F372049

General Info

Members Datasets Scaffolds Average Seq Length
263 145 526 287

Family's Representative Sequence

Representative Sequence 3300042436|Ga0439435_0039570|Ga0439435_0039570_399_1262
Length 287
Sequence MVALVTYTTLIDIETLAAHRADASFRIIDCRFALNDPEWGQQVYTASHIPGAVYADLNRHLAGRPTGSNGRHPLPRVEDLRQTLGNLGIDGERQVVAYDQDTGMFASRLWWLLRWLGHDAVAVLDGGFAAWVAAGLPISSDREPEVRREFTGTPRANLSAGIDDVVAAVQQGGHRLLDARAPERFKGLVEPIDRAAGHIPGARNHFYKWNVDDRGRFLPADALRERITAALDGVAPEKTIAYCGSGITAAHNLLAMEHAGLQGGRLYAGSWSEWSSDERRGVEKLEG

Samples

Sample ID Description Type Environment
1 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.9
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439435_0039570 3300042436 Bacteria 1314
2 SwRhRL3b_contig_4477656 2162886006 Bacteria 1382
3 SwRhRL2b_contig_3866919 2162886007 Bacteria 1892
4 SwRhRL2b_contig_691202 2162886007 Bacteria 2202
5 MRS1b_contig_3738943 2162886011 Bacteria 1737
6 Ga0065704_10071957 3300005289 Bacteria 9521
7 Ga0065715_10093008 3300005293 Bacteria 4841
8 Ga0065707_10000742 3300005295 Bacteria 13855
9 Ga0065707_10180533 3300005295 Bacteria 1421
10 Ga0070683_100056369 3300005329 Bacteria 3650
11 Ga0070670_100026122 3300005331 Bacteria 5027
12 Ga0070677_10159856 3300005333 Bacteria 1056
13 Ga0070666_10097728 3300005335 Bacteria 2021
14 Ga0068868_100007915 3300005338 Bacteria 7594
15 Ga0070689_100008762 3300005340 Bacteria 7139
16 Ga0070689_100030333 3300005340 Bacteria 4104
17 Ga0070691_10094150 3300005341 Bacteria 1480
18 Ga0070692_10096960 3300005345 Bacteria 1611
19 Ga0070668_100049093 3300005347 Bacteria 3247
20 Ga0070669_100002535 3300005353 Bacteria 13200
21 Ga0070669_100174545 3300005353 Unclassified 1678
22 Ga0070675_100001758 3300005354 Bacteria 15974
23 Ga0070675_100039181 3300005354 Bacteria 3866
24 Ga0070675_100128391 3300005354 Bacteria 2158
25 Ga0070675_100343471 3300005354 Bacteria 1322
26 Ga0070673_100024781 3300005364 Bacteria 4404
27 Ga0070673_100087237 3300005364 Bacteria 2543
28 Ga0070673_100139623 3300005364 Bacteria 2042
29 Ga0070673_100644400 3300005364 Bacteria 969
30 Ga0070688_100007900 3300005365 Bacteria 5751
31 Ga0070688_100023862 3300005365 Bacteria 3603
32 Ga0070703_10037498 3300005406 Bacteria 1494
33 Ga0070713_100067564 3300005436 Bacteria 3010
34 Ga0070701_10002153 3300005438 Bacteria 7503
35 Ga0070701_10064110 3300005438 Bacteria 1946
36 Ga0070705_100020778 3300005440 Bacteria 3482
37 Ga0070705_100026196 3300005440 Bacteria 3171
38 Ga0070700_100004323 3300005441 Bacteria 7415
39 Ga0070700_100395866 3300005441 Bacteria 1037
40 Ga0070694_100001727 3300005444 Bacteria 12875
41 Ga0070694_100017424 3300005444 Bacteria 4541
42 Ga0070694_100126233 3300005444 Bacteria 1842
43 Ga0070678_100064557 3300005456 Bacteria 2714
44 Ga0070678_100145541 3300005456 Bacteria 1902
45 Ga0070681_10019302 3300005458 Bacteria 6821
46 Ga0068867_100001312 3300005459 Bacteria 17219
47 Ga0068867_100002569 3300005459 Bacteria 12798
48 Ga0070707_100062728 3300005468 Bacteria 3566
49 Ga0070698_100004874 3300005471 Bacteria 14726
50 Ga0070699_100000612 3300005518 Bacteria 33684
51 Ga0070699_100003352 3300005518 Bacteria 14175
52 Ga0070699_100110784 3300005518 Bacteria 2410
53 Ga0070679_100215182 3300005530 Bacteria 1884
54 Ga0070672_100035528 3300005543 Bacteria 3789
55 Ga0070686_100104701 3300005544 Unclassified 1917
56 Ga0070686_100229763 3300005544 Bacteria 1345
57 Ga0070695_100127737 3300005545 Bacteria 1748
58 Ga0070696_100002555 3300005546 Bacteria 12064
59 Ga0070696_100153354 3300005546 Bacteria 1693
60 Ga0070665_100008764 3300005548 Bacteria 10238
61 Ga0070704_100000478 3300005549 Bacteria 18927
62 Ga0070704_100001847 3300005549 Bacteria 11668
63 Ga0070704_100002059 3300005549 Bacteria 11161
64 Ga0070664_100079151 3300005564 Bacteria 2828
65 Ga0070664_100483380 3300005564 Bacteria 1140
66 Ga0068857_100082954 3300005577 Bacteria 2864
67 Ga0068857_100451992 3300005577 Bacteria 1201
68 Ga0068854_100273645 3300005578 Bacteria 1357
69 Ga0070702_100018044 3300005615 Bacteria 3652
70 Ga0068852_100095627 3300005616 Bacteria 2668
71 Ga0068859_100002275 3300005617 Bacteria 19488
72 Ga0068859_100004259 3300005617 Bacteria 14613
73 Ga0068859_100039907 3300005617 Bacteria 4711
74 Ga0068859_100083260 3300005617 Bacteria 3242
75 Ga0068859_100739926 3300005617 Bacteria 1072
76 Ga0068864_100028989 3300005618 Bacteria 4683
77 Ga0068864_100135233 3300005618 Bacteria 2219
78 Ga0068864_100140747 3300005618 Unclassified 2176
79 Ga0068861_100000420 3300005719 Bacteria 24640
80 Ga0068861_100000673 3300005719 Bacteria 20337
81 Ga0068861_100296184 3300005719 Bacteria 1399
82 Ga0068870_10003704 3300005840 Bacteria 6495
83 Ga0068858_100016561 3300005842 Bacteria 6923
84 Ga0068858_100156273 3300005842 Bacteria 2146
85 Ga0068860_100017128 3300005843 Bacteria 7063
86 Ga0068862_100001595 3300005844 Bacteria 20656
87 Ga0068862_100527104 3300005844 Bacteria 1125
88 Ga0081455_10126359 3300005937 Bacteria 2006
89 Ga0075432_10019691 3300006058 Bacteria 2307
90 Ga0097621_100065992 3300006237 Bacteria 2980
91 Ga0097621_100122533 3300006237 Bacteria 2207
92 Ga0068871_100203991 3300006358 Bacteria 1708
93 Ga0068871_100224790 3300006358 Bacteria 1628
94 Ga0068871_100239905 3300006358 Unclassified 1576
95 Ga0075428_100001571 3300006844 Bacteria 24485
96 Ga0075430_100024650 3300006846 Bacteria 5117
97 Ga0075430_100038047 3300006846 Bacteria 4077
98 Ga0075433_10112731 3300006852 Bacteria 2412
99 Ga0075433_10391847 3300006852 Bacteria 1226
100 Ga0075434_100005536 3300006871 Bacteria 11504
101 Ga0075434_100022055 3300006871 Bacteria 6199
102 Ga0075434_100094247 3300006871 Bacteria 2998
103 Ga0075434_100125040 3300006871 Bacteria 2589
104 Ga0075429_100005543 3300006880 Bacteria 10877
105 Ga0075429_100054044 3300006880 Bacteria 3494
106 Ga0075429_100312969 3300006880 Unclassified 1374
107 Ga0075429_100549576 3300006880 Bacteria 1012
108 Ga0068865_100041320 3300006881 Bacteria 3137
109 Ga0097620_100002275 3300006931 Bacteria 19488
110 Ga0097620_100004259 3300006931 Bacteria 14613
111 Ga0097620_100039907 3300006931 Bacteria 4711
112 Ga0097620_100083260 3300006931 Bacteria 3242
113 Ga0097620_100739907 3300006931 Bacteria 1072
114 Ga0075435_100001382 3300007076 Bacteria 15671
115 Ga0075435_100250795 3300007076 Bacteria 1507
116 Ga0111539_10000149 3300009094 Bacteria 79175
117 Ga0111539_10003780 3300009094 Bacteria 19922
118 Ga0111539_10010500 3300009094 Bacteria 11654
119 Ga0111539_10019043 3300009094 Bacteria 8482
120 Ga0111539_10044591 3300009094 Bacteria 5312
121 Ga0111539_10220963 3300009094 Bacteria 2206
122 Ga0111539_10673946 3300009094 Bacteria 1204
123 Ga0114129_10008625 3300009147 Bacteria 14536
124 Ga0114129_10012111 3300009147 Bacteria 12280
125 Ga0114129_10019881 3300009147 Bacteria 9557
126 Ga0114129_10079722 3300009147 Bacteria 4552
127 Ga0114129_10658131 3300009147 Bacteria 1351
128 Ga0105243_10322320 3300009148 Bacteria 1409
129 Ga0105242_10001295 3300009176 Bacteria 19769
130 Ga0105242_10102574 3300009176 Bacteria 2426
131 Ga0105248_10013203 3300009177 Bacteria 9093
132 Ga0105248_10015104 3300009177 Bacteria 8503
133 Ga0105248_10102184 3300009177 Bacteria 3231
134 Ga0105249_10054657 3300009553 Bacteria 3652
135 Ga0157374_10044209 3300013296 Bacteria 4117
136 Ga0157378_10199267 3300013297 Bacteria 1893
137 Ga0157378_10538623 3300013297 Bacteria 1171
138 Ga0163162_10129044 3300013306 Bacteria 2636
139 Ga0157375_10001192 3300013308 Bacteria 22410
140 Ga0163163_10040987 3300014325 Bacteria 4526
141 Ga0157380_10694985 3300014326 Bacteria 1021
142 Ga0157377_10016801 3300014745 Bacteria 3771
143 Ga0157377_10093316 3300014745 Bacteria 1781
144 Ga0157376_10045559 3300014969 Bacteria 3612
145 Ga0157376_10046814 3300014969 Unclassified 3569
146 Ga0157376_10140315 3300014969 Bacteria 2167
147 Ga0157376_10489772 3300014969 Bacteria 1206
148 Ga0207710_10019149 3300025900 Bacteria 2919
149 Ga0207680_10121563 3300025903 Unclassified 1708
150 Ga0207645_10002322 3300025907 Bacteria 15037
151 Ga0207643_10004376 3300025908 Bacteria 7592
152 Ga0207643_10032554 3300025908 Bacteria 2913
153 Ga0207660_10265210 3300025917 Bacteria 1359
154 Ga0207662_10032920 3300025918 Bacteria 3019
155 Ga0207652_10154686 3300025921 Bacteria 2054
156 Ga0207646_10044446 3300025922 Bacteria 3987
157 Ga0207646_10052935 3300025922 Bacteria 3632
158 Ga0207681_10005522 3300025923 Bacteria 7767
159 Ga0207681_10141838 3300025923 Bacteria 1790
160 Ga0207650_10296214 3300025925 Bacteria 1320
161 Ga0207659_10000581 3300025926 Bacteria 21934
162 Ga0207659_10091215 3300025926 Bacteria 2276
163 Ga0207659_10108373 3300025926 Bacteria 2107
164 Ga0207686_10059150 3300025934 Unclassified 2420
165 Ga0207670_10005703 3300025936 Bacteria 6860
166 Ga0207670_10017223 3300025936 Bacteria 4364
167 Ga0207670_10085772 3300025936 Bacteria 2214
168 Ga0207691_10023138 3300025940 Bacteria 5850
169 Ga0207691_10071681 3300025940 Bacteria 3126
170 Ga0207691_10197607 3300025940 Bacteria 1751
171 Ga0207711_10014086 3300025941 Bacteria 6643
172 Ga0207711_10305373 3300025941 Bacteria 1468
173 Ga0207689_10028170 3300025942 Bacteria 4698
174 Ga0207661_10174529 3300025944 Bacteria 1873
175 Ga0207651_10172103 3300025960 Bacteria 1709
176 Ga0207712_10033740 3300025961 Bacteria 3462
177 Ga0207640_10025908 3300025981 Bacteria 3556
178 Ga0207677_10111708 3300026023 Bacteria 2037
179 Ga0207703_10321709 3300026035 Bacteria 1417
180 Ga0207703_10347347 3300026035 Bacteria 1365
181 Ga0207708_10001419 3300026075 Bacteria 17959
182 Ga0207708_10022633 3300026075 Bacteria 4746
183 Ga0207641_10355147 3300026088 Bacteria 1398
184 Ga0207648_10000409 3300026089 Bacteria 47845
185 Ga0207676_10091969 3300026095 Bacteria 2493
186 Ga0207676_10111034 3300026095 Bacteria 2294
187 Ga0207676_10118888 3300026095 Unclassified 2225
188 Ga0207676_10212922 3300026095 Unclassified 1716
189 Ga0207674_10050819 3300026116 Bacteria 4234
190 Ga0207675_100001233 3300026118 Bacteria 25530
191 Ga0207675_100003287 3300026118 Bacteria 15834
192 Ga0207675_100101721 3300026118 Bacteria 2707
193 Ga0207683_10479111 3300026121 Bacteria 1148
194 Ga0207698_10089650 3300026142 Bacteria 2512
195 Ga0209971_1026925 3300027682 Bacteria 1375
196 Ga0207428_10000359 3300027907 Bacteria 58826
197 Ga0207428_10000885 3300027907 Bacteria 33608
198 Ga0207428_10001323 3300027907 Bacteria 26374
199 Ga0207428_10012189 3300027907 Bacteria 7562
200 Ga0207428_10203810 3300027907 Unclassified 1488
201 Ga0268266_10004349 3300028379 Bacteria 13610
202 Ga0268265_10000725 3300028380 Bacteria 32189
203 Ga0268265_10065396 3300028380 Bacteria 2806
204 Ga0268264_10235558 3300028381 Bacteria 1693
205 Ga0268264_10575505 3300028381 Bacteria 1107
206 Ga0307409_100092179 3300031995 Unclassified 2485
207 Ga0307416_100610502 3300032002 Bacteria 1172
208 Ga0373941_0046549 3300035115 Bacteria 1363
209 Ga0373957_0035564 3300035120 Bacteria 1852
210 Ga0373931_0038652 3300035691 Bacteria 2498
211 Ga0373933_0086611 3300035724 Bacteria 1928
212 Ga0373937_0030437 3300036401 Bacteria 4889
213 Ga0451576_0005338 3300045051 Bacteria 16152
214 Ga0451576_0019689 3300045051 Bacteria 7364
215 Ga0495592_0150078 3300046454 Bacteria 1613
216 Ga0495603_0027591 3300046455 Bacteria 3426
217 Ga0495603_0206020 3300046455 Archaea 1136
218 Ga0495629_0014567 3300046459 Bacteria 5658
219 Ga0495663_0103967 3300046525 Bacteria 938
220 Ga0495609_0040867 3300046538 Bacteria 2086
221 Ga0495621_0023972 3300046539 Unclassified 2033
222 Ga0495621_0055171 3300046539 Bacteria 1429
223 Ga0495633_0197742 3300046558 Bacteria 923
224 Ga0495659_0015026 3300046664 Bacteria 2542
225 Ga0495588_0010688 3300046674 Bacteria 4281
226 Ga0495658_0156753 3300046683 Bacteria 1401
227 Ga0495658_0161068 3300046683 Bacteria 1384
228 Ga0495669_0124101 3300046684 Bacteria 1212
229 Ga0495670_0014483 3300046691 Bacteria 3877
230 Ga0496104_0321885 3300048907 Bacteria 1459
231 Ga0496107_0198536 3300048910 Bacteria 1491
232 Ga0496108_0248496 3300048911 Unclassified 1547
233 Ga0496109_0621321 3300048912 Unclassified 1017
234 Ga0496112_0514906 3300048915 Unclassified 1131
235 Ga0501067_0025621 3300049583 Bacteria 3269
236 nmdc:mga05p37_10739_c2 3300050507 Bacteria 7626
237 nmdc:mga05p37_214599_c1 3300050507 Bacteria 2325
238 nmdc:mga05p37_439900_c1 3300050507 Bacteria 1512
239 nmdc:mga05p37_507615_c1 3300050507 Bacteria 1382
240 nmdc:mga05p37_5795_c1 3300050507 Bacteria 5662
241 nmdc:mga05p37_66374_c1 3300050507 Bacteria 4438
242 nmdc:mga05p37_800_c1 3300050507 Bacteria 35071
243 nmdc:mga09592_121831_c1 3300050508 Bacteria 2240
244 nmdc:mga09592_162994_c1 3300050508 Bacteria 1926
245 nmdc:mga09592_37149_c1 3300050508 Bacteria 4084
246 nmdc:mga09592_70034_c1 3300050508 Bacteria 2976
247 nmdc:mga0qj67_160196_c1 3300050509 Bacteria 1827
248 nmdc:mga0qj67_30687_c1 3300050509 Bacteria 4185
249 nmdc:mga08y16_111934_c1 3300050511 Bacteria 2842
250 nmdc:mga08y16_195289_c1 3300050511 Bacteria 2098
251 nmdc:mga08y16_233106_c1 3300050511 Bacteria 1904
252 nmdc:mga08y16_296421_c1 3300050511 Bacteria 1667
253 nmdc:mga08y16_37019_c1 3300050511 Bacteria 5124
254 nmdc:mga08y16_3795_c1 3300050511 Bacteria 15733
255 nmdc:mga08y16_428_c1 3300050511 Bacteria 38740
256 nmdc:mga08y16_5234_c1 3300050511 Bacteria 13549
257 nmdc:mga08y16_8105_c1 3300050511 Bacteria 10983
258 nmdc:mga0n895_255632_c1 3300050512 Bacteria 1778
259 nmdc:mga0n895_307577_c1 3300050512 Bacteria 1607
260 nmdc:mga0rr50_34110_c1 3300050513 Bacteria 3642
261 nmdc:mga0rr50_6392_c1 3300050513 Bacteria 7168
262 nmdc:mga0rr50_9772_c1 3300050513 Bacteria 6054
263 nmdc:mga0a205_265951_c1 3300050515 Bacteria 1592
264 Ga0439435_0039570
265 SwRhRL3b_contig_4477656
266 SwRhRL2b_contig_3866919
267 SwRhRL2b_contig_691202
268 MRS1b_contig_3738943
269 Ga0065704_10071957
270 Ga0065715_10093008
271 Ga0065707_10000742
272 Ga0065707_10180533
273 Ga0070683_100056369
274 Ga0070670_100026122
275 Ga0070677_10159856
276 Ga0070666_10097728
277 Ga0068868_100007915
278 Ga0070689_100008762
279 Ga0070689_100030333
280 Ga0070691_10094150
281 Ga0070692_10096960
282 Ga0070668_100049093
283 Ga0070669_100002535
284 Ga0070669_100174545
285 Ga0070675_100001758
286 Ga0070675_100039181
287 Ga0070675_100128391
288 Ga0070675_100343471
289 Ga0070673_100024781
290 Ga0070673_100087237
291 Ga0070673_100139623
292 Ga0070673_100644400
293 Ga0070688_100007900
294 Ga0070688_100023862
295 Ga0070703_10037498
296 Ga0070713_100067564
297 Ga0070701_10002153
298 Ga0070701_10064110
299 Ga0070705_100020778
300 Ga0070705_100026196
301 Ga0070700_100004323
302 Ga0070700_100395866
303 Ga0070694_100001727
304 Ga0070694_100017424
305 Ga0070694_100126233
306 Ga0070678_100064557
307 Ga0070678_100145541
308 Ga0070681_10019302
309 Ga0068867_100001312
310 Ga0068867_100002569
311 Ga0070707_100062728
312 Ga0070698_100004874
313 Ga0070699_100000612
314 Ga0070699_100003352
315 Ga0070699_100110784
316 Ga0070679_100215182
317 Ga0070672_100035528
318 Ga0070686_100104701
319 Ga0070686_100229763
320 Ga0070695_100127737
321 Ga0070696_100002555
322 Ga0070696_100153354
323 Ga0070665_100008764
324 Ga0070704_100000478
325 Ga0070704_100001847
326 Ga0070704_100002059
327 Ga0070664_100079151
328 Ga0070664_100483380
329 Ga0068857_100082954
330 Ga0068857_100451992
331 Ga0068854_100273645
332 Ga0070702_100018044
333 Ga0068852_100095627
334 Ga0068859_100002275
335 Ga0068859_100004259
336 Ga0068859_100039907
337 Ga0068859_100083260
338 Ga0068859_100739926
339 Ga0068864_100028989
340 Ga0068864_100135233
341 Ga0068864_100140747
342 Ga0068861_100000420
343 Ga0068861_100000673
344 Ga0068861_100296184
345 Ga0068870_10003704
346 Ga0068858_100016561
347 Ga0068858_100156273
348 Ga0068860_100017128
349 Ga0068862_100001595
350 Ga0068862_100527104
351 Ga0081455_10126359
352 Ga0075432_10019691
353 Ga0097621_100065992
354 Ga0097621_100122533
355 Ga0068871_100203991
356 Ga0068871_100224790
357 Ga0068871_100239905
358 Ga0075428_100001571
359 Ga0075430_100024650
360 Ga0075430_100038047
361 Ga0075433_10112731
362 Ga0075433_10391847
363 Ga0075434_100005536
364 Ga0075434_100022055
365 Ga0075434_100094247
366 Ga0075434_100125040
367 Ga0075429_100005543
368 Ga0075429_100054044
369 Ga0075429_100312969
370 Ga0075429_100549576
371 Ga0068865_100041320
372 Ga0097620_100002275
373 Ga0097620_100004259
374 Ga0097620_100039907
375 Ga0097620_100083260
376 Ga0097620_100739907
377 Ga0075435_100001382
378 Ga0075435_100250795
379 Ga0111539_10000149
380 Ga0111539_10003780
381 Ga0111539_10010500
382 Ga0111539_10019043
383 Ga0111539_10044591
384 Ga0111539_10220963
385 Ga0111539_10673946
386 Ga0114129_10008625
387 Ga0114129_10012111
388 Ga0114129_10019881
389 Ga0114129_10079722
390 Ga0114129_10658131
391 Ga0105243_10322320
392 Ga0105242_10001295
393 Ga0105242_10102574
394 Ga0105248_10013203
395 Ga0105248_10015104
396 Ga0105248_10102184
397 Ga0105249_10054657
398 Ga0157374_10044209
399 Ga0157378_10199267
400 Ga0157378_10538623
401 Ga0163162_10129044
402 Ga0157375_10001192
403 Ga0163163_10040987
404 Ga0157380_10694985
405 Ga0157377_10016801
406 Ga0157377_10093316
407 Ga0157376_10045559
408 Ga0157376_10046814
409 Ga0157376_10140315
410 Ga0157376_10489772
411 Ga0207710_10019149
412 Ga0207680_10121563
413 Ga0207645_10002322
414 Ga0207643_10004376
415 Ga0207643_10032554
416 Ga0207660_10265210
417 Ga0207662_10032920
418 Ga0207652_10154686
419 Ga0207646_10044446
420 Ga0207646_10052935
421 Ga0207681_10005522
422 Ga0207681_10141838
423 Ga0207650_10296214
424 Ga0207659_10000581
425 Ga0207659_10091215
426 Ga0207659_10108373
427 Ga0207686_10059150
428 Ga0207670_10005703
429 Ga0207670_10017223
430 Ga0207670_10085772
431 Ga0207691_10023138
432 Ga0207691_10071681
433 Ga0207691_10197607
434 Ga0207711_10014086
435 Ga0207711_10305373
436 Ga0207689_10028170
437 Ga0207661_10174529
438 Ga0207651_10172103
439 Ga0207712_10033740
440 Ga0207640_10025908
441 Ga0207677_10111708
442 Ga0207703_10321709
443 Ga0207703_10347347
444 Ga0207708_10001419
445 Ga0207708_10022633
446 Ga0207641_10355147
447 Ga0207648_10000409
448 Ga0207676_10091969
449 Ga0207676_10111034
450 Ga0207676_10118888
451 Ga0207676_10212922
452 Ga0207674_10050819
453 Ga0207675_100001233
454 Ga0207675_100003287
455 Ga0207675_100101721
456 Ga0207683_10479111
457 Ga0207698_10089650
458 Ga0209971_1026925
459 Ga0207428_10000359
460 Ga0207428_10000885
461 Ga0207428_10001323
462 Ga0207428_10012189
463 Ga0207428_10203810
464 Ga0268266_10004349
465 Ga0268265_10000725
466 Ga0268265_10065396
467 Ga0268264_10235558
468 Ga0268264_10575505
469 Ga0307409_100092179
470 Ga0307416_100610502
471 Ga0373941_0046549
472 Ga0373957_0035564
473 Ga0373931_0038652
474 Ga0373933_0086611
475 Ga0373937_0030437
476 Ga0451576_0005338
477 Ga0451576_0019689
478 Ga0495592_0150078
479 Ga0495603_0027591
480 Ga0495603_0206020
481 Ga0495629_0014567
482 Ga0495663_0103967
483 Ga0495609_0040867
484 Ga0495621_0023972
485 Ga0495621_0055171
486 Ga0495633_0197742
487 Ga0495659_0015026
488 Ga0495588_0010688
489 Ga0495658_0156753
490 Ga0495658_0161068
491 Ga0495669_0124101
492 Ga0495670_0014483
493 Ga0496104_0321885
494 Ga0496107_0198536
495 Ga0496108_0248496
496 Ga0496109_0621321
497 Ga0496112_0514906
498 Ga0501067_0025621
499 nmdc:mga05p37_10739_c2
500 nmdc:mga05p37_214599_c1
501 nmdc:mga05p37_439900_c1
502 nmdc:mga05p37_507615_c1
503 nmdc:mga05p37_5795_c1
504 nmdc:mga05p37_66374_c1
505 nmdc:mga05p37_800_c1
506 nmdc:mga09592_121831_c1
507 nmdc:mga09592_162994_c1
508 nmdc:mga09592_37149_c1
509 nmdc:mga09592_70034_c1
510 nmdc:mga0qj67_160196_c1
511 nmdc:mga0qj67_30687_c1
512 nmdc:mga08y16_111934_c1
513 nmdc:mga08y16_195289_c1
514 nmdc:mga08y16_233106_c1
515 nmdc:mga08y16_296421_c1
516 nmdc:mga08y16_37019_c1
517 nmdc:mga08y16_3795_c1
518 nmdc:mga08y16_428_c1
519 nmdc:mga08y16_5234_c1
520 nmdc:mga08y16_8105_c1
521 nmdc:mga0n895_255632_c1
522 nmdc:mga0n895_307577_c1
523 nmdc:mga0rr50_34110_c1
524 nmdc:mga0rr50_6392_c1
525 nmdc:mga0rr50_9772_c1
526 nmdc:mga0a205_265951_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

12

134

0.86

PF00581

Rhodanese

Rhodanese-like domain

162

277

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jgt-assembly1.cif.gz_A structure and kinetic analysis of h2s production by human mercaptopyruvate sulfurtransferase 0.9056 26 295
4jgt-assembly2.cif.gz_B structure and kinetic analysis of h2s production by human mercaptopyruvate sulfurtransferase 0.9026 26 298
3olh-assembly1.cif.gz_A human 3-mercaptopyruvate sulfurtransferase 0.9014 24 291
1boi-assembly1.cif.gz_A n-terminally truncated rhodanese 0.9002 27 291
8q5z-assembly1.cif.gz_A crystal structure of bovine thiosulfate sulfurtransferase 0.8991 23 298
ID Description Score Start End Superfamily
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9139 25 160 3.40.250.10
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9079 21 168 3.40.250.10
af_P9WHF5_161_279_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9065 176 299 3.40.250.10
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9037 26 172 3.40.250.10
af_Q24JL3_210_336_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9018 174 298 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A3D5FKF8-F1-model_v4 Sulfurtransferase 0.9941 28 169 GO:0004792
AF-A0A2G4JGA8-F1-model_v4 Sulfurtransferase 0.9906 23 302 GO:0004792
AF-A0A2V8EM36-F1-model_v4 Sulfurtransferase 0.9886 23 236 GO:0004792
AF-A0A7C4LBH3-F1-model_v4 Sulfurtransferase 0.9879 24 302 GO:0004792
AF-A0A7C2R8T0-F1-model_v4 Sulfurtransferase 0.9874 24 302 GO:0004792

Map