F372159

General Info

Members Datasets Scaffolds Average Seq Length
263 123 526 128

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0208114|Ga0501032_0208114_529_972
Length 147
Sequence MSGDKARTPRHAAASRMGGTLVDHDQAVDMLEAITAAFDDHDLDAILEHFADDAVFEGPRGTEPWGTRFIGKEQIREAFAARFSGIPDVRYRDEGNFVDGDRGVSEWTLSGTTAAGERIEIRGCDLWTIRAGKIVKKDSYWKIRTTQ

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
68 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
69 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
70 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
71 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
72 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
73 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 1.9
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 20.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0208114 3300049569 Bacteria 1276
2 Ga0070676_10604249 3300005328 Unclassified 791
3 Ga0068868_101369090 3300005338 Unclassified 659
4 Ga0070661_101265560 3300005344 Bacteria 618
5 Ga0070669_100377951 3300005353 Unclassified 1155
6 Ga0070669_100395060 3300005353 Bacteria 1130
7 Ga0070674_100143839 3300005356 Bacteria 1793
8 Ga0070674_100324700 3300005356 Unclassified 1235
9 Ga0070674_100618983 3300005356 Unclassified 917
10 Ga0070673_100379292 3300005364 Bacteria 1260
11 Ga0070659_101004860 3300005366 Bacteria 732
12 Ga0070703_10167978 3300005406 Bacteria 838
13 Ga0070705_100225794 3300005440 Unclassified 1299
14 Ga0070700_100093305 3300005441 Bacteria 1969
15 Ga0070700_100934585 3300005441 Unclassified 708
16 Ga0070694_100038948 3300005444 Bacteria 3161
17 Ga0070694_100594705 3300005444 Unclassified 890
18 Ga0070694_100803150 3300005444 Bacteria 771
19 Ga0070708_100002682 3300005445 Bacteria 13793
20 Ga0070662_100275107 3300005457 Bacteria 1361
21 Ga0070706_100013178 3300005467 Bacteria 7649
22 Ga0070707_100445754 3300005468 Unclassified 1255
23 Ga0070698_100004326 3300005471 Bacteria 15608
24 Ga0070698_100069603 3300005471 Unclassified 3532
25 Ga0070698_101054815 3300005471 Bacteria 761
26 Ga0070699_100133685 3300005518 Bacteria 2187
27 Ga0070699_101629056 3300005518 Bacteria 591
28 Ga0070679_100622178 3300005530 Bacteria 1023
29 Ga0070697_100421337 3300005536 Bacteria 1160
30 Ga0070695_100003545 3300005545 Bacteria 9114
31 Ga0070695_100520853 3300005545 Bacteria 922
32 Ga0070696_100009404 3300005546 Bacteria 6544
33 Ga0070704_100801051 3300005549 Bacteria 842
34 Ga0070704_101175388 3300005549 Bacteria 699
35 Ga0068859_100460797 3300005617 Bacteria 1367
36 Ga0068866_10583141 3300005718 Bacteria 752
37 Ga0081538_10187690 3300005981 Bacteria 873
38 Ga0075365_10189912 3300006038 Bacteria 1438
39 Ga0075364_10117926 3300006051 Bacteria 1775
40 Ga0075362_10020395 3300006177 Bacteria 2768
41 Ga0075428_101218906 3300006844 Bacteria 793
42 Ga0075428_101275850 3300006844 Unclassified 773
43 Ga0075428_101579630 3300006844 Bacteria 686
44 Ga0075430_100761095 3300006846 Unclassified 798
45 Ga0075431_100429518 3300006847 Bacteria 1319
46 Ga0068865_101703930 3300006881 Bacteria 568
47 Ga0097620_100460819 3300006931 Bacteria 1367
48 Ga0111539_10030542 3300009094 Bacteria 6548
49 Ga0111539_10073423 3300009094 Bacteria 4034
50 Ga0111539_10172419 3300009094 Bacteria 2527
51 Ga0105245_11018096 3300009098 Unclassified 873
52 Ga0114129_10065826 3300009147 Bacteria 5056
53 Ga0114129_10117136 3300009147 Bacteria 3671
54 Ga0114129_10214595 3300009147 Bacteria 2599
55 Ga0114129_10231338 3300009147 Bacteria 2489
56 Ga0114129_10359215 3300009147 Bacteria 1928
57 Ga0114129_11622198 3300009147 Bacteria 791
58 Ga0105243_10129810 3300009148 Bacteria 2136
59 Ga0105243_10773697 3300009148 Bacteria 943
60 Ga0105242_10566009 3300009176 Bacteria 1092
61 Ga0105249_10564042 3300009553 Bacteria 1190
62 Ga0105249_13373050 3300009553 Unclassified 514
63 Ga0105030_125980 3300009987 Archaea 539
64 Ga0163162_10903661 3300013306 Bacteria 996
65 Ga0157375_10586811 3300013308 Bacteria 1274
66 Ga0157375_13223938 3300013308 Unclassified 544
67 Ga0157380_10671078 3300014326 Bacteria 1037
68 Ga0157380_10719781 3300014326 Unclassified 1005
69 Ga0157377_10085786 3300014745 Bacteria 1849
70 Ga0163161_10048482 3300017792 Bacteria 3068
71 Ga0207688_10168531 3300025901 Bacteria 1301
72 Ga0207645_11129460 3300025907 Unclassified 528
73 Ga0207684_10001160 3300025910 Bacteria 29394
74 Ga0207652_11038425 3300025921 Bacteria 719
75 Ga0207646_10007896 3300025922 Bacteria 10742
76 Ga0207646_10155891 3300025922 Unclassified 2060
77 Ga0207646_10760957 3300025922 Bacteria 864
78 Ga0207646_11313773 3300025922 Bacteria 631
79 Ga0207706_10363804 3300025933 Unclassified 1257
80 Ga0207686_10351768 3300025934 Bacteria 1109
81 Ga0207686_10735431 3300025934 Bacteria 787
82 Ga0207709_10472140 3300025935 Bacteria 974
83 Ga0207709_10495885 3300025935 Bacteria 952
84 Ga0207669_10421883 3300025937 Bacteria 1050
85 Ga0207669_10800871 3300025937 Unclassified 781
86 Ga0207651_10388099 3300025960 Bacteria 1185
87 Ga0207708_10260674 3300026075 Unclassified 1399
88 Ga0207708_10262124 3300026075 Bacteria 1395
89 Ga0207708_10274657 3300026075 Bacteria 1364
90 Ga0207648_10848438 3300026089 Bacteria 852
91 Ga0207648_10917627 3300026089 Unclassified 818
92 Ga0209974_10027402 3300027876 Bacteria 1885
93 Ga0207428_10009989 3300027907 Bacteria 8495
94 Ga0207428_10019175 3300027907 Bacteria 5832
95 Ga0207428_10112015 3300027907 Bacteria 2099
96 Ga0307405_10181499 3300031731 Unclassified 1511
97 Ga0307407_10119922 3300031903 Bacteria 1666
98 Ga0307407_10914065 3300031903 Unclassified 674
99 Ga0307412_10144574 3300031911 Unclassified 1746
100 Ga0307409_100142930 3300031995 Unclassified 2065
101 Ga0307409_100229695 3300031995 Bacteria 1681
102 Ga0307409_101571856 3300031995 Unclassified 686
103 Ga0307416_100001281 3300032002 Bacteria 13544
104 Ga0307416_101930354 3300032002 Unclassified 693
105 Ga0307416_102076744 3300032002 Unclassified 670
106 Ga0395905_0246347 3300037471 Bacteria 1670
107 Ga0439466_0222552 3300041411 Bacteria 573
108 Ga0439443_115923 3300042003 Unclassified 523
109 Ga0450920_005164 3300042122 Bacteria 2314
110 Ga0450923_051190 3300042125 Bacteria 888
111 Ga0450888_002847 3300042126 Bacteria 1727
112 Ga0450910_005566 3300042147 Bacteria 1722
113 Ga0439460_0049900 3300042461 Bacteria 1252
114 Ga0451577_0919972 3300042876 Unclassified 787
115 Ga0451576_1429697 3300045051 Unclassified 719
116 Ga0496102_0002147 3300048905 Bacteria 16928
117 Ga0496103_0013211 3300048906 Bacteria 4895
118 Ga0496106_0008662 3300048909 Bacteria 7527
119 Ga0496107_0018330 3300048910 Bacteria 4929
120 Ga0496112_0517626 3300048915 Bacteria 1128
121 Ga0501031_0000185 3300049568 Bacteria 35075
122 Ga0501031_0330141 3300049568 Unclassified 988
123 Ga0501031_0744565 3300049568 Bacteria 629
124 Ga0501032_0040114 3300049569 Bacteria 3183
125 Ga0501033_0000721 3300049570 Bacteria 30336
126 Ga0501033_0654854 3300049570 Bacteria 717
127 Ga0501034_0169596 3300049571 Bacteria 2150
128 Ga0501036_0007819 3300049572 Bacteria 8745
129 Ga0501036_0334041 3300049572 Unclassified 1266
130 Ga0501037_0017448 3300049573 Bacteria 5283
131 Ga0501037_0459336 3300049573 Unclassified 868
132 Ga0501037_0895242 3300049573 Unclassified 582
133 Ga0501038_0000667 3300049574 Bacteria 30546
134 Ga0501038_0442524 3300049574 Bacteria 1000
135 Ga0501038_0689860 3300049574 Bacteria 766
136 Ga0501039_0000132 3300049575 Bacteria 51966
137 Ga0501039_0014115 3300049575 Bacteria 6116
138 Ga0501039_0087626 3300049575 Bacteria 2425
139 Ga0501039_0396461 3300049575 Unclassified 1084
140 Ga0501040_0000756 3300049576 Bacteria 20037
141 Ga0501040_0104571 3300049576 Bacteria 1977
142 Ga0501040_0136983 3300049576 Bacteria 1724
143 Ga0501040_0141034 3300049576 Bacteria 1698
144 Ga0501040_0154009 3300049576 Bacteria 1623
145 Ga0501040_1051161 3300049576 Bacteria 590
146 Ga0501041_0000868 3300049577 Bacteria 16318
147 Ga0501041_0095847 3300049577 Bacteria 1834
148 Ga0501041_0179876 3300049577 Bacteria 1324
149 Ga0501041_0493249 3300049577 Bacteria 779
150 Ga0501042_0010791 3300049578 Bacteria 6141
151 Ga0501042_0027557 3300049578 Bacteria 3996
152 Ga0501042_0071348 3300049578 Bacteria 2485
153 Ga0501042_0074205 3300049578 Bacteria 2434
154 Ga0501042_0132534 3300049578 Bacteria 1796
155 Ga0501042_0789259 3300049578 Unclassified 691
156 Ga0501042_1452289 3300049578 Bacteria 500
157 Ga0501043_0001142 3300049579 Bacteria 23354
158 Ga0501043_0651577 3300049579 Bacteria 773
159 Ga0501046_0012260 3300049580 Bacteria 7305
160 Ga0501046_0122725 3300049580 Bacteria 1976
161 Ga0501046_0188335 3300049580 Bacteria 1540
162 Ga0501046_0377453 3300049580 Bacteria 1026
163 Ga0501047_0003928 3300049581 Bacteria 13967
164 Ga0501048_0001621 3300049582 Bacteria 17134
165 Ga0501048_0015417 3300049582 Bacteria 5643
166 Ga0501048_0043365 3300049582 Bacteria 3220
167 Ga0501048_0227912 3300049582 Bacteria 1322
168 Ga0501048_0296370 3300049582 Bacteria 1150
169 Ga0501048_0769161 3300049582 Bacteria 692
170 Ga0501067_0218778 3300049583 Bacteria 1061
171 Ga0501068_0028694 3300049584 Bacteria 3292
172 Ga0501068_0065582 3300049584 Bacteria 2210
173 Ga0501068_0151579 3300049584 Bacteria 1457
174 Ga0501068_0589276 3300049584 Bacteria 724
175 Ga0501069_0003643 3300049585 Bacteria 7930
176 Ga0501069_0056938 3300049585 Bacteria 2179
177 Ga0501070_0002865 3300049586 Bacteria 15026
178 Ga0501070_0414528 3300049586 Unclassified 1088
179 Ga0501070_0967777 3300049586 Unclassified 661
180 Ga0501071_0000001 3300049587 Bacteria 123952
181 Ga0501071_0043568 3300049587 Bacteria 3218
182 Ga0501071_0140916 3300049587 Bacteria 1795
183 Ga0501071_0374955 3300049587 Bacteria 1084
184 Ga0501071_0455118 3300049587 Unclassified 980
185 Ga0501072_0001753 3300049588 Bacteria 16129
186 Ga0501072_0164333 3300049588 Unclassified 1771
187 Ga0501072_0192259 3300049588 Bacteria 1627
188 Ga0501072_1302498 3300049588 Bacteria 563
189 Ga0501073_0007975 3300049589 Bacteria 7860
190 Ga0501073_0191855 3300049589 Bacteria 1414
191 Ga0501074_0000031 3300049590 Bacteria 66130
192 Ga0501074_0103988 3300049590 Bacteria 2033
193 Ga0501074_0135715 3300049590 Bacteria 1760
194 Ga0501075_0000048 3300049591 Bacteria 50313
195 Ga0501075_0063224 3300049591 Bacteria 2790
196 Ga0501075_0170306 3300049591 Bacteria 1662
197 Ga0501075_0460858 3300049591 Bacteria 969
198 Ga0501075_0499971 3300049591 Bacteria 927
199 Ga0501076_0004472 3300049592 Bacteria 9950
200 Ga0501076_0052073 3300049592 Bacteria 3242
201 Ga0501076_0869338 3300049592 Bacteria 743
202 Ga0501077_0000926 3300049593 Bacteria 17657
203 Ga0501077_0222070 3300049593 Bacteria 1201
204 Ga0501077_0266672 3300049593 Bacteria 1089
205 Ga0501077_0546155 3300049593 Unclassified 743
206 Ga0501225_0309373 3300049705 Unclassified 537
207 Ga0501079_0008473 3300049741 Bacteria 7794
208 Ga0501079_0110825 3300049741 Bacteria 2132
209 Ga0501079_0461645 3300049741 Bacteria 997
210 Ga0501079_0839249 3300049741 Unclassified 723
211 Ga0501079_1355317 3300049741 Bacteria 560
212 Ga0501080_0008734 3300049742 Bacteria 9201
213 Ga0501080_0334581 3300049742 Unclassified 1369
214 Ga0501080_0975553 3300049742 Bacteria 736
215 Ga0501081_0001756 3300049743 Bacteria 13445
216 Ga0501081_0232440 3300049743 Unclassified 1343
217 Ga0501081_0247986 3300049743 Bacteria 1299
218 Ga0501081_1324268 3300049743 Bacteria 546
219 Ga0501083_0001140 3300049744 Bacteria 17856
220 Ga0501083_0337651 3300049744 Bacteria 980
221 Ga0501035_0022521 3300049822 Bacteria 5786
222 Ga0501035_0523360 3300049822 Bacteria 974
223 Ga0501044_0014890 3300049823 Bacteria 8385
224 Ga0501045_0000792 3300049824 Bacteria 20343
225 Ga0501045_0058883 3300049824 Bacteria 2813
226 Ga0501045_0106273 3300049824 Bacteria 2080
227 Ga0501045_0219138 3300049824 Bacteria 1417
228 nmdc:mga0yw44_160814_c1 3300050492 Unclassified 1470
229 nmdc:mga05p37_160632_c1 3300050507 Bacteria 2745
230 nmdc:mga05p37_222949_c1 3300050507 Bacteria 2275
231 nmdc:mga05p37_267537_c1 3300050507 Bacteria 2044
232 nmdc:mga05p37_492988_c1 3300050507 Bacteria 1408
233 nmdc:mga05p37_516717_c1 3300050507 Unclassified 1367
234 nmdc:mga05p37_70328_c1 3300050507 Bacteria 4304
235 nmdc:mga05p37_96439_c1 3300050507 Bacteria 3643
236 nmdc:mga09592_58834_c1 3300050508 Bacteria 3250
237 nmdc:mga0qj67_193043_c1 3300050509 Bacteria 1655
238 nmdc:mga0qj67_701077_c1 3300050509 Unclassified 805
239 nmdc:mga06r32_1168930_c1 3300050510 Bacteria 717
240 nmdc:mga06r32_527679_c1 3300050510 Bacteria 1156
241 nmdc:mga08y16_13278_c1 3300050511 Bacteria 8661
242 nmdc:mga08y16_2018316_c1 3300050511 Unclassified 526
243 nmdc:mga08y16_582387_c1 3300050511 Unclassified 1130
244 nmdc:mga08y16_599397_c1 3300050511 Bacteria 1111
245 Ga0501084_0023223 3300054114 Bacteria 5177
246 Ga0501084_0031375 3300054114 Bacteria 4444
247 Ga0501084_0145548 3300054114 Unclassified 1996
248 Ga0501084_0216309 3300054114 Bacteria 1617
249 Ga0501084_0420599 3300054114 Bacteria 1130
250 Ga0501084_0464967 3300054114 Unclassified 1069
251 Ga0501084_0535914 3300054114 Bacteria 989
252 Ga0590075_091098 3300059424 Bacteria 791
253 Ga0501082_0000607 3300060353 Bacteria 31518
254 Ga0501082_0044164 3300060353 Bacteria 3845
255 Ga0501082_0063196 3300060353 Bacteria 3187
256 Ga0501082_0760258 3300060353 Bacteria 848
257 Ga0501082_1037305 3300060353 Bacteria 717
258 Ga0530510_0001212 3300061734 Bacteria 17219
259 Ga0530510_0023188 3300061734 Bacteria 4420
260 Ga0530510_0028996 3300061734 Bacteria 3970
261 Ga0530510_0230038 3300061734 Bacteria 1379
262 Ga0530510_0493914 3300061734 Bacteria 927
263 Ga0530510_1569667 3300061734 Unclassified 505
264 Ga0501032_0208114
265 Ga0070676_10604249
266 Ga0068868_101369090
267 Ga0070661_101265560
268 Ga0070669_100377951
269 Ga0070669_100395060
270 Ga0070674_100143839
271 Ga0070674_100324700
272 Ga0070674_100618983
273 Ga0070673_100379292
274 Ga0070659_101004860
275 Ga0070703_10167978
276 Ga0070705_100225794
277 Ga0070700_100093305
278 Ga0070700_100934585
279 Ga0070694_100038948
280 Ga0070694_100594705
281 Ga0070694_100803150
282 Ga0070708_100002682
283 Ga0070662_100275107
284 Ga0070706_100013178
285 Ga0070707_100445754
286 Ga0070698_100004326
287 Ga0070698_100069603
288 Ga0070698_101054815
289 Ga0070699_100133685
290 Ga0070699_101629056
291 Ga0070679_100622178
292 Ga0070697_100421337
293 Ga0070695_100003545
294 Ga0070695_100520853
295 Ga0070696_100009404
296 Ga0070704_100801051
297 Ga0070704_101175388
298 Ga0068859_100460797
299 Ga0068866_10583141
300 Ga0081538_10187690
301 Ga0075365_10189912
302 Ga0075364_10117926
303 Ga0075362_10020395
304 Ga0075428_101218906
305 Ga0075428_101275850
306 Ga0075428_101579630
307 Ga0075430_100761095
308 Ga0075431_100429518
309 Ga0068865_101703930
310 Ga0097620_100460819
311 Ga0111539_10030542
312 Ga0111539_10073423
313 Ga0111539_10172419
314 Ga0105245_11018096
315 Ga0114129_10065826
316 Ga0114129_10117136
317 Ga0114129_10214595
318 Ga0114129_10231338
319 Ga0114129_10359215
320 Ga0114129_11622198
321 Ga0105243_10129810
322 Ga0105243_10773697
323 Ga0105242_10566009
324 Ga0105249_10564042
325 Ga0105249_13373050
326 Ga0105030_125980
327 Ga0163162_10903661
328 Ga0157375_10586811
329 Ga0157375_13223938
330 Ga0157380_10671078
331 Ga0157380_10719781
332 Ga0157377_10085786
333 Ga0163161_10048482
334 Ga0207688_10168531
335 Ga0207645_11129460
336 Ga0207684_10001160
337 Ga0207652_11038425
338 Ga0207646_10007896
339 Ga0207646_10155891
340 Ga0207646_10760957
341 Ga0207646_11313773
342 Ga0207706_10363804
343 Ga0207686_10351768
344 Ga0207686_10735431
345 Ga0207709_10472140
346 Ga0207709_10495885
347 Ga0207669_10421883
348 Ga0207669_10800871
349 Ga0207651_10388099
350 Ga0207708_10260674
351 Ga0207708_10262124
352 Ga0207708_10274657
353 Ga0207648_10848438
354 Ga0207648_10917627
355 Ga0209974_10027402
356 Ga0207428_10009989
357 Ga0207428_10019175
358 Ga0207428_10112015
359 Ga0307405_10181499
360 Ga0307407_10119922
361 Ga0307407_10914065
362 Ga0307412_10144574
363 Ga0307409_100142930
364 Ga0307409_100229695
365 Ga0307409_101571856
366 Ga0307416_100001281
367 Ga0307416_101930354
368 Ga0307416_102076744
369 Ga0395905_0246347
370 Ga0439466_0222552
371 Ga0439443_115923
372 Ga0450920_005164
373 Ga0450923_051190
374 Ga0450888_002847
375 Ga0450910_005566
376 Ga0439460_0049900
377 Ga0451577_0919972
378 Ga0451576_1429697
379 Ga0496102_0002147
380 Ga0496103_0013211
381 Ga0496106_0008662
382 Ga0496107_0018330
383 Ga0496112_0517626
384 Ga0501031_0000185
385 Ga0501031_0330141
386 Ga0501031_0744565
387 Ga0501032_0040114
388 Ga0501033_0000721
389 Ga0501033_0654854
390 Ga0501034_0169596
391 Ga0501036_0007819
392 Ga0501036_0334041
393 Ga0501037_0017448
394 Ga0501037_0459336
395 Ga0501037_0895242
396 Ga0501038_0000667
397 Ga0501038_0442524
398 Ga0501038_0689860
399 Ga0501039_0000132
400 Ga0501039_0014115
401 Ga0501039_0087626
402 Ga0501039_0396461
403 Ga0501040_0000756
404 Ga0501040_0104571
405 Ga0501040_0136983
406 Ga0501040_0141034
407 Ga0501040_0154009
408 Ga0501040_1051161
409 Ga0501041_0000868
410 Ga0501041_0095847
411 Ga0501041_0179876
412 Ga0501041_0493249
413 Ga0501042_0010791
414 Ga0501042_0027557
415 Ga0501042_0071348
416 Ga0501042_0074205
417 Ga0501042_0132534
418 Ga0501042_0789259
419 Ga0501042_1452289
420 Ga0501043_0001142
421 Ga0501043_0651577
422 Ga0501046_0012260
423 Ga0501046_0122725
424 Ga0501046_0188335
425 Ga0501046_0377453
426 Ga0501047_0003928
427 Ga0501048_0001621
428 Ga0501048_0015417
429 Ga0501048_0043365
430 Ga0501048_0227912
431 Ga0501048_0296370
432 Ga0501048_0769161
433 Ga0501067_0218778
434 Ga0501068_0028694
435 Ga0501068_0065582
436 Ga0501068_0151579
437 Ga0501068_0589276
438 Ga0501069_0003643
439 Ga0501069_0056938
440 Ga0501070_0002865
441 Ga0501070_0414528
442 Ga0501070_0967777
443 Ga0501071_0000001
444 Ga0501071_0043568
445 Ga0501071_0140916
446 Ga0501071_0374955
447 Ga0501071_0455118
448 Ga0501072_0001753
449 Ga0501072_0164333
450 Ga0501072_0192259
451 Ga0501072_1302498
452 Ga0501073_0007975
453 Ga0501073_0191855
454 Ga0501074_0000031
455 Ga0501074_0103988
456 Ga0501074_0135715
457 Ga0501075_0000048
458 Ga0501075_0063224
459 Ga0501075_0170306
460 Ga0501075_0460858
461 Ga0501075_0499971
462 Ga0501076_0004472
463 Ga0501076_0052073
464 Ga0501076_0869338
465 Ga0501077_0000926
466 Ga0501077_0222070
467 Ga0501077_0266672
468 Ga0501077_0546155
469 Ga0501225_0309373
470 Ga0501079_0008473
471 Ga0501079_0110825
472 Ga0501079_0461645
473 Ga0501079_0839249
474 Ga0501079_1355317
475 Ga0501080_0008734
476 Ga0501080_0334581
477 Ga0501080_0975553
478 Ga0501081_0001756
479 Ga0501081_0232440
480 Ga0501081_0247986
481 Ga0501081_1324268
482 Ga0501083_0001140
483 Ga0501083_0337651
484 Ga0501035_0022521
485 Ga0501035_0523360
486 Ga0501044_0014890
487 Ga0501045_0000792
488 Ga0501045_0058883
489 Ga0501045_0106273
490 Ga0501045_0219138
491 nmdc:mga0yw44_160814_c1
492 nmdc:mga05p37_160632_c1
493 nmdc:mga05p37_222949_c1
494 nmdc:mga05p37_267537_c1
495 nmdc:mga05p37_492988_c1
496 nmdc:mga05p37_516717_c1
497 nmdc:mga05p37_70328_c1
498 nmdc:mga05p37_96439_c1
499 nmdc:mga09592_58834_c1
500 nmdc:mga0qj67_193043_c1
501 nmdc:mga0qj67_701077_c1
502 nmdc:mga06r32_1168930_c1
503 nmdc:mga06r32_527679_c1
504 nmdc:mga08y16_13278_c1
505 nmdc:mga08y16_2018316_c1
506 nmdc:mga08y16_582387_c1
507 nmdc:mga08y16_599397_c1
508 Ga0501084_0023223
509 Ga0501084_0031375
510 Ga0501084_0145548
511 Ga0501084_0216309
512 Ga0501084_0420599
513 Ga0501084_0464967
514 Ga0501084_0535914
515 Ga0590075_091098
516 Ga0501082_0000607
517 Ga0501082_0044164
518 Ga0501082_0063196
519 Ga0501082_0760258
520 Ga0501082_1037305
521 Ga0530510_0001212
522 Ga0530510_0023188
523 Ga0530510_0028996
524 Ga0530510_0230038
525 Ga0530510_0493914
526 Ga0530510_1569667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

31

137

0.94

PF07366

SnoaL

SnoaL-like polyketide cyclase

28

143

0.92

PF14534

DUF4440

Domain of unknown function (DUF4440)

28

143

0.84

PF13474

SnoaL_3

SnoaL-like domain

28

145

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2inx-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol 0.9033 7 121
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.9021 1 121
1dmn-assembly1.cif.gz_A-2 crystal structure of mutant enzyme y32f/y57f of ketosteroid isomerase from pseudomonas putida biotype b 0.8988 1 121
3m8c-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound 0.8985 1 118
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.8982 6 121
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8973 4 121 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8932 1 119 3.10.450.50
5tgnA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8928 6 123 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8926 8 119 3.10.450.50
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8846 29 121 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1F8S1T0-F1-model_v4 DUF4440 domain-containing protein 0.9927 1 125
AF-A0A315E1W6-F1-model_v4 DUF4440 domain-containing protein 0.992 7 124
AF-A0A7V9GM45-F1-model_v4 Nuclear transport factor 2 family protein 0.9912 7 126
AF-X1MP87-F1-model_v4 SnoaL-like domain-containing protein 0.9912 7 111
AF-A0A858WY70-F1-model_v4 Nuclear transport factor 2 family protein 0.9908 1 125

Map