150 3300048925 Ga0496122_0010299 Ga0496122_0010299_1054_1761 232
151 3300048925 Ga0496122_0255760 Ga0496122_0255760_48_752 232
152 3300048927 Ga0496124_0000358 Ga0496124_0000358_61836_62540 232
153 3300048927 Ga0496124_0001985 Ga0496124_0001985_14921_15664 232
154 3300048929 Ga0496126_0001637 Ga0496126_0001637_16957_17661 232
155 3300048929 Ga0496126_0001968 Ga0496126_0001968_10781_11488 232
156 iso_pu_bacteria 2919414237 2919415960 232
157 3300003187 JGI25151J46595_10006893 JGI25151J46595_100068935 233
158 3300003751 Ga0055538_1000101 Ga0055538_100010115 233
159 3300003751 Ga0055538_1000427 Ga0055538_100042711 233
160 3300003781 Ga0055536_1017480 Ga0055536_10174802 233
161 3300003781 Ga0055536_1018971 Ga0055536_10189712 233
162 3300009036 Ga0105244_10061903 Ga0105244_100619033 233
163 3300025224 Ga0209784_100165 Ga0209784_10016540 233
164 3300025292 Ga0209676_1000533 Ga0209676_100053322 233
165 3300025292 Ga0209676_1008742 Ga0209676_10087422 233
166 3300025294 Ga0209025_1003510 Ga0209025_10035105 233
167 3300025294 Ga0209025_1013726 Ga0209025_10137264 233
168 3300025294 Ga0209025_1026995 Ga0209025_10269952 233
169 3300032002 Ga0307416_100068820 Ga0307416_1000688204 233
170 3300049161 Ga0501305_010515 Ga0501305_010515_500_1222 233
171 3300003187 JGI25151J46595_10003817 JGI25151J46595_100038178 234
172 3300025294 Ga0209025_1001718 Ga0209025_100171811 234
173 3300027312 Ga0209371_1022038 Ga0209371_10220382 234
174 3300030500 Ga0268256_1015856 Ga0268256_10158562 234
175 3300002987 JGI25159J45721_1009463 JGI25159J45721_10094632 235
176 3300002987 JGI25159J45721_1011017 JGI25159J45721_10110172 235
177 3300003187 JGI25151J46595_10005998 JGI25151J46595_100059983 235
178 3300003187 JGI25151J46595_10023546 JGI25151J46595_100235462 235
179 3300003187 JGI25151J46595_10045137 JGI25151J46595_100451372 235
180 3300003187 JGI25151J46595_10066897 JGI25151J46595_100668972 235
181 3300003316 rootH1_10001198 rootH1_1000119846 235
182 3300003320 rootH2_10134014 rootH2_101340142 235
183 3300003322 rootL2_10020976 rootL2_100209769 235
184 3300003578 Ga0006562J51391_1008264 Ga0006562J51391_10082643 235
185 3300003578 Ga0006562J51391_1012747 Ga0006562J51391_10127473 235
186 3300003758 Ga0055532_1000256 Ga0055532_10002568 235
187 3300003790 Ga0055528_1002289 Ga0055528_10022899 235
188 3300005355 Ga0070671_100141785 Ga0070671_1001417851 235
189 3300009011 Ga0105251_10034779 Ga0105251_100347793 235
190 3300009011 Ga0105251_10036445 Ga0105251_100364454 235
191 3300009011 Ga0105251_10071901 Ga0105251_100719012 235
192 3300009036 Ga0105244_10037676 Ga0105244_100376763 235
193 3300009036 Ga0105244_10040163 Ga0105244_100401634 235
194 3300009036 Ga0105244_10061440 Ga0105244_100614402 235
195 3300009092 Ga0105250_10022494 Ga0105250_100224943 235
196 3300009092 Ga0105250_10034212 Ga0105250_100342122 235
197 3300009148 Ga0105243_10034103 Ga0105243_100341033 235
198 3300009176 Ga0105242_10881173 Ga0105242_108811731 235
199 3300010375 Ga0105239_10906212 Ga0105239_109062121 235
200 3300011119 Ga0105246_10150890 Ga0105246_101508902 235
201 3300013307 Ga0157372_10400313 Ga0157372_104003132 235
202 3300014745 Ga0157377_10021646 Ga0157377_100216462 235
203 3300025229 Ga0209147_100324 Ga0209147_1003247 235
204 3300025229 Ga0209147_100599 Ga0209147_10059919 235
205 3300025229 Ga0209147_103980 Ga0209147_1039802 235
206 3300025284 Ga0209130_1010020 Ga0209130_10100202 235
207 3300025284 Ga0209130_1010757 Ga0209130_10107573 235
208 3300025294 Ga0209025_1003985 Ga0209025_10039852 235
209 3300025294 Ga0209025_1028940 Ga0209025_10289403 235
210 3300025294 Ga0209025_1029023 Ga0209025_10290232 235
211 3300025294 Ga0209025_1029396 Ga0209025_10293962 235
212 3300025294 Ga0209025_1029406 Ga0209025_10294061 235
213 3300025294 Ga0209025_1029824 Ga0209025_10298242 235
214 3300025294 Ga0209025_1030129 Ga0209025_10301291 235
215 3300025294 Ga0209025_1031741 Ga0209025_10317413 235
216 3300025294 Ga0209025_1039981 Ga0209025_10399812 235
217 3300025294 Ga0209025_1040094 Ga0209025_10400941 235
218 3300025294 Ga0209025_1070396 Ga0209025_10703961 235
219 3300025302 Ga0207426_1004770 Ga0207426_10047703 235
220 3300025711 Ga0207696_1013738 Ga0207696_10137381 235
221 3300025711 Ga0207696_1017644 Ga0207696_10176443 235
222 3300025711 Ga0207696_1022483 Ga0207696_10224831 235
223 3300025711 Ga0207696_1037480 Ga0207696_10374801 235
224 3300025711 Ga0207696_1039618 Ga0207696_10396181 235
225 3300025728 Ga0207655_1030086 Ga0207655_10300861 235
226 3300025728 Ga0207655_1058117 Ga0207655_10581172 235
227 3300025735 Ga0207713_1020956 Ga0207713_10209564 235
228 3300025735 Ga0207713_1041472 Ga0207713_10414721 235
229 3300025735 Ga0207713_1106647 Ga0207713_11066471 235
230 3300025935 Ga0207709_10023231 Ga0207709_100232312 235
231 3300030083 Ga0237817_10743 Ga0237817_107432 235
232 3300030083 Ga0237817_10754 Ga0237817_107542 235
233 3300031548 Ga0307408_100073088 Ga0307408_1000730883 235
234 3300031901 Ga0307406_10576945 Ga0307406_105769451 235
235 3300038705 Ga0237819_03867 Ga0237819_03867_1475_2203 235
236 3300038705 Ga0237819_03924 Ga0237819_03924_290_1021 235
237 3300044765 Ga0466970_0111850 Ga0466970_0111850_48_788 235
238 3300045976 Ga0466967_0106384 Ga0466967_0106384_346_1077 235
239 3300046455 Ga0495603_0043678 Ga0495603_0043678_467_1207 235
240 3300046492 Ga0495585_0097776 Ga0495585_0097776_727_1467 235
241 3300048903 Ga0496100_0214551 Ga0496100_0214551_455_1195 235
242 3300048904 Ga0496101_0014035 Ga0496101_0014035_2355_3095 235
243 3300048905 Ga0496102_0008258 Ga0496102_0008258_397_1137 235
244 3300048906 Ga0496103_0024018 Ga0496103_0024018_455_1195 235
245 3300048907 Ga0496104_0013928 Ga0496104_0013928_3843_4583 235
246 3300048908 Ga0496105_0010157 Ga0496105_0010157_2483_3223 235
247 3300048909 Ga0496106_0000564 Ga0496106_0000564_6406_7146 235
248 3300048910 Ga0496107_0000196 Ga0496107_0000196_7957_8697 235
249 3300048911 Ga0496108_0002965 Ga0496108_0002965_7575_8315 235
250 3300048912 Ga0496109_0002204 Ga0496109_0002204_7463_8203 235
251 3300048913 Ga0496110_0553269 Ga0496110_0553269_36_776 235
252 3300048915 Ga0496112_0006001 Ga0496112_0006001_2355_3095 235
253 3300048916 Ga0496113_0001817 Ga0496113_0001817_9033_9773 235
254 3300048919 Ga0496116_0000253 Ga0496116_0000253_40173_40889 235
255 3300048919 Ga0496116_0005382 Ga0496116_0005382_50_790 235
256 3300048922 Ga0496119_0051036 Ga0496119_0051036_312_1052 235
257 3300048925 Ga0496122_0007874 Ga0496122_0007874_1472_2212 235
258 3300048925 Ga0496122_0181095 Ga0496122_0181095_397_1113 235
259 3300048926 Ga0496123_0096676 Ga0496123_0096676_124_864 235
260 3300048928 Ga0496125_0043732 Ga0496125_0043732_2447_3187 235
261 3300048929 Ga0496126_0007050 Ga0496126_0007050_4262_5002 235
262 3300049523 Ga0501300_020566 Ga0501300_020566_58_789 235
263 3300049704 Ga0501221_024750 Ga0501221_024750_54_785 235
264 2010549000 RicEn_FSXC10653_g1 RicEn_237220 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

2

206

0.96

PF13462

Thioredoxin_4

Thioredoxin

83

207

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gl5-assembly1.cif.gz_A-2 crystal structure of probable dsba oxidoreductase sco1869 from streptomyces coelicolor 0.9506 1 210
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9129 2 233
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.91 2 234
5y1a-assembly1.cif.gz_A hbp35 of porphyromonas gingivalis 0.9082 2 41
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9015 2 233
ID Description Score Start End Superfamily
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9631 2 207 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9453 2 207 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9384 1 207 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9298 1 207 3.40.30.10
af_I1KWJ3_9_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8922 2 205 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A229UH36-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9841 1 152 GO:0016491
AF-A0A4U1D913-F1-model_v4 DsbA family oxidoreductase 0.9747 17 210 GO:0016491
AF-A0A6P1AQQ3-F1-model_v4 deleted 0.9725 1 210
AF-A0A229UH36-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9715 1 152 GO:0016491
AF-A0A3S1B5W0-F1-model_v4 DsbA family oxidoreductase 0.971 1 212 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.61 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map