F371892

General Info

Members Datasets Scaffolds Average Seq Length
263 171 263 246

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10157164|Ga0157380_101571642
Length 238
Sequence VRQIVLDTETTGLEIADGHRVIEIGCIELVHRRPTGRDWHRYLKPGRDVDPGALAVHGITNEFLATQPEFAQVAAEFLAFIDGAELVIHNADFDVGFLDSELATAGIAPPIADRCRVLDTLALARRMHPGQRNNLDALCKRYNVDNSARDLHGALLDARILADVYLAMSGGQAALGLDAAPTAPGAAAAAGTVARGAVRIPVICASDAELAAHEASLDTIDRVSGGRTIFRAGTARGA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
116 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
129 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
169 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
170 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 3.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 6.46
Rhizosphere 84.79
Stem 0
Stem Tuber 0
Unclassified 7.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100034275 3300005329 Bacteria 4636
2 Ga0070690_100016077 3300005330 Bacteria 4475
3 Ga0070670_100003186 3300005331 Bacteria 13546
4 Ga0070666_10047249 3300005335 Bacteria 2889
5 Ga0070666_10068047 3300005335 Bacteria 2419
6 Ga0070680_100044178 3300005336 Bacteria 3620
7 Ga0068868_100000140 3300005338 Bacteria 46540
8 Ga0070689_100004275 3300005340 Bacteria 9630
9 Ga0070689_100173383 3300005340 Bacteria 1748
10 Ga0070687_100041958 3300005343 Bacteria 2315
11 Ga0070687_100113239 3300005343 Bacteria 1539
12 Ga0070661_100004974 3300005344 Bacteria 9154
13 Ga0070669_100173114 3300005353 Bacteria 1684
14 Ga0070669_100324000 3300005353 Bacteria 1245
15 Ga0070669_100623508 3300005353 Bacteria 905
16 Ga0070671_100000102 3300005355 Bacteria 54494
17 Ga0070671_100034970 3300005355 Bacteria 4161
18 Ga0070673_100024242 3300005364 Bacteria 4446
19 Ga0070667_100000545 3300005367 Bacteria 37543
20 Ga0070667_100004709 3300005367 Bacteria 11441
21 Ga0070701_10043674 3300005438 Bacteria 2294
22 Ga0070711_100020773 3300005439 Bacteria 4237
23 Ga0070711_100321171 3300005439 Bacteria 1237
24 Ga0070705_100064235 3300005440 Bacteria 2192
25 Ga0070700_100003343 3300005441 Bacteria 8270
26 Ga0070663_100071637 3300005455 Bacteria 2522
27 Ga0070678_100197424 3300005456 Bacteria 1658
28 Ga0068867_100278768 3300005459 Bacteria 1370
29 Ga0070685_10414406 3300005466 Bacteria 936
30 Ga0070699_100508090 3300005518 Bacteria 1095
31 Ga0070684_100014147 3300005535 Bacteria 6453
32 Ga0068853_100134823 3300005539 Bacteria 2213
33 Ga0070686_100007297 3300005544 Bacteria 6164
34 Ga0070686_100009063 3300005544 Bacteria 5581
35 Ga0070696_100297846 3300005546 Bacteria 1234
36 Ga0070665_100033659 3300005548 Bacteria 5156
37 Ga0070665_100317353 3300005548 Bacteria 1562
38 Ga0070704_100003086 3300005549 Bacteria 9484
39 Ga0068855_100926491 3300005563 Bacteria 919
40 Ga0070664_100001539 3300005564 Bacteria 18430
41 Ga0070664_100370113 3300005564 Bacteria 1306
42 Ga0068856_100093613 3300005614 Bacteria 2991
43 Ga0068856_100384401 3300005614 Bacteria 1423
44 Ga0070702_100001690 3300005615 Bacteria 9157
45 Ga0068852_100461647 3300005616 Bacteria 1259
46 Ga0068859_100002762 3300005617 Bacteria 17790
47 Ga0068859_100017284 3300005617 Bacteria 7243
48 Ga0068859_100064316 3300005617 Bacteria 3701
49 Ga0068859_100124230 3300005617 Bacteria 2649
50 Ga0068859_100133878 3300005617 Bacteria 2550
51 Ga0068864_100004386 3300005618 Bacteria 11586
52 Ga0068864_100061342 3300005618 Bacteria 3257
53 Ga0068861_100085073 3300005719 Bacteria 2483
54 Ga0068861_100243265 3300005719 Bacteria 1531
55 Ga0068851_10054590 3300005834 Bacteria 2035
56 Ga0068863_100000238 3300005841 Bacteria 58572
57 Ga0068863_100001120 3300005841 Bacteria 26763
58 Ga0068863_100002124 3300005841 Bacteria 19659
59 Ga0068858_100001102 3300005842 Bacteria 27941
60 Ga0068858_100002757 3300005842 Bacteria 17656
61 Ga0068858_100425606 3300005842 Bacteria 1277
62 Ga0068860_100000270 3300005843 Bacteria 75836
63 Ga0068860_100001877 3300005843 Bacteria 22327
64 Ga0068860_100064026 3300005843 Bacteria 3493
65 Ga0068860_100095951 3300005843 Bacteria 2826
66 Ga0068862_100014465 3300005844 Bacteria 6548
67 Ga0068862_100080627 3300005844 Bacteria 2822
68 Ga0081455_10000663 3300005937 Bacteria 44594
69 Ga0081539_10063481 3300005985 Bacteria 2015
70 Ga0097621_100004963 3300006237 Bacteria 9327
71 Ga0097621_100109508 3300006237 Bacteria 2333
72 Ga0068871_100017580 3300006358 Bacteria 5415
73 Ga0068871_100028282 3300006358 Bacteria 4394
74 Ga0075428_100154298 3300006844 Bacteria 2495
75 Ga0075428_100300552 3300006844 Bacteria 1725
76 Ga0097620_100002762 3300006931 Bacteria 17790
77 Ga0097620_100017284 3300006931 Bacteria 7243
78 Ga0097620_100064313 3300006931 Bacteria 3701
79 Ga0097620_100124228 3300006931 Bacteria 2649
80 Ga0097620_100133884 3300006931 Bacteria 2550
81 Ga0105240_10082841 3300009093 Bacteria 3939
82 Ga0105240_10088735 3300009093 Bacteria 3783
83 Ga0105240_10353054 3300009093 Bacteria 1668
84 Ga0111539_10227169 3300009094 Bacteria 2174
85 Ga0105245_10002520 3300009098 Bacteria 16517
86 Ga0105247_10000126 3300009101 Bacteria 74123
87 Ga0105247_10046923 3300009101 Bacteria 2652
88 Ga0105243_10146388 3300009148 Bacteria 2021
89 Ga0105243_10184834 3300009148 Bacteria 1815
90 Ga0105241_10251524 3300009174 Bacteria 1498
91 Ga0105241_10278830 3300009174 Bacteria 1427
92 Ga0105241_10304402 3300009174 Bacteria 1369
93 Ga0105248_10001120 3300009177 Bacteria 29831
94 Ga0105237_10192334 3300009545 Bacteria 2040
95 Ga0105237_10961811 3300009545 Bacteria 861
96 Ga0105238_10016040 3300009551 Bacteria 7576
97 Ga0105238_10126884 3300009551 Bacteria 2530
98 Ga0105249_10044713 3300009553 Bacteria 4026
99 Ga0105249_10421677 3300009553 Bacteria 1368
100 Ga0105239_10019344 3300010375 Bacteria 7520
101 Ga0105246_10000898 3300011119 Bacteria 17066
102 Ga0157374_10001917 3300013296 Bacteria 17432
103 Ga0157374_10691360 3300013296 Bacteria 1033
104 Ga0157378_10223181 3300013297 Bacteria 1792
105 Ga0163162_10001076 3300013306 Bacteria 25422
106 Ga0163162_10054238 3300013306 Bacteria 4032
107 Ga0157375_10003406 3300013308 Bacteria 13779
108 Ga0163163_10001074 3300014325 Bacteria 23194
109 Ga0163163_10001397 3300014325 Bacteria 20390
110 Ga0163163_10025535 3300014325 Bacteria 5633
111 Ga0163163_10703432 3300014325 Bacteria 1074
112 Ga0157380_10032268 3300014326 Bacteria 4028
113 Ga0157380_10049889 3300014326 Bacteria 3303
114 Ga0157380_10157164 3300014326 Bacteria 1972
115 Ga0157380_10175721 3300014326 Bacteria 1876
116 Ga0157377_10235991 3300014745 Bacteria 1178
117 Ga0157379_10001859 3300014968 Bacteria 17475
118 Ga0157379_10031511 3300014968 Bacteria 4723
119 Ga0157379_10033325 3300014968 Bacteria 4595
120 Ga0157379_10242561 3300014968 Bacteria 1634
121 Ga0213876_10039611 3300021384 Bacteria 2490
122 Ga0207656_10021168 3300025321 Bacteria 2595
123 Ga0207710_10001964 3300025900 Bacteria 9825
124 Ga0207680_10078821 3300025903 Bacteria 2064
125 Ga0207680_10103808 3300025903 Bacteria 1831
126 Ga0207680_10377378 3300025903 Bacteria 999
127 Ga0207647_10034952 3300025904 Bacteria 3205
128 Ga0207695_10074787 3300025913 Bacteria 3448
129 Ga0207695_10109501 3300025913 Bacteria 2744
130 Ga0207663_10246640 3300025916 Bacteria 1312
131 Ga0207662_10135868 3300025918 Bacteria 1554
132 Ga0207649_10006436 3300025920 Bacteria 6379
133 Ga0207694_10119045 3300025924 Bacteria 2107
134 Ga0207694_10407476 3300025924 Bacteria 1131
135 Ga0207650_10341884 3300025925 Bacteria 1229
136 Ga0207659_10407230 3300025926 Bacteria 1139
137 Ga0207687_10008849 3300025927 Bacteria 6581
138 Ga0207644_10023911 3300025931 Bacteria 4190
139 Ga0207706_10670414 3300025933 Bacteria 887
140 Ga0207709_10033274 3300025935 Bacteria 3025
141 Ga0207670_10045783 3300025936 Bacteria 2902
142 Ga0207711_10022143 3300025941 Bacteria 5312
143 Ga0207661_10017644 3300025944 Bacteria 5288
144 Ga0207679_10377538 3300025945 Bacteria 1242
145 Ga0207667_10485279 3300025949 Bacteria 1254
146 Ga0207651_10014682 3300025960 Bacteria 4531
147 Ga0207712_10034126 3300025961 Bacteria 3445
148 Ga0207640_10412924 3300025981 Bacteria 1102
149 Ga0207658_10003397 3300025986 Bacteria 11266
150 Ga0207658_10216783 3300025986 Bacteria 1607
151 Ga0207703_10000299 3300026035 Bacteria 54610
152 Ga0207703_10006867 3300026035 Bacteria 9065
153 Ga0207703_10013696 3300026035 Bacteria 6320
154 Ga0207639_10036484 3300026041 Bacteria 3643
155 Ga0207678_10040928 3300026067 Bacteria 4017
156 Ga0207708_10009569 3300026075 Bacteria 7185
157 Ga0207641_10000189 3300026088 Bacteria 86363
158 Ga0207641_10000934 3300026088 Bacteria 30167
159 Ga0207641_10029991 3300026088 Bacteria 4501
160 Ga0207641_10398240 3300026088 Bacteria 1321
161 Ga0207676_10036330 3300026095 Bacteria 3746
162 Ga0207676_10346483 3300026095 Bacteria 1372
163 Ga0207675_100009227 3300026118 Bacteria 9250
164 Ga0207675_100134266 3300026118 Bacteria 2347
165 Ga0209966_1015158 3300027695 Bacteria 1446
166 Ga0268266_10011152 3300028379 Bacteria 7823
167 Ga0268266_10152780 3300028379 Bacteria 2082
168 Ga0268265_10003985 3300028380 Bacteria 10401
169 Ga0268265_10196014 3300028380 Bacteria 1748
170 Ga0268264_10000164 3300028381 Bacteria 147861
171 Ga0268264_10006996 3300028381 Bacteria 9468
172 Ga0268264_10526659 3300028381 Bacteria 1156
173 Ga0307515_10143944 3300028794 Bacteria 2538
174 Ga0307511_10000629 3300030521 Bacteria 37797
175 Ga0307511_10052571 3300030521 Bacteria 3244
176 Ga0307509_10005253 3300031507 Bacteria 18134
177 Ga0307509_10021518 3300031507 Bacteria 7287
178 Ga0307509_10206550 3300031507 Bacteria 1794
179 Ga0307508_10189394 3300031616 Bacteria 1659
180 Ga0316579_10001368 3300031691 Bacteria 8836
181 Ga0316579_10178679 3300031691 Bacteria 1026
182 Ga0316576_10047613 3300031727 Bacteria 3107
183 Ga0316576_10057235 3300031727 Bacteria 2848
184 Ga0316578_10000462 3300031728 Bacteria 13535
185 Ga0316578_10000657 3300031728 Bacteria 12257
186 Ga0316577_10016681 3300031733 Bacteria 4052
187 Ga0316577_10146119 3300031733 Bacteria 1332
188 Ga0307406_10438405 3300031901 Bacteria 1045
189 Ga0307409_100680321 3300031995 Unclassified 1026
190 Ga0307411_10299872 3300032005 Bacteria 1288
191 Ga0316583_10003176 3300032133 Bacteria 5775
192 Ga0316585_10000348 3300032137 Bacteria 10541
193 Ga0316580_10003352 3300032139 Bacteria 4535
194 Ga0316593_10016445 3300032168 Bacteria 2243
195 Ga0316593_10019228 3300032168 Bacteria 2109
196 Ga0316593_10061622 3300032168 Bacteria 1283
197 Ga0307510_10017214 3300033180 Bacteria 8527
198 Ga0316592_1008573 3300033524 Bacteria 2026
199 Ga0316592_1019440 3300033524 Bacteria 1436
200 Ga0316588_1008455 3300033528 Bacteria 2120
201 Ga0316588_1009784 3300033528 Bacteria 2007
202 Ga0316596_1003819 3300033541 Bacteria 3332
203 Ga0316596_1007618 3300033541 Bacteria 2563
204 Ga0316596_1039330 3300033541 Bacteria 1241
205 Ga0373940_0106037 3300035088 Bacteria 858
206 Ga0316574_0005283 3300035398 Bacteria 6878
207 Ga0373931_0055200 3300035691 Bacteria 2125
208 Ga0316582_0002776 3300036647 Bacteria 8338
209 Ga0316582_0035707 3300036647 Bacteria 3072
210 Ga0316582_0209194 3300036647 Bacteria 1332
211 Ga0316584_0002544 3300036712 Bacteria 11577
212 Ga0316584_0007919 3300036712 Bacteria 7292
213 Ga0316584_0042450 3300036712 Bacteria 3391
214 Ga0316581_0071630 3300037588 Bacteria 1065
215 Ga0400483_035656 3300039062 Bacteria 8570
216 Ga0400483_154665 3300039062 Bacteria 8820
217 Ga0436365_0292777 3300039437 Bacteria 7278
218 Ga0436363_0892344 3300039450 Bacteria 2268
219 Ga0451791_0604978 3300041451 Bacteria 3533
220 Ga0451791_1651729 3300041451 Bacteria 997
221 Ga0451797_0713288 3300041453 Bacteria 1792
222 Ga0451802_0420246 3300041460 Bacteria 2631
223 Ga0451807_0472349 3300041486 Bacteria 1557
224 Ga0451807_0605089 3300041486 Bacteria 4839
225 Ga0451837_0846489 3300041494 Bacteria 1677
226 Ga0466969_0029678 3300044656 Bacteria 2791
227 Ga0466965_0315498 3300044683 Bacteria 851
228 Ga0466961_0066548 3300044693 Bacteria 2288
229 Ga0466971_0003446 3300044719 Bacteria 6755
230 Ga0466957_0109908 3300044842 Bacteria 1747
231 Ga0466958_0075327 3300045836 Bacteria 2070
232 Ga0495590_0007379 3300046457 Bacteria 4244
233 Ga0495638_0133389 3300046460 Bacteria 1457
234 Ga0495686_0130036 3300047472 Bacteria 1494
235 Ga0496101_0138305 3300048904 Bacteria 1855
236 Ga0496102_0084657 3300048905 Bacteria 2927
237 Ga0496104_0028763 3300048907 Bacteria 5151
238 Ga0496106_0376815 3300048909 Bacteria 1140
239 Ga0496108_0021311 3300048911 Bacteria 5327
240 Ga0496109_0010404 3300048912 Bacteria 7946
241 Ga0496111_0114092 3300048914 Bacteria 1992
242 Ga0496114_0002009 3300048917 Bacteria 15468
243 Ga0496114_0152068 3300048917 Bacteria 2008
244 Ga0496114_0175294 3300048917 Bacteria 1871
245 Ga0496115_0144617 3300048918 Bacteria 1962
246 Ga0496116_0000005 3300048919 Bacteria 827804
247 Ga0496121_0000126 3300048924 Bacteria 168873
248 Ga0496125_0001270 3300048928 Bacteria 37575
249 Ga0496125_0026797 3300048928 Bacteria 5237
250 Ga0496126_0067446 3300048929 Bacteria 3197
251 Ga0501034_0175537 3300049571 Bacteria 2109
252 Ga0501072_0157411 3300049588 Bacteria 1812
253 Ga0501073_0220197 3300049589 Bacteria 1311
254 Ga0501045_0182242 3300049824 Bacteria 1565
255 nmdc:mga09592_422996_c1 3300050508 Bacteria 1150
256 nmdc:mga08y16_92846_c1 3300050511 Bacteria 3145
257 nmdc:mga0a205_269454_c1 3300050515 Bacteria 1580
258 Ga0495601_0020338 3300053077 Bacteria 4054
259 Ga0500641_0009063 3300053096 Bacteria 3568
260 Ga0500591_112177 3300053115 Unclassified 1140
261 Ga0500639_113531 3300053163 Bacteria 1314
262 Ga0500576_108267 3300053725 Bacteria 1119
263 Ga0466962_0005292 3300061719 Bacteria 6202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100425606 Ga0068858_1004256062 210
2 3300005439 Ga0070711_100321171 Ga0070711_1003211711 215
3 3300032168 Ga0316593_10016445 Ga0316593_100164451 215
4 3300033180 Ga0307510_10017214 Ga0307510_100172146 225
5 3300033541 Ga0316596_1003819 Ga0316596_10038193 228
6 3300048919 Ga0496116_0000005 Ga0496116_0000005_272193_272891 229
7 3300048924 Ga0496121_0000126 Ga0496121_0000126_51410_52108 229
8 3300044656 Ga0466969_0029678 Ga0466969_0029678_1514_2266 231
9 3300044693 Ga0466961_0066548 Ga0466961_0066548_1038_1790 231
10 3300044719 Ga0466971_0003446 Ga0466971_0003446_2642_3394 231
11 3300044842 Ga0466957_0109908 Ga0466957_0109908_813_1565 231
12 3300045836 Ga0466958_0075327 Ga0466958_0075327_892_1644 231
13 3300061719 Ga0466962_0005292 Ga0466962_0005292_4923_5675 231
14 3300028794 Ga0307515_10143944 Ga0307515_101439442 232
15 3300036647 Ga0316582_0035707 Ga0316582_0035707_1018_1722 232
16 3300036647 Ga0316582_0209194 Ga0316582_0209194_35_739 232
17 3300044683 Ga0466965_0315498 Ga0466965_0315498_34_786 232
18 3300046457 Ga0495590_0007379 Ga0495590_0007379_999_1709 234
19 3300046460 Ga0495638_0133389 Ga0495638_0133389_388_1098 234
20 3300005335 Ga0070666_10047249 Ga0070666_100472492 235
21 3300005539 Ga0068853_100134823 Ga0068853_1001348232 235
22 3300005564 Ga0070664_100370113 Ga0070664_1003701132 235
23 3300005614 Ga0068856_100093613 Ga0068856_1000936131 235
24 3300005617 Ga0068859_100124230 Ga0068859_1001242302 235
25 3300005841 Ga0068863_100000238 Ga0068863_10000023838 235
26 3300005843 Ga0068860_100000270 Ga0068860_10000027016 235
27 3300006931 Ga0097620_100124228 Ga0097620_1001242282 235
28 3300009174 Ga0105241_10251524 Ga0105241_102515242 235
29 3300009545 Ga0105237_10192334 Ga0105237_101923342 235
30 3300009551 Ga0105238_10126884 Ga0105238_101268842 235
31 3300009553 Ga0105249_10421677 Ga0105249_104216772 235
32 3300013296 Ga0157374_10691360 Ga0157374_106913602 235
33 3300013306 Ga0163162_10054238 Ga0163162_100542383 235
34 3300014325 Ga0163163_10025535 Ga0163163_100255351 235
35 3300014325 Ga0163163_10703432 Ga0163163_107034322 235
36 3300014326 Ga0157380_10157164 Ga0157380_101571642 235
37 3300014968 Ga0157379_10033325 Ga0157379_100333252 235
38 3300025903 Ga0207680_10078821 Ga0207680_100788212 235
39 3300025903 Ga0207680_10103808 Ga0207680_101038081 235
40 3300025904 Ga0207647_10034952 Ga0207647_100349523 235
41 3300025913 Ga0207695_10074787 Ga0207695_100747873 235
42 3300025924 Ga0207694_10119045 Ga0207694_101190452 235
43 3300025945 Ga0207679_10377538 Ga0207679_103775382 235
44 3300025949 Ga0207667_10485279 Ga0207667_104852792 235
45 3300025981 Ga0207640_10412924 Ga0207640_104129241 235
46 3300026041 Ga0207639_10036484 Ga0207639_100364842 235
47 3300026067 Ga0207678_10040928 Ga0207678_100409283 235
48 3300026088 Ga0207641_10000189 Ga0207641_1000018945 235
49 3300028381 Ga0268264_10000164 Ga0268264_10000164105 235
50 3300039062 Ga0400483_035656 Ga0400483_035656_6208_6924 235
51 3300039062 Ga0400483_154665 Ga0400483_154665_2979_3695 235
52 3300047472 Ga0495686_0130036 Ga0495686_0130036_510_1223 235
53 3300053725 Ga0500576_108267 Ga0500576_108267_363_1076 235
54 3300005353 Ga0070669_100173114 Ga0070669_1001731142 236
55 3300005353 Ga0070669_100623508 Ga0070669_1006235081 236
56 3300006844 Ga0075428_100154298 Ga0075428_1001542983 236
57 3300005518 Ga0070699_100508090 Ga0070699_1005080901 237
58 3300009174 Ga0105241_10278830 Ga0105241_102788302 237
59 3300031901 Ga0307406_10438405 Ga0307406_104384051 237
60 3300005985 Ga0081539_10063481 Ga0081539_100634813 239
61 3300041451 Ga0451791_0604978 Ga0451791_0604978_1977_2699 239
62 3300041453 Ga0451797_0713288 Ga0451797_0713288_166_888 239
63 3300041460 Ga0451802_0420246 Ga0451802_0420246_1298_2020 239
64 3300041486 Ga0451807_0605089 Ga0451807_0605089_2845_3567 239
65 3300041494 Ga0451837_0846489 Ga0451837_0846489_502_1224 239
66 3300031691 Ga0316579_10178679 Ga0316579_101786791 240
67 3300031727 Ga0316576_10057235 Ga0316576_100572352 240
68 3300031728 Ga0316578_10000657 Ga0316578_100006573 240
69 3300032139 Ga0316580_10003352 Ga0316580_100033522 240
70 3300032168 Ga0316593_10061622 Ga0316593_100616222 240
71 3300033524 Ga0316592_1019440 Ga0316592_10194401 240
72 3300033528 Ga0316588_1008455 Ga0316588_10084551 240
73 3300036712 Ga0316584_0002544 Ga0316584_0002544_3166_3903 240
74 3300041486 Ga0451807_0472349 Ga0451807_0472349_784_1512 241
75 3300006237 Ga0097621_100109508 Ga0097621_1001095083 242
76 3300006358 Ga0068871_100017580 Ga0068871_1000175803 242
77 3300031691 Ga0316579_10001368 Ga0316579_100013681 242
78 3300031728 Ga0316578_10000462 Ga0316578_1000046210 242
79 3300031733 Ga0316577_10016681 Ga0316577_100166812 242
80 3300032133 Ga0316583_10003176 Ga0316583_100031762 242
81 3300032137 Ga0316585_10000348 Ga0316585_100003484 242
82 3300032168 Ga0316593_10019228 Ga0316593_100192282 242
83 3300033524 Ga0316592_1008573 Ga0316592_10085731 242
84 3300033528 Ga0316588_1009784 Ga0316588_10097842 242
85 3300033541 Ga0316596_1039330 Ga0316596_10393301 242
86 3300035398 Ga0316574_0005283 Ga0316574_0005283_2676_3413 242
87 3300036647 Ga0316582_0002776 Ga0316582_0002776_1908_2645 242
88 3300036712 Ga0316584_0042450 Ga0316584_0042450_1204_1941 242
89 3300037588 Ga0316581_0071630 Ga0316581_0071630_241_978 242
90 3300041451 Ga0451791_1651729 Ga0451791_1651729_199_939 242
91 3300048917 Ga0496114_0152068 Ga0496114_0152068_505_1248 242
92 3300005330 Ga0070690_100016077 Ga0070690_1000160774 243
93 3300005340 Ga0070689_100004275 Ga0070689_1000042758 243
94 3300005438 Ga0070701_10043674 Ga0070701_100436742 243
95 3300005440 Ga0070705_100064235 Ga0070705_1000642352 243
96 3300005459 Ga0068867_100278768 Ga0068867_1002787682 243
97 3300005544 Ga0070686_100007297 Ga0070686_1000072974 243
98 3300005546 Ga0070696_100297846 Ga0070696_1002978461 243
99 3300005617 Ga0068859_100133878 Ga0068859_1001338782 243
100 3300005618 Ga0068864_100061342 Ga0068864_1000613423 243
101 3300005719 Ga0068861_100085073 Ga0068861_1000850732 243
102 3300005843 Ga0068860_100064026 Ga0068860_1000640262 243
103 3300005844 Ga0068862_100080627 Ga0068862_1000806273 243
104 3300005937 Ga0081455_10000663 Ga0081455_1000066313 243
105 3300006931 Ga0097620_100133884 Ga0097620_1001338844 243
106 3300014326 Ga0157380_10175721 Ga0157380_101757212 243
107 3300025936 Ga0207670_10045783 Ga0207670_100457833 243
108 3300026088 Ga0207641_10398240 Ga0207641_103982401 243
109 3300026095 Ga0207676_10346483 Ga0207676_103464832 243
110 3300026118 Ga0207675_100009227 Ga0207675_1000092278 243
111 3300028380 Ga0268265_10196014 Ga0268265_101960142 243
112 3300031507 Ga0307509_10021518 Ga0307509_100215185 243
113 3300031507 Ga0307509_10206550 Ga0307509_102065503 243
114 3300031727 Ga0316576_10047613 Ga0316576_100476131 243
115 3300049571 Ga0501034_0175537 Ga0501034_0175537_770_1510 243
116 3300005616 Ga0068852_100461647 Ga0068852_1004616471 244
117 3300048917 Ga0496114_0175294 Ga0496114_0175294_63_812 244
118 3300005614 Ga0068856_100384401 Ga0068856_1003844012 245
119 3300014326 Ga0157380_10049889 Ga0157380_100498893 245
120 3300014968 Ga0157379_10242561 Ga0157379_102425611 245
121 3300031733 Ga0316577_10146119 Ga0316577_101461192 245
122 3300033541 Ga0316596_1007618 Ga0316596_10076182 245
123 3300036712 Ga0316584_0007919 Ga0316584_0007919_5380_6126 245
124 3300049588 Ga0501072_0157411 Ga0501072_0157411_440_1180 245
125 3300049824 Ga0501045_0182242 Ga0501045_0182242_655_1395 245
126 3300050515 nmdc:mga0a205_269454_c1 nmdc:mga0a205_269454_c1_722_1471 245
127 3300005456 Ga0070678_100197424 Ga0070678_1001974242 246
128 3300005466 Ga0070685_10414406 Ga0070685_104144061 246
129 3300009094 Ga0111539_10227169 Ga0111539_102271693 246
130 3300025926 Ga0207659_10407230 Ga0207659_104072301 246
131 3300031995 Ga0307409_100680321 Ga0307409_1006803211 246
132 3300032005 Ga0307411_10299872 Ga0307411_102998721 246
133 3300005336 Ga0070680_100044178 Ga0070680_1000441784 247
134 3300005355 Ga0070671_100000102 Ga0070671_10000010214 247
135 3300005367 Ga0070667_100000545 Ga0070667_10000054528 247
136 3300005455 Ga0070663_100071637 Ga0070663_1000716372 247
137 3300005548 Ga0070665_100317353 Ga0070665_1003173532 247
138 3300005617 Ga0068859_100002762 Ga0068859_1000027628 247
139 3300005841 Ga0068863_100001120 Ga0068863_10000112015 247
140 3300005842 Ga0068858_100001102 Ga0068858_10000110215 247
141 3300005843 Ga0068860_100001877 Ga0068860_1000018773 247
142 3300005844 Ga0068862_100014465 Ga0068862_1000144653 247
143 3300006844 Ga0075428_100300552 Ga0075428_1003005522 247
144 3300006931 Ga0097620_100002762 Ga0097620_1000027628 247
145 3300009093 Ga0105240_10088735 Ga0105240_100887352 247
146 3300009093 Ga0105240_10353054 Ga0105240_103530542 247
147 3300009101 Ga0105247_10000126 Ga0105247_1000012611 247
148 3300009545 Ga0105237_10961811 Ga0105237_109618111 247
149 3300009553 Ga0105249_10044713 Ga0105249_100447133 247
150 3300014325 Ga0163163_10001074 Ga0163163_1000107417 247
151 3300014968 Ga0157379_10001859 Ga0157379_100018594 247
152 3300025900 Ga0207710_10001964 Ga0207710_100019643 247
153 3300025913 Ga0207695_10109501 Ga0207695_101095013 247
154 3300025961 Ga0207712_10034126 Ga0207712_100341263 247
155 3300025986 Ga0207658_10003397 Ga0207658_100033976 247
156 3300026035 Ga0207703_10000299 Ga0207703_1000029913 247
157 3300026088 Ga0207641_10000934 Ga0207641_100009347 247
158 3300028379 Ga0268266_10011152 Ga0268266_100111526 247
159 3300028380 Ga0268265_10003985 Ga0268265_100039853 247
160 3300028381 Ga0268264_10006996 Ga0268264_100069963 247
161 3300030521 Ga0307511_10000629 Ga0307511_1000062931 247
162 3300031507 Ga0307509_10005253 Ga0307509_100052538 247
163 3300031616 Ga0307508_10189394 Ga0307508_101893942 247
164 3300048905 Ga0496102_0084657 Ga0496102_0084657_1742_2494 247
165 3300048911 Ga0496108_0021311 Ga0496108_0021311_3621_4373 247
166 3300048928 Ga0496125_0026797 Ga0496125_0026797_245_997 247
167 3300049589 Ga0501073_0220197 Ga0501073_0220197_28_783 247
168 3300050508 nmdc:mga09592_422996_c1 nmdc:mga09592_422996_c1_298_1044 247
169 3300050511 nmdc:mga08y16_92846_c1 nmdc:mga08y16_92846_c1_150_896 247
170 3300005343 Ga0070687_100113239 Ga0070687_1001132392 248
171 3300005353 Ga0070669_100324000 Ga0070669_1003240002 248
172 3300005441 Ga0070700_100003343 Ga0070700_1000033435 248
173 3300005549 Ga0070704_100003086 Ga0070704_1000030866 248
174 3300005617 Ga0068859_100064316 Ga0068859_1000643162 248
175 3300005719 Ga0068861_100243265 Ga0068861_1002432653 248
176 3300006931 Ga0097620_100064313 Ga0097620_1000643132 248
177 3300009101 Ga0105247_10046923 Ga0105247_100469232 248
178 3300009148 Ga0105243_10184834 Ga0105243_101848342 248
179 3300014326 Ga0157380_10032268 Ga0157380_100322684 248
180 3300025918 Ga0207662_10135868 Ga0207662_101358682 248
181 3300026035 Ga0207703_10013696 Ga0207703_100136966 248
182 3300026075 Ga0207708_10009569 Ga0207708_100095696 248
183 3300026118 Ga0207675_100134266 Ga0207675_1001342661 248
184 3300027695 Ga0209966_1015158 Ga0209966_10151582 248
185 3300048928 Ga0496125_0001270 Ga0496125_0001270_6592_7347 248
186 3300048929 Ga0496126_0067446 Ga0496126_0067446_1992_2747 248
187 3300053077 Ga0495601_0020338 Ga0495601_0020338_692_1453 249
188 3300053096 Ga0500641_0009063 Ga0500641_0009063_2254_3015 249
189 3300005329 Ga0070683_100034275 Ga0070683_1000342752 250
190 3300005331 Ga0070670_100003186 Ga0070670_1000031865 250
191 3300005335 Ga0070666_10068047 Ga0070666_100680473 250
192 3300005338 Ga0068868_100000140 Ga0068868_10000014040 250
193 3300005340 Ga0070689_100173383 Ga0070689_1001733832 250
194 3300005343 Ga0070687_100041958 Ga0070687_1000419583 250
195 3300005344 Ga0070661_100004974 Ga0070661_1000049744 250
196 3300005355 Ga0070671_100034970 Ga0070671_1000349704 250
197 3300005364 Ga0070673_100024242 Ga0070673_1000242424 250
198 3300005367 Ga0070667_100004709 Ga0070667_1000047092 250
199 3300005439 Ga0070711_100020773 Ga0070711_1000207732 250
200 3300005535 Ga0070684_100014147 Ga0070684_1000141472 250
201 3300005544 Ga0070686_100009063 Ga0070686_1000090633 250
202 3300005548 Ga0070665_100033659 Ga0070665_1000336592 250
203 3300005563 Ga0068855_100926491 Ga0068855_1009264912 250
204 3300005564 Ga0070664_100001539 Ga0070664_1000015394 250
205 3300005615 Ga0070702_100001690 Ga0070702_1000016902 250
206 3300005617 Ga0068859_100017284 Ga0068859_1000172846 250
207 3300005618 Ga0068864_100004386 Ga0068864_1000043865 250
208 3300005834 Ga0068851_10054590 Ga0068851_100545902 250
209 3300005841 Ga0068863_100002124 Ga0068863_10000212410 250
210 3300005842 Ga0068858_100002757 Ga0068858_1000027576 250
211 3300005843 Ga0068860_100095951 Ga0068860_1000959511 250
212 3300006237 Ga0097621_100004963 Ga0097621_1000049636 250
213 3300006358 Ga0068871_100028282 Ga0068871_1000282823 250
214 3300006931 Ga0097620_100017284 Ga0097620_1000172846 250
215 3300009093 Ga0105240_10082841 Ga0105240_100828414 250
216 3300009098 Ga0105245_10002520 Ga0105245_100025203 250
217 3300009148 Ga0105243_10146388 Ga0105243_101463882 250
218 3300009174 Ga0105241_10304402 Ga0105241_103044021 250
219 3300009177 Ga0105248_10001120 Ga0105248_1000112023 250
220 3300009551 Ga0105238_10016040 Ga0105238_100160404 250
221 3300010375 Ga0105239_10019344 Ga0105239_100193443 250
222 3300011119 Ga0105246_10000898 Ga0105246_100008986 250
223 3300013296 Ga0157374_10001917 Ga0157374_100019174 250
224 3300013297 Ga0157378_10223181 Ga0157378_102231812 250
225 3300013306 Ga0163162_10001076 Ga0163162_100010767 250
226 3300013308 Ga0157375_10003406 Ga0157375_1000340611 250
227 3300014325 Ga0163163_10001397 Ga0163163_1000139724 250
228 3300014745 Ga0157377_10235991 Ga0157377_102359911 250
229 3300014968 Ga0157379_10031511 Ga0157379_100315114 250
230 3300021384 Ga0213876_10039611 Ga0213876_100396112 250
231 3300025321 Ga0207656_10021168 Ga0207656_100211682 250
232 3300025903 Ga0207680_10377378 Ga0207680_103773782 250
233 3300025916 Ga0207663_10246640 Ga0207663_102466402 250
234 3300025920 Ga0207649_10006436 Ga0207649_100064362 250
235 3300025924 Ga0207694_10407476 Ga0207694_104074762 250
236 3300025925 Ga0207650_10341884 Ga0207650_103418842 250
237 3300025927 Ga0207687_10008849 Ga0207687_100088494 250
238 3300025931 Ga0207644_10023911 Ga0207644_100239112 250
239 3300025933 Ga0207706_10670414 Ga0207706_106704141 250
240 3300025935 Ga0207709_10033274 Ga0207709_100332742 250
241 3300025941 Ga0207711_10022143 Ga0207711_100221435 250
242 3300025944 Ga0207661_10017644 Ga0207661_100176441 250
243 3300025960 Ga0207651_10014682 Ga0207651_100146824 250
244 3300025986 Ga0207658_10216783 Ga0207658_102167831 250
245 3300026035 Ga0207703_10006867 Ga0207703_100068674 250
246 3300026088 Ga0207641_10029991 Ga0207641_100299914 250
247 3300026095 Ga0207676_10036330 Ga0207676_100363302 250
248 3300028379 Ga0268266_10152780 Ga0268266_101527802 250
249 3300028381 Ga0268264_10526659 Ga0268264_105266591 250
250 3300030521 Ga0307511_10052571 Ga0307511_100525712 250
251 3300035088 Ga0373940_0106037 Ga0373940_0106037_27_779 250
252 3300035691 Ga0373931_0055200 Ga0373931_0055200_881_1633 250
253 3300039437 Ga0436365_0292777 Ga0436365_0292777_1801_2568 250
254 3300039450 Ga0436363_0892344 Ga0436363_0892344_16_783 250
255 3300048904 Ga0496101_0138305 Ga0496101_0138305_726_1493 250
256 3300048907 Ga0496104_0028763 Ga0496104_0028763_1977_2744 250
257 3300048909 Ga0496106_0376815 Ga0496106_0376815_302_1054 250
258 3300048912 Ga0496109_0010404 Ga0496109_0010404_4895_5647 250
259 3300048914 Ga0496111_0114092 Ga0496111_0114092_1032_1784 250
260 3300048917 Ga0496114_0002009 Ga0496114_0002009_5285_6052 250
261 3300048918 Ga0496115_0144617 Ga0496115_0144617_321_1088 250
262 3300053115 Ga0500591_112177 Ga0500591_112177_227_1000 250
263 3300053163 Ga0500639_113531 Ga0500639_113531_277_1050 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

4

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9715 3 171
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9524 1 171
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9415 1 171
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9387 3 171
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.8945 2 170
ID Description Score Start End Superfamily
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9715 3 171 3.30.420.10
af_B0G161_292_467_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9539 2 167 3.30.420.10
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9386 3 171 3.30.420.10
2p1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9128 4 144 3.30.420.10
af_Q2FWZ6_2_173_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9052 2 175 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A382PCW3-F1-model_v4 Exonuclease domain-containing protein 1.001 1 83 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A7X4JCP6-F1-model_v4 DNA polymerase III subunit epsilon (EC 2.7.7.7) 0.9968 7 156 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
GO:0046872
AF-E2XR20-F1-model_v4 deleted 0.994 1 88
AF-A0A6B2JL20-F1-model_v4 DNA polymerase III subunit epsilon 0.9935 1 73 GO:0003676
GO:0005829
GO:0008408
GO:0016779
GO:0045004
AF-A0A3C1SQ90-F1-model_v4 DNA polymerase III subunit epsilon 0.9924 2 93 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004

Feature Viewer

pLDDT pTM Quality
80.52 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map