F372198

General Info

Members Datasets Scaffolds Average Seq Length
263 175 252 285

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_381_c3|nmdc:mga0k408_381_c3_14400_15359
Length 319
Sequence LTGYDIKQINKRPFSWLCFLLKAILAPDKLYLGMKVMKIIKESISIGLGILAAGFGLKGFLLSSHFIDGGVTGVSMLVADISAVPISLLIFIINVPFLWLGYKKLGLWFAIKSTVAIGLLSVSLVVINFPDVTHDKLLTAVFGGVFIGTGSGLAMRGGAVLDGTEIAAVLISKRTQLLKVSDFILLLNVLIFGLAAFLLGVEPAMYSILTYMAAAKMIDFILNGIEQYSGITVVSIHSEAIRRAITLTLGRGVTIYQGKSGYGKDGHVNDPRDIIFTVATRLEIPSLKQTILRIDPKAFIVQQSVDDTTGGLLKRKGLH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
4 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.82
Metatranscriptomes 0
Isolates 4.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 0.38
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 7.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_462792 2162886007 Bacteria 1239
2 JGI24737J22298_10000123 3300001990 Bacteria 23564
3 JGI24735J21928_10000006 3300002067 Bacteria 339303
4 JGI24744J21845_10002708 3300002077 Bacteria 3615
5 rootH1_10031496 3300003316 Bacteria 7170
6 rootH2_10003875 3300003320 Bacteria 32454
7 rootL2_10218701 3300003322 Bacteria 2386
8 rootH1_10123158 3300003323 Bacteria 2038
9 rootH1_10151461 3300003323 Bacteria 2827
10 rootH1_10251722 3300003323 Bacteria 4426
11 rootH1_10328500 3300003323 Bacteria 2179
12 Ga0065704_10002439 3300005289 Bacteria 7799
13 Ga0065712_10069653 3300005290 Bacteria 6923
14 Ga0065712_10128728 3300005290 Unclassified 1551
15 Ga0065715_10115634 3300005293 Bacteria 2408
16 Ga0065707_10001185 3300005295 Bacteria 10540
17 Ga0070658_10000254 3300005327 Bacteria 46924
18 Ga0070658_10000368 3300005327 Bacteria 39342
19 Ga0070676_10000806 3300005328 Bacteria 15501
20 Ga0070683_100046142 3300005329 Bacteria 4024
21 Ga0070690_100008289 3300005330 Bacteria 5977
22 Ga0070690_100015325 3300005330 Unclassified 4570
23 Ga0070682_100000027 3300005337 Bacteria 188799
24 Ga0068868_100023654 3300005338 Bacteria 4652
25 Ga0068868_100100498 3300005338 Bacteria 2340
26 Ga0070660_100030351 3300005339 Bacteria 4055
27 Ga0070687_100061379 3300005343 Unclassified 1987
28 Ga0070692_10059458 3300005345 Unclassified 2009
29 Ga0070669_100090761 3300005353 Unclassified 2290
30 Ga0070671_100000925 3300005355 Bacteria 21446
31 Ga0070671_100010341 3300005355 Bacteria 7485
32 Ga0070674_100013787 3300005356 Bacteria 5005
33 Ga0070673_100004384 3300005364 Bacteria 8918
34 Ga0070659_100012795 3300005366 Bacteria 6231
35 Ga0070678_100056873 3300005456 Bacteria 2863
36 Ga0070662_100001605 3300005457 Bacteria 13949
37 Ga0068867_100001592 3300005459 Bacteria 15771
38 Ga0070698_100101873 3300005471 Bacteria 2843
39 Ga0070684_100039867 3300005535 Bacteria 4042
40 Ga0068853_100017941 3300005539 Bacteria 5849
41 Ga0068853_100026472 3300005539 Bacteria 4870
42 Ga0070672_100116566 3300005543 Bacteria 2182
43 Ga0070665_100000367 3300005548 Bacteria 67579
44 Ga0068855_100000172 3300005563 Bacteria 82970
45 Ga0068855_100000249 3300005563 Bacteria 67932
46 Ga0068855_100000574 3300005563 Bacteria 45033
47 Ga0068855_100072312 3300005563 Bacteria 4009
48 Ga0068855_100146036 3300005563 Bacteria 2692
49 Ga0068855_100156806 3300005563 Bacteria 2586
50 Ga0068857_100106746 3300005577 Bacteria 2515
51 Ga0068856_100001222 3300005614 Bacteria 26913
52 Ga0068856_100086323 3300005614 Bacteria 3118
53 Ga0068856_100102784 3300005614 Bacteria 2851
54 Ga0068852_100001838 3300005616 Bacteria 14437
55 Ga0068852_100631457 3300005616 Bacteria 1077
56 Ga0068864_100221640 3300005618 Bacteria 1745
57 Ga0068866_10022021 3300005718 Bacteria 2944
58 Ga0068851_10153278 3300005834 Bacteria 1261
59 Ga0068870_10179656 3300005840 Bacteria 1269
60 Ga0068863_100024754 3300005841 Bacteria 5725
61 Ga0068858_100095779 3300005842 Bacteria 2766
62 Ga0075365_10001996 3300006038 Bacteria 9668
63 Ga0075366_10006526 3300006195 Bacteria 6397
64 Ga0075366_10015420 3300006195 Bacteria 4380
65 Ga0097621_100000418 3300006237 Bacteria 29674
66 Ga0068871_100000043 3300006358 Bacteria 67759
67 Ga0068871_100265879 3300006358 Bacteria 1497
68 Ga0075434_100065506 3300006871 Bacteria 3618
69 Ga0075434_100129793 3300006871 Bacteria 2539
70 Ga0075434_100131283 3300006871 Bacteria 2524
71 Ga0068865_100000587 3300006881 Bacteria 20419
72 Ga0075436_100212019 3300006914 Bacteria 1373
73 Ga0075435_100083148 3300007076 Bacteria 2632
74 Ga0105240_10009931 3300009093 Bacteria 13420
75 Ga0105240_10072838 3300009093 Bacteria 4245
76 Ga0105240_10232973 3300009093 Bacteria 2139
77 Ga0105240_10253319 3300009093 Bacteria 2035
78 Ga0114129_10251534 3300009147 Archaea 2372
79 Ga0114129_10416104 3300009147 Bacteria 1769
80 Ga0105241_10000784 3300009174 Bacteria 24141
81 Ga0105241_10004847 3300009174 Bacteria 9924
82 Ga0105241_10058040 3300009174 Bacteria 2971
83 Ga0105242_10021503 3300009176 Bacteria 5067
84 Ga0105248_10031663 3300009177 Bacteria 5908
85 Ga0105248_10105598 3300009177 Bacteria 3176
86 Ga0105237_10001869 3300009545 Bacteria 26863
87 Ga0105237_10002830 3300009545 Bacteria 21104
88 Ga0105237_10015729 3300009545 Bacteria 7866
89 Ga0105237_10024963 3300009545 Bacteria 6114
90 Ga0105238_10006998 3300009551 Bacteria 11277
91 Ga0105239_10004534 3300010375 Bacteria 16549
92 Ga0105239_10004850 3300010375 Bacteria 15914
93 Ga0105239_10111540 3300010375 Bacteria 3032
94 Ga0105239_10158867 3300010375 Bacteria 2525
95 Ga0105239_10801590 3300010375 Unclassified 1079
96 Ga0157373_10000119 3300013100 Bacteria 62053
97 Ga0157373_10226802 3300013100 Unclassified 1319
98 Ga0157371_10024704 3300013102 Bacteria 4384
99 Ga0157369_10413292 3300013105 Bacteria 1399
100 Ga0157374_10000393 3300013296 Bacteria 39683
101 Ga0157374_10000575 3300013296 Bacteria 32602
102 Ga0157374_10081957 3300013296 Bacteria 3062
103 Ga0157378_10004547 3300013297 Bacteria 12167
104 Ga0157378_10047960 3300013297 Bacteria 3798
105 Ga0157378_10052182 3300013297 Bacteria 3638
106 Ga0157378_10125024 3300013297 Bacteria 2375
107 Ga0163162_10000457 3300013306 Bacteria 37808
108 Ga0163162_10000831 3300013306 Bacteria 28720
109 Ga0157372_10000193 3300013307 Bacteria 67258
110 Ga0157372_10094770 3300013307 Bacteria 3400
111 Ga0157375_10003673 3300013308 Bacteria 13321
112 Ga0157375_10021086 3300013308 Bacteria 5968
113 Ga0157375_10057819 3300013308 Bacteria 3835
114 Ga0157375_10209839 3300013308 Unclassified 2105
115 Ga0163163_10006852 3300014325 Bacteria 10001
116 Ga0157380_10008887 3300014326 Bacteria 7179
117 Ga0157377_10016661 3300014745 Bacteria 3785
118 Ga0157376_10206357 3300014969 Bacteria 1811
119 Ga0163161_10090524 3300017792 Unclassified 2264
120 Ga0163161_10188987 3300017792 Bacteria 1582
121 Ga0213872_10005216 3300021361 Bacteria 6721
122 Ga0209437_100077 3300025233 Bacteria 286656
123 Ga0209026_1000748 3300025250 Bacteria 18488
124 Ga0207710_10003633 3300025900 Bacteria 6840
125 Ga0207647_10000495 3300025904 Bacteria 31517
126 Ga0207647_10010480 3300025904 Bacteria 6546
127 Ga0207645_10000205 3300025907 Bacteria 48288
128 Ga0207705_10000384 3300025909 Bacteria 39520
129 Ga0207705_10078746 3300025909 Bacteria 2399
130 Ga0207654_10015574 3300025911 Bacteria 3949
131 Ga0207654_10029768 3300025911 Bacteria 2992
132 Ga0207695_10105079 3300025913 Bacteria 2812
133 Ga0207695_10140770 3300025913 Bacteria 2361
134 Ga0207695_10144168 3300025913 Bacteria 2327
135 Ga0207671_10001237 3300025914 Bacteria 30177
136 Ga0207671_10006387 3300025914 Bacteria 10508
137 Ga0207671_10016541 3300025914 Bacteria 5728
138 Ga0207671_10032000 3300025914 Bacteria 3916
139 Ga0207662_10011879 3300025918 Bacteria 4841
140 Ga0207657_10024229 3300025919 Bacteria 5630
141 Ga0207694_10070456 3300025924 Bacteria 2732
142 Ga0207650_10442132 3300025925 Unclassified 1081
143 Ga0207644_10002216 3300025931 Bacteria 12616
144 Ga0207644_10012048 3300025931 Bacteria 5734
145 Ga0207690_10005404 3300025932 Bacteria 7528
146 Ga0207690_10025534 3300025932 Bacteria 3711
147 Ga0207706_10000553 3300025933 Bacteria 39805
148 Ga0207706_10125980 3300025933 Bacteria 2253
149 Ga0207686_10084411 3300025934 Bacteria 2081
150 Ga0207669_10089398 3300025937 Bacteria 2000
151 Ga0207704_10000341 3300025938 Bacteria 21653
152 Ga0207704_10471620 3300025938 Unclassified 1006
153 Ga0207691_10123113 3300025940 Bacteria 2296
154 Ga0207667_10000095 3300025949 Bacteria 143866
155 Ga0207667_10000288 3300025949 Bacteria 69604
156 Ga0207667_10004229 3300025949 Bacteria 17622
157 Ga0207667_10032471 3300025949 Bacteria 5625
158 Ga0207667_10053570 3300025949 Bacteria 4245
159 Ga0207667_10133527 3300025949 Bacteria 2557
160 Ga0207651_10066167 3300025960 Bacteria 2538
161 Ga0207712_10003605 3300025961 Bacteria 9768
162 Ga0207668_10078003 3300025972 Bacteria 2391
163 Ga0207640_10308480 3300025981 Bacteria 1255
164 Ga0207677_10065847 3300026023 Bacteria 2530
165 Ga0207677_10318490 3300026023 Unclassified 1291
166 Ga0207639_10007459 3300026041 Bacteria 7461
167 Ga0207639_10014056 3300026041 Bacteria 5618
168 Ga0207639_10367620 3300026041 Bacteria 1289
169 Ga0207702_10000258 3300026078 Bacteria 61221
170 Ga0207641_10527780 3300026088 Bacteria 1149
171 Ga0207648_10002074 3300026089 Bacteria 21854
172 Ga0207675_100326707 3300026118 Bacteria 1499
173 Ga0207683_10006052 3300026121 Bacteria 10358
174 Ga0207698_10005419 3300026142 Bacteria 7885
175 Ga0207698_10554661 3300026142 Bacteria 1127
176 Ga0268266_10000053 3300028379 Bacteria 295181
177 Ga0268264_10004910 3300028381 Bacteria 11333
178 Ga0265337_1000495 3300028556 Bacteria 20897
179 Ga0265334_10053450 3300028573 Bacteria 1542
180 Ga0307517_10000515 3300028786 Bacteria 66157
181 Ga0307515_10000349 3300028794 Bacteria 114163
182 Ga0307515_10001860 3300028794 Bacteria 46999
183 Ga0265338_10025296 3300028800 Bacteria 6030
184 Ga0265320_10000103 3300031240 Bacteria 72829
185 Ga0307507_10008385 3300033179 Bacteria 14329
186 Ga0307510_10002869 3300033180 Bacteria 19823
187 Ga0373937_0009226 3300036401 Bacteria 8564
188 Ga0373925_0186641 3300037068 Bacteria 1644
189 Ga0395899_0001241 3300037312 Bacteria 22209
190 Ga0395900_0000647 3300037418 Bacteria 46625
191 Ga0395900_0000812 3300037418 Bacteria 41307
192 Ga0395905_0000896 3300037471 Bacteria 38873
193 Ga0395905_0408713 3300037471 Bacteria 1253
194 Ga0395901_0001468 3300038443 Bacteria 24531
195 Ga0436361_0813248 3300039447 Bacteria 14855
196 Ga0451849_0804081 3300041505 Bacteria 1406
197 Ga0439448_0009116 3300042005 Bacteria 2921
198 Ga0451576_0055346 3300045051 Bacteria 4151
199 Ga0451576_0267461 3300045051 Bacteria 1787
200 Ga0495629_0122468 3300046459 Bacteria 1812
201 Ga0495650_0000014 3300046471 Bacteria 581606
202 Ga0495582_0161895 3300046473 Unclassified 1273
203 Ga0495585_0000031 3300046492 Bacteria 143899
204 Ga0495585_0001206 3300046492 Bacteria 20954
205 Ga0495606_0000020 3300046507 Bacteria 274490
206 Ga0495606_0009858 3300046507 Bacteria 8011
207 Ga0495606_0081926 3300046507 Bacteria 2005
208 Ga0495606_0083322 3300046507 Bacteria 1983
209 Ga0495610_0002311 3300046512 Bacteria 16108
210 Ga0495610_0160922 3300046512 Bacteria 949
211 Ga0495631_0006656 3300046518 Bacteria 5942
212 Ga0495632_0083241 3300046519 Bacteria 1524
213 Ga0495644_0007426 3300046523 Bacteria 4226
214 Ga0495648_0003726 3300046524 Bacteria 13299
215 Ga0495663_0000358 3300046525 Bacteria 17020
216 Ga0495652_0107015 3300046529 Bacteria 2257
217 Ga0495598_0000570 3300046537 Bacteria 6934
218 Ga0495621_0001104 3300046539 Bacteria 6945
219 Ga0495633_0000029 3300046558 Bacteria 200381
220 Ga0495633_0007830 3300046558 Bacteria 6098
221 Ga0495668_0000021 3300046616 Bacteria 381308
222 Ga0495625_0000009 3300046660 Bacteria 404954
223 Ga0495625_0000601 3300046660 Bacteria 52410
224 Ga0495625_0019015 3300046660 Bacteria 5345
225 Ga0495625_0027949 3300046660 Bacteria 4236
226 Ga0495661_0000636 3300046665 Bacteria 35605
227 Ga0495661_0005655 3300046665 Bacteria 8860
228 Ga0495661_0027908 3300046665 Bacteria 3620
229 Ga0495671_0015633 3300046692 Bacteria 4062
230 Ga0495649_0000008 3300046694 Bacteria 483706
231 Ga0495649_0059245 3300046694 Bacteria 2062
232 Ga0495600_0239581 3300046809 Bacteria 1156
233 Ga0495660_0007248 3300046810 Bacteria 6528
234 Ga0495683_0087524 3300047323 Bacteria 1513
235 Ga0495687_000602 3300047443 Bacteria 42023
236 Ga0495687_003643 3300047443 Bacteria 10986
237 Ga0495687_005239 3300047443 Bacteria 8338
238 Ga0495677_0041810 3300047445 Bacteria 1678
239 Ga0495684_0082329 3300047471 Bacteria 2442
240 Ga0495686_0000194 3300047472 Bacteria 113904
241 Ga0495686_0003288 3300047472 Bacteria 14130
242 Ga0495614_0018649 3300048089 Bacteria 3005
243 Ga0495682_0037339 3300049460 Bacteria 1788
244 nmdc:mga0yw44_76835_c1 3300050492 Bacteria 2085
245 nmdc:mga0k408_381_c3 3300050493 Bacteria 17837
246 nmdc:mga0k408_657_c1 3300050493 Bacteria 18929
247 nmdc:mga05p37_327980_c1 3300050507 Bacteria 1809
248 nmdc:mga0n895_433053_c1 3300050512 Bacteria 1329
249 nmdc:mga0rr50_363347_c1 3300050513 Bacteria 1219
250 Ga0500608_003284 3300053122 Bacteria 6029
251 Ga0500618_000040 3300053125 Bacteria 112548
252 Ga0500622_0001467 3300053156 Bacteria 18800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100212019 Ga0075436_1002120192 241
2 3300025933 Ga0207706_10125980 Ga0207706_101259802 243
3 3300005355 Ga0070671_100010341 Ga0070671_1000103416 245
4 3300005841 Ga0068863_100024754 Ga0068863_1000247542 245
5 3300025931 Ga0207644_10012048 Ga0207644_100120482 245
6 3300045051 Ga0451576_0267461 Ga0451576_0267461_606_1457 245
7 3300050513 nmdc:mga0rr50_363347_c1 nmdc:mga0rr50_363347_c1_206_1057 245
8 3300006871 Ga0075434_100129793 Ga0075434_1001297932 246
9 3300007076 Ga0075435_100083148 Ga0075435_1000831482 246
10 3300050512 nmdc:mga0n895_433053_c1 nmdc:mga0n895_433053_c1_158_1009 246
11 3300009147 Ga0114129_10416104 Ga0114129_104161042 250
12 3300026118 Ga0207675_100326707 Ga0207675_1003267072 250
13 3300050507 nmdc:mga05p37_327980_c1 nmdc:mga05p37_327980_c1_136_981 250
14 3300046507 Ga0495606_0081926 Ga0495606_0081926_107_916 252
15 3300013297 Ga0157378_10047960 Ga0157378_100479604 253
16 3300046519 Ga0495632_0083241 Ga0495632_0083241_71_904 255
17 3300006038 Ga0075365_10001996 Ga0075365_100019967 257
18 3300050492 nmdc:mga0yw44_76835_c1 nmdc:mga0yw44_76835_c1_846_1694 257
19 3300005471 Ga0070698_100101873 Ga0070698_1001018731 258
20 3300028800 Ga0265338_10025296 Ga0265338_100252965 259
21 3300005842 Ga0068858_100095779 Ga0068858_1000957792 260
22 3300006871 Ga0075434_100131283 Ga0075434_1001312832 260
23 3300025900 Ga0207710_10003633 Ga0207710_100036334 260
24 3300025961 Ga0207712_10003605 Ga0207712_100036058 260
25 3300025972 Ga0207668_10078003 Ga0207668_100780032 260
26 3300026088 Ga0207641_10527780 Ga0207641_105277801 260
27 3300028381 Ga0268264_10004910 Ga0268264_1000491010 260
28 3300037068 Ga0373925_0186641 Ga0373925_0186641_833_1621 260
29 3300005563 Ga0068855_100000172 Ga0068855_10000017255 262
30 3300025949 Ga0207667_10000288 Ga0207667_100002889 262
31 3300042005 Ga0439448_0009116 Ga0439448_0009116_1604_2419 266
32 3300003323 rootH1_10251722 rootH1_102517225 267
33 3300009177 Ga0105248_10105598 Ga0105248_101055983 267
34 3300013296 Ga0157374_10081957 Ga0157374_100819572 267
35 3300013297 Ga0157378_10004547 Ga0157378_100045473 267
36 3300013306 Ga0163162_10000831 Ga0163162_1000083117 267
37 3300013308 Ga0157375_10021086 Ga0157375_100210862 267
38 3300014325 Ga0163163_10006852 Ga0163163_100068527 267
39 3300014969 Ga0157376_10206357 Ga0157376_102063571 267
40 3300025938 Ga0207704_10471620 Ga0207704_104716201 267
41 3300026142 Ga0207698_10554661 Ga0207698_105546611 267
42 3300002077 JGI24744J21845_10002708 JGI24744J21845_100027084 268
43 3300003320 rootH2_10003875 rootH2_1000387526 268
44 3300003323 rootH1_10123158 rootH1_101231582 268
45 3300003323 rootH1_10151461 rootH1_101514612 268
46 3300005290 Ga0065712_10128728 Ga0065712_101287282 268
47 3300005293 Ga0065715_10115634 Ga0065715_101156342 268
48 3300005327 Ga0070658_10000368 Ga0070658_1000036825 268
49 3300005328 Ga0070676_10000806 Ga0070676_100008062 268
50 3300005330 Ga0070690_100008289 Ga0070690_1000082894 268
51 3300005338 Ga0068868_100023654 Ga0068868_1000236543 268
52 3300005338 Ga0068868_100100498 Ga0068868_1001004983 268
53 3300005339 Ga0070660_100030351 Ga0070660_1000303513 268
54 3300005343 Ga0070687_100061379 Ga0070687_1000613792 268
55 3300005345 Ga0070692_10059458 Ga0070692_100594582 268
56 3300005353 Ga0070669_100090761 Ga0070669_1000907611 268
57 3300005355 Ga0070671_100000925 Ga0070671_10000092516 268
58 3300005364 Ga0070673_100004384 Ga0070673_1000043845 268
59 3300005456 Ga0070678_100056873 Ga0070678_1000568732 268
60 3300005457 Ga0070662_100001605 Ga0070662_1000016059 268
61 3300005459 Ga0068867_100001592 Ga0068867_1000015925 268
62 3300005539 Ga0068853_100017941 Ga0068853_1000179414 268
63 3300005539 Ga0068853_100026472 Ga0068853_1000264723 268
64 3300005543 Ga0070672_100116566 Ga0070672_1001165664 268
65 3300005548 Ga0070665_100000367 Ga0070665_10000036744 268
66 3300005563 Ga0068855_100000249 Ga0068855_10000024917 268
67 3300005563 Ga0068855_100000574 Ga0068855_10000057412 268
68 3300005563 Ga0068855_100146036 Ga0068855_1001460362 268
69 3300005614 Ga0068856_100001222 Ga0068856_10000122210 268
70 3300005614 Ga0068856_100086323 Ga0068856_1000863233 268
71 3300005614 Ga0068856_100102784 Ga0068856_1001027843 268
72 3300005616 Ga0068852_100001838 Ga0068852_1000018387 268
73 3300005616 Ga0068852_100631457 Ga0068852_1006314571 268
74 3300005718 Ga0068866_10022021 Ga0068866_100220214 268
75 3300005834 Ga0068851_10153278 Ga0068851_101532782 268
76 3300005840 Ga0068870_10179656 Ga0068870_101796561 268
77 3300006237 Ga0097621_100000418 Ga0097621_10000041831 268
78 3300006358 Ga0068871_100000043 Ga0068871_10000004329 268
79 3300006881 Ga0068865_100000587 Ga0068865_10000058718 268
80 3300009093 Ga0105240_10009931 Ga0105240_100099312 268
81 3300009093 Ga0105240_10072838 Ga0105240_100728383 268
82 3300009174 Ga0105241_10000784 Ga0105241_1000078423 268
83 3300009174 Ga0105241_10004847 Ga0105241_100048476 268
84 3300009174 Ga0105241_10058040 Ga0105241_100580402 268
85 3300009176 Ga0105242_10021503 Ga0105242_100215035 268
86 3300009177 Ga0105248_10031663 Ga0105248_100316632 268
87 3300009545 Ga0105237_10001869 Ga0105237_100018696 268
88 3300009545 Ga0105237_10002830 Ga0105237_1000283016 268
89 3300009551 Ga0105238_10006998 Ga0105238_100069985 268
90 3300010375 Ga0105239_10111540 Ga0105239_101115402 268
91 3300010375 Ga0105239_10801590 Ga0105239_108015901 268
92 3300013100 Ga0157373_10226802 Ga0157373_102268021 268
93 3300013296 Ga0157374_10000393 Ga0157374_1000039321 268
94 3300013296 Ga0157374_10000575 Ga0157374_1000057531 268
95 3300013297 Ga0157378_10052182 Ga0157378_100521822 268
96 3300013306 Ga0163162_10000457 Ga0163162_1000045716 268
97 3300013308 Ga0157375_10003673 Ga0157375_100036736 268
98 3300013308 Ga0157375_10057819 Ga0157375_100578194 268
99 3300014326 Ga0157380_10008887 Ga0157380_100088872 268
100 3300014745 Ga0157377_10016661 Ga0157377_100166613 268
101 3300017792 Ga0163161_10090524 Ga0163161_100905242 268
102 3300021361 Ga0213872_10005216 Ga0213872_100052166 268
103 3300025904 Ga0207647_10000495 Ga0207647_1000049510 268
104 3300025907 Ga0207645_10000205 Ga0207645_1000020547 268
105 3300025909 Ga0207705_10000384 Ga0207705_1000038418 268
106 3300025911 Ga0207654_10015574 Ga0207654_100155743 268
107 3300025911 Ga0207654_10029768 Ga0207654_100297683 268
108 3300025913 Ga0207695_10140770 Ga0207695_101407702 268
109 3300025913 Ga0207695_10144168 Ga0207695_101441682 268
110 3300025914 Ga0207671_10001237 Ga0207671_1000123716 268
111 3300025914 Ga0207671_10016541 Ga0207671_100165413 268
112 3300025918 Ga0207662_10011879 Ga0207662_100118792 268
113 3300025919 Ga0207657_10024229 Ga0207657_100242294 268
114 3300025924 Ga0207694_10070456 Ga0207694_100704562 268
115 3300025931 Ga0207644_10002216 Ga0207644_100022161 268
116 3300025932 Ga0207690_10025534 Ga0207690_100255342 268
117 3300025933 Ga0207706_10000553 Ga0207706_100005539 268
118 3300025934 Ga0207686_10084411 Ga0207686_100844114 268
119 3300025938 Ga0207704_10000341 Ga0207704_1000034116 268
120 3300025940 Ga0207691_10123113 Ga0207691_101231134 268
121 3300025949 Ga0207667_10000095 Ga0207667_1000009517 268
122 3300025949 Ga0207667_10004229 Ga0207667_1000422911 268
123 3300025949 Ga0207667_10032471 Ga0207667_100324712 268
124 3300025960 Ga0207651_10066167 Ga0207651_100661673 268
125 3300026023 Ga0207677_10065847 Ga0207677_100658473 268
126 3300026023 Ga0207677_10318490 Ga0207677_103184901 268
127 3300026041 Ga0207639_10007459 Ga0207639_100074594 268
128 3300026041 Ga0207639_10014056 Ga0207639_100140564 268
129 3300026041 Ga0207639_10367620 Ga0207639_103676201 268
130 3300026078 Ga0207702_10000258 Ga0207702_100002584 268
131 3300026089 Ga0207648_10002074 Ga0207648_1000207411 268
132 3300026121 Ga0207683_10006052 Ga0207683_100060528 268
133 3300026142 Ga0207698_10005419 Ga0207698_100054193 268
134 3300028379 Ga0268266_10000053 Ga0268266_10000053225 268
135 3300028786 Ga0307517_10000515 Ga0307517_1000051524 268
136 3300033180 Ga0307510_10002869 Ga0307510_100028694 268
137 3300037312 Ga0395899_0001241 Ga0395899_0001241_14056_14928 268
138 3300037418 Ga0395900_0000647 Ga0395900_0000647_12579_13436 268
139 3300037418 Ga0395900_0000812 Ga0395900_0000812_12856_13728 268
140 3300037471 Ga0395905_0000896 Ga0395905_0000896_24698_25570 268
141 3300038443 Ga0395901_0001468 Ga0395901_0001468_10240_11112 268
142 3300039447 Ga0436361_0813248 Ga0436361_0813248_3560_4432 268
143 3300046518 Ga0495631_0006656 Ga0495631_0006656_3366_4238 268
144 3300046523 Ga0495644_0007426 Ga0495644_0007426_2213_3070 268
145 3300046665 Ga0495661_0000636 Ga0495661_0000636_19129_19986 268
146 3300046694 Ga0495649_0059245 Ga0495649_0059245_112_984 268
147 3300047443 Ga0495687_000602 Ga0495687_000602_38235_39164 268
148 3300047445 Ga0495677_0041810 Ga0495677_0041810_785_1642 268
149 3300053122 Ga0500608_003284 Ga0500608_003284_2878_3750 268
150 iso_pu_bacteria 2687453341 2688391533 268
151 2162886007 SwRhRL2b_contig_462792 SwRhRL2b_0431.00006150 269
152 3300001990 JGI24737J22298_10000123 JGI24737J22298_1000012312 269
153 3300002067 JGI24735J21928_10000006 JGI24735J21928_1000000663 269
154 3300003316 rootH1_10031496 rootH1_100314965 269
155 3300003322 rootL2_10218701 rootL2_102187013 269
156 3300003323 rootH1_10328500 rootH1_103285002 269
157 3300005289 Ga0065704_10002439 Ga0065704_100024397 269
158 3300005290 Ga0065712_10069653 Ga0065712_100696532 269
159 3300005295 Ga0065707_10001185 Ga0065707_100011855 269
160 3300005327 Ga0070658_10000254 Ga0070658_1000025427 269
161 3300005329 Ga0070683_100046142 Ga0070683_1000461424 269
162 3300005330 Ga0070690_100015325 Ga0070690_1000153255 269
163 3300005337 Ga0070682_100000027 Ga0070682_10000002749 269
164 3300005356 Ga0070674_100013787 Ga0070674_1000137875 269
165 3300005366 Ga0070659_100012795 Ga0070659_1000127957 269
166 3300005535 Ga0070684_100039867 Ga0070684_1000398675 269
167 3300005563 Ga0068855_100072312 Ga0068855_1000723122 269
168 3300005563 Ga0068855_100156806 Ga0068855_1001568063 269
169 3300005577 Ga0068857_100106746 Ga0068857_1001067462 269
170 3300005618 Ga0068864_100221640 Ga0068864_1002216402 269
171 3300006195 Ga0075366_10006526 Ga0075366_100065264 269
172 3300006195 Ga0075366_10015420 Ga0075366_100154203 269
173 3300006358 Ga0068871_100265879 Ga0068871_1002658792 269
174 3300006871 Ga0075434_100065506 Ga0075434_1000655063 269
175 3300009093 Ga0105240_10232973 Ga0105240_102329734 269
176 3300009093 Ga0105240_10253319 Ga0105240_102533192 269
177 3300009147 Ga0114129_10251534 Ga0114129_102515342 269
178 3300009545 Ga0105237_10015729 Ga0105237_100157296 269
179 3300009545 Ga0105237_10024963 Ga0105237_100249635 269
180 3300010375 Ga0105239_10004534 Ga0105239_100045345 269
181 3300010375 Ga0105239_10004850 Ga0105239_100048504 269
182 3300010375 Ga0105239_10158867 Ga0105239_101588673 269
183 3300013100 Ga0157373_10000119 Ga0157373_1000011910 269
184 3300013102 Ga0157371_10024704 Ga0157371_100247044 269
185 3300013105 Ga0157369_10413292 Ga0157369_104132922 269
186 3300013297 Ga0157378_10125024 Ga0157378_101250243 269
187 3300013307 Ga0157372_10000193 Ga0157372_100001935 269
188 3300013307 Ga0157372_10094770 Ga0157372_100947702 269
189 3300013308 Ga0157375_10209839 Ga0157375_102098393 269
190 3300017792 Ga0163161_10188987 Ga0163161_101889872 269
191 3300025233 Ga0209437_100077 Ga0209437_100077146 269
192 3300025250 Ga0209026_1000748 Ga0209026_10007489 269
193 3300025904 Ga0207647_10010480 Ga0207647_100104808 269
194 3300025909 Ga0207705_10078746 Ga0207705_100787463 269
195 3300025913 Ga0207695_10105079 Ga0207695_101050792 269
196 3300025914 Ga0207671_10006387 Ga0207671_100063877 269
197 3300025914 Ga0207671_10032000 Ga0207671_100320002 269
198 3300025925 Ga0207650_10442132 Ga0207650_104421321 269
199 3300025932 Ga0207690_10005404 Ga0207690_100054046 269
200 3300025937 Ga0207669_10089398 Ga0207669_100893982 269
201 3300025949 Ga0207667_10053570 Ga0207667_100535704 269
202 3300025949 Ga0207667_10133527 Ga0207667_101335272 269
203 3300025981 Ga0207640_10308480 Ga0207640_103084802 269
204 3300028556 Ga0265337_1000495 Ga0265337_10004955 269
205 3300028573 Ga0265334_10053450 Ga0265334_100534501 269
206 3300028794 Ga0307515_10000349 Ga0307515_1000034935 269
207 3300028794 Ga0307515_10001860 Ga0307515_1000186027 269
208 3300031240 Ga0265320_10000103 Ga0265320_1000010347 269
209 3300033179 Ga0307507_10008385 Ga0307507_1000838514 269
210 3300036401 Ga0373937_0009226 Ga0373937_0009226_1449_2303 269
211 3300037471 Ga0395905_0408713 Ga0395905_0408713_30_878 269
212 3300041505 Ga0451849_0804081 Ga0451849_0804081_77_940 269
213 3300045051 Ga0451576_0055346 Ga0451576_0055346_519_1328 269
214 3300046459 Ga0495629_0122468 Ga0495629_0122468_586_1440 269
215 3300046471 Ga0495650_0000014 Ga0495650_0000014_551837_552733 269
216 3300046473 Ga0495582_0161895 Ga0495582_0161895_16_831 269
217 3300046492 Ga0495585_0000031 Ga0495585_0000031_118456_119316 269
218 3300046492 Ga0495585_0001206 Ga0495585_0001206_10513_11373 269
219 3300046507 Ga0495606_0000020 Ga0495606_0000020_12143_13003 269
220 3300046507 Ga0495606_0009858 Ga0495606_0009858_6027_6887 269
221 3300046507 Ga0495606_0083322 Ga0495606_0083322_670_1536 269
222 3300046512 Ga0495610_0002311 Ga0495610_0002311_6959_7855 269
223 3300046512 Ga0495610_0160922 Ga0495610_0160922_44_898 269
224 3300046524 Ga0495648_0003726 Ga0495648_0003726_3027_3887 269
225 3300046525 Ga0495663_0000358 Ga0495663_0000358_4781_5635 269
226 3300046529 Ga0495652_0107015 Ga0495652_0107015_569_1429 269
227 3300046537 Ga0495598_0000570 Ga0495598_0000570_2160_3014 269
228 3300046539 Ga0495621_0001104 Ga0495621_0001104_3073_3927 269
229 3300046558 Ga0495633_0000029 Ga0495633_0000029_14237_15097 269
230 3300046558 Ga0495633_0007830 Ga0495633_0007830_2525_3421 269
231 3300046616 Ga0495668_0000021 Ga0495668_0000021_139868_140728 269
232 3300046660 Ga0495625_0000009 Ga0495625_0000009_74792_75688 269
233 3300046660 Ga0495625_0000601 Ga0495625_0000601_30600_31460 269
234 3300046660 Ga0495625_0019015 Ga0495625_0019015_80_940 269
235 3300046660 Ga0495625_0027949 Ga0495625_0027949_1006_1866 269
236 3300046665 Ga0495661_0005655 Ga0495661_0005655_1242_2138 269
237 3300046665 Ga0495661_0027908 Ga0495661_0027908_1408_2304 269
238 3300046692 Ga0495671_0015633 Ga0495671_0015633_1189_2085 269
239 3300046694 Ga0495649_0000008 Ga0495649_0000008_172870_173766 269
240 3300046809 Ga0495600_0239581 Ga0495600_0239581_175_1035 269
241 3300046810 Ga0495660_0007248 Ga0495660_0007248_2035_2895 269
242 3300047323 Ga0495683_0087524 Ga0495683_0087524_12_872 269
243 3300047443 Ga0495687_003643 Ga0495687_003643_6079_6975 269
244 3300047443 Ga0495687_005239 Ga0495687_005239_5407_6267 269
245 3300047471 Ga0495684_0082329 Ga0495684_0082329_511_1365 269
246 3300047472 Ga0495686_0000194 Ga0495686_0000194_85869_86729 269
247 3300047472 Ga0495686_0003288 Ga0495686_0003288_5087_5947 269
248 3300048089 Ga0495614_0018649 Ga0495614_0018649_1964_2824 269
249 3300049460 Ga0495682_0037339 Ga0495682_0037339_573_1433 269
250 3300050493 nmdc:mga0k408_381_c3 nmdc:mga0k408_381_c3_14400_15359 269
251 3300050493 nmdc:mga0k408_657_c1 nmdc:mga0k408_657_c1_14917_15777 269
252 3300053125 Ga0500618_000040 Ga0500618_000040_108427_109287 269
253 3300053156 Ga0500622_0001467 Ga0500622_0001467_11708_12586 269
254 iso_pu_bacteria 2599185184 2599476853 269
255 iso_pu_bacteria 2739367866 2740034541 269
256 iso_pu_bacteria 2852623160 2852624662 269
257 iso_pu_bacteria 2884933994 2884936452 269
258 iso_pu_bacteria 2910245624 2910249995 269
259 iso_pu_bacteria 2919437846 2919438777 269
260 iso_pu_bacteria 2928078545 2928078763 269
261 iso_pu_bacteria 2928147474 2928151559 269
262 iso_pu_bacteria 2932082852 2932085426 269
263 iso_pu_bacteria 2977232053 2977233699 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02588

YitT_membrane

Uncharacterised 5xTM membrane BCR, YitT family COG1284

42

246

0.98

PF10035

DUF2179

Uncharacterized protein conserved in bacteria (DUF2179)

251

310

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hlu-assembly1.cif.gz_B crystal structure of uncharacterized protein conserved in bacteria duf2179 from eubacterium ventriosum 0.8745 181 253
3hlu-assembly1.cif.gz_B crystal structure of uncharacterized protein conserved in bacteria duf2179 from eubacterium ventriosum 0.8636 181 253
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8371 182 254
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.803 182 254
4d3h-assembly1.cif.gz_C structure of psta 0.7911 178 255
ID Description Score Start End Superfamily
af_Q2G2E2_188_262_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9422 178 251 3.30.70.120
af_Q2G2E2_188_262_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9184 178 251 3.30.70.120
af_Q2G2E2_1_187_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8634 2 177 1.10.1760.20
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8371 182 254 3.30.70.120
af_A0A0R0J2P3_24_128_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8275 180 259 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A357IYC4-F1-model_v4 YitT family protein 0.9671 2 179 GO:0005886
AF-A0A139PXM5-F1-model_v4 Transporter 0.9585 179 254 GO:0005886
AF-W1SJC7-F1-model_v4 deleted 0.9514 4 178
AF-A0A7X6X1Z5-F1-model_v4 YitT family protein 0.9434 178 255 GO:0005886
AF-A0A5Q2N4N8-F1-model_v4 YitT family protein 0.9368 3 177 GO:0005886

Feature Viewer

pLDDT pTM Quality
85.52 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map