F372012

General Info

Members Datasets Scaffolds Average Seq Length
263 144 526 224

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0366873|Ga0373925_0366873_270_1043
Length 257
Sequence MSVCRISINQQTVSYKGQYVKKRPDAIMSGSMGGEMRFSDEAWQQNAALREAIHRLPFNTGLAAGALSRERFRFYIMQDAIYLGQYARVLALAAAKAPEIANLQAFASSALGAVAVEQALHGRYLQEFGVDPAAVLAAEPAPDCLAYTSFLLATAYQEPWEVLVAALLPCFWIYWDVAQAISRDAAPENPYRAWIDTYADPHFGEAVGRVIGTADAAAATTTPRIRQGMLGAFRRSTQYEWLFWDGAYHRRGWPAFG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
139 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
140 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
141 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
142 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
143 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
144 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0.38
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0.38
Rhizoplane 0.76
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 7.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0366873 3300037068 Bacteria 1171
2 Ga0070666_10081437 3300005335 Bacteria 2213
3 Ga0070666_10437026 3300005335 Unclassified 944
4 Ga0070680_100289024 3300005336 Bacteria 1389
5 Ga0070669_100639868 3300005353 Unclassified 894
6 Ga0070675_100273679 3300005354 Bacteria 1482
7 Ga0070671_100008266 3300005355 Bacteria 8329
8 Ga0070671_100661149 3300005355 Bacteria 905
9 Ga0070673_100163308 3300005364 Bacteria 1896
10 Ga0070709_10335328 3300005434 Bacteria 1114
11 Ga0070709_10497344 3300005434 Unclassified 926
12 Ga0070714_100054044 3300005435 Bacteria 3430
13 Ga0070714_100095047 3300005435 Bacteria 2616
14 Ga0070714_100173310 3300005435 Bacteria 1959
15 Ga0070713_100047093 3300005436 Bacteria 3542
16 Ga0070713_100129516 3300005436 Bacteria 2223
17 Ga0070713_100183094 3300005436 Bacteria 1883
18 Ga0070713_100191587 3300005436 Bacteria 1843
19 Ga0070713_100276455 3300005436 Bacteria 1539
20 Ga0070713_100452466 3300005436 Bacteria 1206
21 Ga0070710_10473293 3300005437 Bacteria 853
22 Ga0070710_10746401 3300005437 Unclassified 695
23 Ga0070711_100145550 3300005439 Unclassified 1781
24 Ga0070711_100173924 3300005439 Bacteria 1643
25 Ga0070711_100309529 3300005439 Unclassified 1259
26 Ga0070711_100367087 3300005439 Bacteria 1161
27 Ga0070711_100435798 3300005439 Bacteria 1071
28 Ga0070711_100508489 3300005439 Bacteria 994
29 Ga0070708_100133169 3300005445 Bacteria 2302
30 Ga0070708_100454864 3300005445 Bacteria 1208
31 Ga0070662_100462196 3300005457 Bacteria 1055
32 Ga0070681_10115066 3300005458 Bacteria 2628
33 Ga0070681_10133965 3300005458 Bacteria 2409
34 Ga0070681_10196709 3300005458 Bacteria 1935
35 Ga0070706_100031795 3300005467 Bacteria 4865
36 Ga0070707_100006521 3300005468 Bacteria 10839
37 Ga0070707_100412942 3300005468 Bacteria 1310
38 Ga0070698_100002505 3300005471 Bacteria 20247
39 Ga0070699_100400012 3300005518 Bacteria 1242
40 Ga0070679_100092599 3300005530 Bacteria 3010
41 Ga0070697_100077217 3300005536 Bacteria 2739
42 Ga0070697_100202883 3300005536 Bacteria 1686
43 Ga0070697_100739497 3300005536 Bacteria 869
44 Ga0070686_100358971 3300005544 Bacteria 1097
45 Ga0070665_100024552 3300005548 Bacteria 6074
46 Ga0068854_100925722 3300005578 Bacteria 767
47 Ga0068856_100058555 3300005614 Bacteria 3805
48 Ga0068856_100073362 3300005614 Bacteria 3389
49 Ga0068852_101252571 3300005616 Bacteria 763
50 Ga0081455_10061459 3300005937 Bacteria 3161
51 Ga0081540_1026462 3300005983 Bacteria 3310
52 Ga0070717_10000126 3300006028 Bacteria 56422
53 Ga0070717_10161945 3300006028 Bacteria 1941
54 Ga0070717_10200310 3300006028 Bacteria 1748
55 Ga0070717_10268776 3300006028 Bacteria 1510
56 Ga0070717_10296041 3300006028 Bacteria 1438
57 Ga0070716_100127424 3300006173 Bacteria 1603
58 Ga0070716_100418312 3300006173 Bacteria 968
59 Ga0070712_100011760 3300006175 Bacteria 5563
60 Ga0070712_100087466 3300006175 Unclassified 2273
61 Ga0070712_100161038 3300006175 Unclassified 1733
62 Ga0070712_100225457 3300006175 Bacteria 1486
63 Ga0068871_100993711 3300006358 Bacteria 781
64 Ga0075434_100558267 3300006871 Bacteria 1165
65 Ga0075436_100047944 3300006914 Bacteria 2947
66 Ga0075435_100197795 3300007076 Unclassified 1703
67 Ga0075435_100227900 3300007076 Bacteria 1583
68 Ga0099795_10031963 3300007788 Unclassified 1817
69 Ga0111539_10540915 3300009094 Bacteria 1357
70 Ga0105245_10467943 3300009098 Bacteria 1272
71 Ga0114129_10031727 3300009147 Bacteria 7469
72 Ga0105248_10126980 3300009177 Bacteria 2877
73 Ga0163163_10025563 3300014325 Bacteria 5630
74 Ga0163163_10243010 3300014325 Bacteria 1850
75 Ga0182008_10076873 3300014497 Bacteria 1642
76 Ga0157376_10311362 3300014969 Bacteria 1494
77 Ga0213875_10034215 3300021388 Bacteria 2399
78 Ga0224572_1012482 3300024225 Bacteria 1615
79 Ga0228598_1005991 3300024227 Bacteria 2526
80 Ga0207426_1060361 3300025302 Bacteria 1093
81 Ga0207692_10329850 3300025898 Bacteria 936
82 Ga0207692_10350735 3300025898 Unclassified 910
83 Ga0207692_10487409 3300025898 Unclassified 781
84 Ga0207680_10065784 3300025903 Bacteria 2227
85 Ga0207680_10167998 3300025903 Unclassified 1475
86 Ga0207699_10328910 3300025906 Bacteria 1074
87 Ga0207684_10012978 3300025910 Bacteria 7213
88 Ga0207684_10036312 3300025910 Bacteria 4183
89 Ga0207707_10090130 3300025912 Bacteria 2680
90 Ga0207707_10111281 3300025912 Bacteria 2394
91 Ga0207707_10362868 3300025912 Bacteria 1247
92 Ga0207693_10007201 3300025915 Bacteria 9162
93 Ga0207693_10040597 3300025915 Bacteria 3665
94 Ga0207693_10118259 3300025915 Bacteria 2081
95 Ga0207693_10217335 3300025915 Unclassified 1502
96 Ga0207693_10373911 3300025915 Bacteria 1115
97 Ga0207660_10273236 3300025917 Bacteria 1339
98 Ga0207646_10053459 3300025922 Bacteria 3613
99 Ga0207646_10465869 3300025922 Bacteria 1140
100 Ga0207700_10066098 3300025928 Bacteria 2762
101 Ga0207700_10141971 3300025928 Bacteria 1974
102 Ga0207700_10188364 3300025928 Bacteria 1732
103 Ga0207664_10015059 3300025929 Bacteria 5602
104 Ga0207664_10024804 3300025929 Bacteria 4509
105 Ga0207664_10077584 3300025929 Bacteria 2692
106 Ga0207664_10296075 3300025929 Bacteria 1423
107 Ga0207644_10029662 3300025931 Bacteria 3797
108 Ga0207644_10073509 3300025931 Bacteria 2507
109 Ga0207706_10317394 3300025933 Bacteria 1356
110 Ga0207665_10073216 3300025939 Bacteria 2342
111 Ga0207679_10224952 3300025945 Bacteria 1581
112 Ga0207640_10346035 3300025981 Bacteria 1193
113 Ga0207703_10703568 3300026035 Bacteria 961
114 Ga0207702_10048339 3300026078 Bacteria 3588
115 Ga0207702_10649479 3300026078 Bacteria 1037
116 Ga0268266_10391546 3300028379 Bacteria 1312
117 Ga0265338_10016101 3300028800 Bacteria 8158
118 Ga0265760_10039441 3300031090 Bacteria 1405
119 Ga0373928_0031436 3300035084 Bacteria 1179
120 Ga0373923_0107154 3300035111 Bacteria 1238
121 Ga0373923_0229106 3300035111 Bacteria 865
122 Ga0373936_0207930 3300035113 Bacteria 865
123 Ga0373941_0056761 3300035115 Bacteria 1262
124 Ga0373945_0079534 3300035116 Bacteria 1254
125 Ga0373953_0009591 3300035117 Bacteria 3338
126 Ga0373953_0038302 3300035117 Bacteria 1896
127 Ga0373953_0051203 3300035117 Bacteria 1669
128 Ga0373954_0048958 3300035118 Bacteria 1981
129 Ga0373954_0133067 3300035118 Bacteria 1211
130 Ga0373954_0147252 3300035118 Bacteria 1150
131 Ga0373957_0081914 3300035120 Bacteria 1275
132 Ga0373943_0043527 3300035170 Bacteria 2181
133 Ga0373924_0036242 3300035410 Bacteria 2004
134 Ga0373931_0318622 3300035691 Unclassified 965
135 Ga0373935_0104207 3300035692 Bacteria 1874
136 Ga0373935_0166964 3300035692 Bacteria 1503
137 Ga0373927_0039004 3300035695 Bacteria 3083
138 Ga0373927_0267181 3300035695 Bacteria 1125
139 Ga0373927_0379331 3300035695 Bacteria 932
140 Ga0373927_0456004 3300035695 Bacteria 844
141 Ga0373933_0004989 3300035724 Bacteria 7239
142 Ga0373933_0016454 3300035724 Bacteria 4136
143 Ga0373933_0041835 3300035724 Bacteria 2706
144 Ga0373933_0094163 3300035724 Bacteria 1852
145 Ga0373933_0133533 3300035724 Bacteria 1562
146 Ga0373947_0074575 3300035725 Bacteria 2088
147 Ga0373947_0287959 3300035725 Bacteria 1093
148 Ga0373937_0001071 3300036401 Bacteria 23094
149 Ga0373937_0004705 3300036401 Bacteria 11610
150 Ga0373937_0005356 3300036401 Bacteria 10973
151 Ga0373937_0048707 3300036401 Bacteria 3879
152 Ga0373937_0075648 3300036401 Bacteria 3109
153 Ga0373937_0103484 3300036401 Bacteria 2644
154 Ga0373925_0013423 3300037068 Bacteria 5928
155 Ga0373925_0028627 3300037068 Bacteria 4082
156 Ga0373925_0031922 3300037068 Bacteria 3874
157 Ga0373925_0115099 3300037068 Bacteria 2082
158 Ga0373925_0287967 3300037068 Bacteria 1324
159 Ga0373925_0834336 3300037068 Bacteria 760
160 Ga0395900_0282346 3300037418 Bacteria 1652
161 Ga0436364_0375554 3300037853 Bacteria 868
162 Ga0436364_0745692 3300037853 Unclassified 803
163 Ga0436364_1433799 3300037853 Bacteria 15900
164 Ga0436365_0427933 3300039437 Unclassified 736
165 Ga0436365_0653927 3300039437 Bacteria 3566
166 Ga0436365_0686407 3300039437 Bacteria 2267
167 Ga0436360_0743302 3300039438 Bacteria 1525
168 Ga0436360_0998796 3300039438 Bacteria 3518
169 Ga0436361_0479815 3300039447 Bacteria 2700
170 Ga0436361_0807218 3300039447 Bacteria 1341
171 Ga0436361_0882687 3300039447 Bacteria 4251
172 Ga0436361_1095557 3300039447 Bacteria 1788
173 Ga0436363_0648787 3300039450 Bacteria 1869
174 Ga0436363_0686471 3300039450 Unclassified 922
175 Ga0436363_1312099 3300039450 Bacteria 1203
176 Ga0436362_1014574 3300039453 Bacteria 3470
177 Ga0436362_1033985 3300039453 Bacteria 6707
178 Ga0436362_1267992 3300039453 Bacteria 2152
179 Ga0466965_0232566 3300044683 Bacteria 985
180 Ga0466959_0462781 3300045049 Bacteria 859
181 Ga0495592_0014443 3300046454 Bacteria 5994
182 Ga0495592_0020567 3300046454 Bacteria 5023
183 Ga0495603_0391092 3300046455 Bacteria 797
184 Ga0495629_0086067 3300046459 Bacteria 2193
185 Ga0495629_0097323 3300046459 Bacteria 2053
186 Ga0495651_0010306 3300046462 Bacteria 7182
187 Ga0495651_0012941 3300046462 Bacteria 6448
188 Ga0495653_0136929 3300046463 Bacteria 1726
189 Ga0495653_0359915 3300046463 Bacteria 934
190 Ga0495580_0174243 3300046472 Bacteria 1486
191 Ga0495662_0010262 3300046476 Bacteria 4591
192 Ga0495662_0173936 3300046476 Bacteria 1061
193 Ga0495664_0008236 3300046477 Bacteria 5807
194 Ga0495594_0303112 3300046499 Bacteria 910
195 Ga0495608_0006521 3300046511 Bacteria 8276
196 Ga0495608_0016412 3300046511 Bacteria 5124
197 Ga0495608_0173021 3300046511 Bacteria 1369
198 Ga0495618_0075978 3300046514 Bacteria 2140
199 Ga0495618_0099215 3300046514 Bacteria 1864
200 Ga0495628_0023301 3300046516 Bacteria 5083
201 Ga0495628_0038845 3300046516 Bacteria 3808
202 Ga0495630_0168593 3300046517 Bacteria 1668
203 Ga0495666_0238065 3300046526 Bacteria 831
204 Ga0495652_0172207 3300046529 Bacteria 1670
205 Ga0495652_0268636 3300046529 Bacteria 1255
206 Ga0495652_0452045 3300046529 Unclassified 899
207 Ga0495640_0012157 3300046533 Bacteria 6591
208 Ga0495640_0178945 3300046533 Bacteria 1352
209 Ga0495640_0367472 3300046533 Bacteria 886
210 Ga0495587_0001398 3300046536 Bacteria 16059
211 Ga0495645_0001188 3300046543 Bacteria 17779
212 Ga0495645_0221232 3300046543 Bacteria 1273
213 Ga0495633_0002919 3300046558 Bacteria 11726
214 Ga0495667_0004767 3300046559 Bacteria 9174
215 Ga0495667_0020744 3300046559 Bacteria 4434
216 Ga0495667_0077400 3300046559 Bacteria 2164
217 Ga0495667_0108957 3300046559 Bacteria 1789
218 Ga0495667_0264665 3300046559 Bacteria 1093
219 Ga0495634_0368615 3300046642 Bacteria 857
220 Ga0495657_0009958 3300046675 Bacteria 7172
221 Ga0495657_0016801 3300046675 Bacteria 5322
222 Ga0495657_0504939 3300046675 Bacteria 705
223 Ga0495599_0008092 3300046678 Bacteria 6384
224 Ga0495599_0031276 3300046678 Bacteria 3341
225 Ga0495623_0095325 3300046679 Bacteria 1819
226 Ga0495646_0030289 3300046680 Bacteria 3379
227 Ga0495624_0231443 3300046690 Bacteria 1119
228 Ga0495600_0031068 3300046809 Bacteria 3459
229 Ga0495604_0003907 3300047317 Bacteria 11864
230 Ga0495674_0004585 3300047319 Bacteria 13288
231 Ga0495674_0129031 3300047319 Bacteria 2131
232 Ga0495680_0075614 3300047322 Bacteria 2555
233 Ga0495680_0089876 3300047322 Bacteria 2305
234 Ga0495680_0104577 3300047322 Bacteria 2106
235 Ga0495675_0001602 3300047444 Bacteria 13605
236 Ga0495684_0025674 3300047471 Bacteria 4527
237 Ga0495684_0102523 3300047471 Bacteria 2163
238 Ga0495602_0000230 3300048088 Bacteria 52313
239 Ga0495602_0077628 3300048088 Bacteria 2809
240 Ga0496112_0063522 3300048915 Bacteria 3642
241 Ga0496113_0042276 3300048916 Bacteria 3367
242 Ga0496119_0060318 3300048922 Bacteria 2272
243 Ga0496120_0094367 3300048923 Bacteria 1593
244 Ga0496126_0212753 3300048929 Bacteria 1627
245 nmdc:mga05p37_316421_c1 3300050507 Bacteria 1849
246 nmdc:mga08y16_504840_c1 3300050511 Bacteria 1228
247 nmdc:mga08x19_406822_c1 3300050514 Bacteria 955
248 nmdc:mga08x19_95586_c1 3300050514 Bacteria 1966
249 Ga0495601_0001753 3300053077 Bacteria 12008
250 Ga0495601_0012057 3300053077 Bacteria 5181
251 Ga0495601_0075147 3300053077 Bacteria 2163
252 Ga0495612_0178519 3300053078 Bacteria 932
253 Ga0495595_0058907 3300053084 Bacteria 1794
254 Ga0495619_0010037 3300053085 Bacteria 5960
255 Ga0495619_0034017 3300053085 Bacteria 3312
256 Ga0495619_0273912 3300053085 Bacteria 1169
257 2596375741 2595698237 Bacteria 6712432
258 2861692474 2861691609 Bacteria 5628931
259 2889310627 2889306138 Bacteria 6358934
260 2902405242 2902405164 Bacteria 6784948
261 2928129286 2928125067 Bacteria 5937560
262 2932424590 2932422444 Bacteria 4678430
263 643592356 643348564 Bacteria 8839022
264 Ga0373925_0366873
265 Ga0070666_10081437
266 Ga0070666_10437026
267 Ga0070680_100289024
268 Ga0070669_100639868
269 Ga0070675_100273679
270 Ga0070671_100008266
271 Ga0070671_100661149
272 Ga0070673_100163308
273 Ga0070709_10335328
274 Ga0070709_10497344
275 Ga0070714_100054044
276 Ga0070714_100095047
277 Ga0070714_100173310
278 Ga0070713_100047093
279 Ga0070713_100129516
280 Ga0070713_100183094
281 Ga0070713_100191587
282 Ga0070713_100276455
283 Ga0070713_100452466
284 Ga0070710_10473293
285 Ga0070710_10746401
286 Ga0070711_100145550
287 Ga0070711_100173924
288 Ga0070711_100309529
289 Ga0070711_100367087
290 Ga0070711_100435798
291 Ga0070711_100508489
292 Ga0070708_100133169
293 Ga0070708_100454864
294 Ga0070662_100462196
295 Ga0070681_10115066
296 Ga0070681_10133965
297 Ga0070681_10196709
298 Ga0070706_100031795
299 Ga0070707_100006521
300 Ga0070707_100412942
301 Ga0070698_100002505
302 Ga0070699_100400012
303 Ga0070679_100092599
304 Ga0070697_100077217
305 Ga0070697_100202883
306 Ga0070697_100739497
307 Ga0070686_100358971
308 Ga0070665_100024552
309 Ga0068854_100925722
310 Ga0068856_100058555
311 Ga0068856_100073362
312 Ga0068852_101252571
313 Ga0081455_10061459
314 Ga0081540_1026462
315 Ga0070717_10000126
316 Ga0070717_10161945
317 Ga0070717_10200310
318 Ga0070717_10268776
319 Ga0070717_10296041
320 Ga0070716_100127424
321 Ga0070716_100418312
322 Ga0070712_100011760
323 Ga0070712_100087466
324 Ga0070712_100161038
325 Ga0070712_100225457
326 Ga0068871_100993711
327 Ga0075434_100558267
328 Ga0075436_100047944
329 Ga0075435_100197795
330 Ga0075435_100227900
331 Ga0099795_10031963
332 Ga0111539_10540915
333 Ga0105245_10467943
334 Ga0114129_10031727
335 Ga0105248_10126980
336 Ga0163163_10025563
337 Ga0163163_10243010
338 Ga0182008_10076873
339 Ga0157376_10311362
340 Ga0213875_10034215
341 Ga0224572_1012482
342 Ga0228598_1005991
343 Ga0207426_1060361
344 Ga0207692_10329850
345 Ga0207692_10350735
346 Ga0207692_10487409
347 Ga0207680_10065784
348 Ga0207680_10167998
349 Ga0207699_10328910
350 Ga0207684_10012978
351 Ga0207684_10036312
352 Ga0207707_10090130
353 Ga0207707_10111281
354 Ga0207707_10362868
355 Ga0207693_10007201
356 Ga0207693_10040597
357 Ga0207693_10118259
358 Ga0207693_10217335
359 Ga0207693_10373911
360 Ga0207660_10273236
361 Ga0207646_10053459
362 Ga0207646_10465869
363 Ga0207700_10066098
364 Ga0207700_10141971
365 Ga0207700_10188364
366 Ga0207664_10015059
367 Ga0207664_10024804
368 Ga0207664_10077584
369 Ga0207664_10296075
370 Ga0207644_10029662
371 Ga0207644_10073509
372 Ga0207706_10317394
373 Ga0207665_10073216
374 Ga0207679_10224952
375 Ga0207640_10346035
376 Ga0207703_10703568
377 Ga0207702_10048339
378 Ga0207702_10649479
379 Ga0268266_10391546
380 Ga0265338_10016101
381 Ga0265760_10039441
382 Ga0373928_0031436
383 Ga0373923_0107154
384 Ga0373923_0229106
385 Ga0373936_0207930
386 Ga0373941_0056761
387 Ga0373945_0079534
388 Ga0373953_0009591
389 Ga0373953_0038302
390 Ga0373953_0051203
391 Ga0373954_0048958
392 Ga0373954_0133067
393 Ga0373954_0147252
394 Ga0373957_0081914
395 Ga0373943_0043527
396 Ga0373924_0036242
397 Ga0373931_0318622
398 Ga0373935_0104207
399 Ga0373935_0166964
400 Ga0373927_0039004
401 Ga0373927_0267181
402 Ga0373927_0379331
403 Ga0373927_0456004
404 Ga0373933_0004989
405 Ga0373933_0016454
406 Ga0373933_0041835
407 Ga0373933_0094163
408 Ga0373933_0133533
409 Ga0373947_0074575
410 Ga0373947_0287959
411 Ga0373937_0001071
412 Ga0373937_0004705
413 Ga0373937_0005356
414 Ga0373937_0048707
415 Ga0373937_0075648
416 Ga0373937_0103484
417 Ga0373925_0013423
418 Ga0373925_0028627
419 Ga0373925_0031922
420 Ga0373925_0115099
421 Ga0373925_0287967
422 Ga0373925_0834336
423 Ga0395900_0282346
424 Ga0436364_0375554
425 Ga0436364_0745692
426 Ga0436364_1433799
427 Ga0436365_0427933
428 Ga0436365_0653927
429 Ga0436365_0686407
430 Ga0436360_0743302
431 Ga0436360_0998796
432 Ga0436361_0479815
433 Ga0436361_0807218
434 Ga0436361_0882687
435 Ga0436361_1095557
436 Ga0436363_0648787
437 Ga0436363_0686471
438 Ga0436363_1312099
439 Ga0436362_1014574
440 Ga0436362_1033985
441 Ga0436362_1267992
442 Ga0466965_0232566
443 Ga0466959_0462781
444 Ga0495592_0014443
445 Ga0495592_0020567
446 Ga0495603_0391092
447 Ga0495629_0086067
448 Ga0495629_0097323
449 Ga0495651_0010306
450 Ga0495651_0012941
451 Ga0495653_0136929
452 Ga0495653_0359915
453 Ga0495580_0174243
454 Ga0495662_0010262
455 Ga0495662_0173936
456 Ga0495664_0008236
457 Ga0495594_0303112
458 Ga0495608_0006521
459 Ga0495608_0016412
460 Ga0495608_0173021
461 Ga0495618_0075978
462 Ga0495618_0099215
463 Ga0495628_0023301
464 Ga0495628_0038845
465 Ga0495630_0168593
466 Ga0495666_0238065
467 Ga0495652_0172207
468 Ga0495652_0268636
469 Ga0495652_0452045
470 Ga0495640_0012157
471 Ga0495640_0178945
472 Ga0495640_0367472
473 Ga0495587_0001398
474 Ga0495645_0001188
475 Ga0495645_0221232
476 Ga0495633_0002919
477 Ga0495667_0004767
478 Ga0495667_0020744
479 Ga0495667_0077400
480 Ga0495667_0108957
481 Ga0495667_0264665
482 Ga0495634_0368615
483 Ga0495657_0009958
484 Ga0495657_0016801
485 Ga0495657_0504939
486 Ga0495599_0008092
487 Ga0495599_0031276
488 Ga0495623_0095325
489 Ga0495646_0030289
490 Ga0495624_0231443
491 Ga0495600_0031068
492 Ga0495604_0003907
493 Ga0495674_0004585
494 Ga0495674_0129031
495 Ga0495680_0075614
496 Ga0495680_0089876
497 Ga0495680_0104577
498 Ga0495675_0001602
499 Ga0495684_0025674
500 Ga0495684_0102523
501 Ga0495602_0000230
502 Ga0495602_0077628
503 Ga0496112_0063522
504 Ga0496113_0042276
505 Ga0496119_0060318
506 Ga0496120_0094367
507 Ga0496126_0212753
508 nmdc:mga05p37_316421_c1
509 nmdc:mga08y16_504840_c1
510 nmdc:mga08x19_406822_c1
511 nmdc:mga08x19_95586_c1
512 Ga0495601_0001753
513 Ga0495601_0012057
514 Ga0495601_0075147
515 Ga0495612_0178519
516 Ga0495595_0058907
517 Ga0495619_0010037
518 Ga0495619_0034017
519 Ga0495619_0273912
520 2596375741
521 2861692474
522 2889310627
523 2902405242
524 2928129286
525 2932424590
526 643592356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

43

250

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rtw-assembly1.cif.gz_D x-ray structure of pf1337, a tena homologue from pyrococcus furiosus. northeast structural genomics research consortium (nesg) target pfr34 0.9595 4 213
2qcx-assembly1.cif.gz_B crystal structure of bacillus subtilis tena y112f mutant complexed with formyl aminomethyl pyrimidine 0.9556 1 219
1to9-assembly1.cif.gz_A crystal structure of thi-4 protein from bacillus subtilis 0.949 3 219
1rtw-assembly1.cif.gz_D x-ray structure of pf1337, a tena homologue from pyrococcus furiosus. northeast structural genomics research consortium (nesg) target pfr34 0.946 4 213
2qcx-assembly1.cif.gz_B crystal structure of bacillus subtilis tena y112f mutant complexed with formyl aminomethyl pyrimidine 0.943 1 219
ID Description Score Start End Superfamily
1rtwA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9556 5 213 1.20.910.10
1to9A00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9443 3 219 1.20.910.10
1rtwA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9419 5 213 1.20.910.10
af_O94266_316_538_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9294 2 215 1.20.910.10
af_Q0J3L2_49_284_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9281 2 212 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A7X7AFU6-F1-model_v4 deleted 0.9934 112 221
AF-A0A151UGW6-F1-model_v4 Thiaminase-2 (EC 2.7.4.-) 0.9888 92 219 GO:0005829
GO:0006772
GO:0016740
AF-A0A7Z9VG96-F1-model_v4 Thiaminase II 0.9852 81 219 GO:0005829
GO:0006790
GO:0044281
GO:0072527
GO:1901615
AF-A0A238HGA9-F1-model_v4 Aminopyrimidine aminohydrolase (EC 3.5.99.2) 0.9769 2 221 GO:0005829
GO:0009228
GO:0009229
GO:0050334
AF-M1Z0V6-F1-model_v4 Aminopyrimidine aminohydrolase (EC 3.5.99.2) 0.9766 2 219 GO:0005829
GO:0009228
GO:0009229
GO:0050334

Map