F371892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 263 | 171 | 263 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10157164|Ga0157380_101571642 |
| Length | 238 |
| Sequence | VRQIVLDTETTGLEIADGHRVIEIGCIELVHRRPTGRDWHRYLKPGRDVDPGALAVHGITNEFLATQPEFAQVAAEFLAFIDGAELVIHNADFDVGFLDSELATAGIAPPIADRCRVLDTLALARRMHPGQRNNLDALCKRYNVDNSARDLHGALLDARILADVYLAMSGGQAALGLDAAPTAPGAAAAAGTVARGAVRIPVICASDAELAAHEASLDTIDRVSGGRTIFRAGTARGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 106 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 107 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 108 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 109 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 110 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 111 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 116 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 117 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 118 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 127 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 128 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 129 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 132 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 168 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 169 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 170 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 171 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.2 |
| Metatranscriptomes | 3.8 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0 |
| Rhizoplane | 6.46 |
| Rhizosphere | 84.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100034275 | 3300005329 | Bacteria | 4636 |
| 2 | Ga0070690_100016077 | 3300005330 | Bacteria | 4475 |
| 3 | Ga0070670_100003186 | 3300005331 | Bacteria | 13546 |
| 4 | Ga0070666_10047249 | 3300005335 | Bacteria | 2889 |
| 5 | Ga0070666_10068047 | 3300005335 | Bacteria | 2419 |
| 6 | Ga0070680_100044178 | 3300005336 | Bacteria | 3620 |
| 7 | Ga0068868_100000140 | 3300005338 | Bacteria | 46540 |
| 8 | Ga0070689_100004275 | 3300005340 | Bacteria | 9630 |
| 9 | Ga0070689_100173383 | 3300005340 | Bacteria | 1748 |
| 10 | Ga0070687_100041958 | 3300005343 | Bacteria | 2315 |
| 11 | Ga0070687_100113239 | 3300005343 | Bacteria | 1539 |
| 12 | Ga0070661_100004974 | 3300005344 | Bacteria | 9154 |
| 13 | Ga0070669_100173114 | 3300005353 | Bacteria | 1684 |
| 14 | Ga0070669_100324000 | 3300005353 | Bacteria | 1245 |
| 15 | Ga0070669_100623508 | 3300005353 | Bacteria | 905 |
| 16 | Ga0070671_100000102 | 3300005355 | Bacteria | 54494 |
| 17 | Ga0070671_100034970 | 3300005355 | Bacteria | 4161 |
| 18 | Ga0070673_100024242 | 3300005364 | Bacteria | 4446 |
| 19 | Ga0070667_100000545 | 3300005367 | Bacteria | 37543 |
| 20 | Ga0070667_100004709 | 3300005367 | Bacteria | 11441 |
| 21 | Ga0070701_10043674 | 3300005438 | Bacteria | 2294 |
| 22 | Ga0070711_100020773 | 3300005439 | Bacteria | 4237 |
| 23 | Ga0070711_100321171 | 3300005439 | Bacteria | 1237 |
| 24 | Ga0070705_100064235 | 3300005440 | Bacteria | 2192 |
| 25 | Ga0070700_100003343 | 3300005441 | Bacteria | 8270 |
| 26 | Ga0070663_100071637 | 3300005455 | Bacteria | 2522 |
| 27 | Ga0070678_100197424 | 3300005456 | Bacteria | 1658 |
| 28 | Ga0068867_100278768 | 3300005459 | Bacteria | 1370 |
| 29 | Ga0070685_10414406 | 3300005466 | Bacteria | 936 |
| 30 | Ga0070699_100508090 | 3300005518 | Bacteria | 1095 |
| 31 | Ga0070684_100014147 | 3300005535 | Bacteria | 6453 |
| 32 | Ga0068853_100134823 | 3300005539 | Bacteria | 2213 |
| 33 | Ga0070686_100007297 | 3300005544 | Bacteria | 6164 |
| 34 | Ga0070686_100009063 | 3300005544 | Bacteria | 5581 |
| 35 | Ga0070696_100297846 | 3300005546 | Bacteria | 1234 |
| 36 | Ga0070665_100033659 | 3300005548 | Bacteria | 5156 |
| 37 | Ga0070665_100317353 | 3300005548 | Bacteria | 1562 |
| 38 | Ga0070704_100003086 | 3300005549 | Bacteria | 9484 |
| 39 | Ga0068855_100926491 | 3300005563 | Bacteria | 919 |
| 40 | Ga0070664_100001539 | 3300005564 | Bacteria | 18430 |
| 41 | Ga0070664_100370113 | 3300005564 | Bacteria | 1306 |
| 42 | Ga0068856_100093613 | 3300005614 | Bacteria | 2991 |
| 43 | Ga0068856_100384401 | 3300005614 | Bacteria | 1423 |
| 44 | Ga0070702_100001690 | 3300005615 | Bacteria | 9157 |
| 45 | Ga0068852_100461647 | 3300005616 | Bacteria | 1259 |
| 46 | Ga0068859_100002762 | 3300005617 | Bacteria | 17790 |
| 47 | Ga0068859_100017284 | 3300005617 | Bacteria | 7243 |
| 48 | Ga0068859_100064316 | 3300005617 | Bacteria | 3701 |
| 49 | Ga0068859_100124230 | 3300005617 | Bacteria | 2649 |
| 50 | Ga0068859_100133878 | 3300005617 | Bacteria | 2550 |
| 51 | Ga0068864_100004386 | 3300005618 | Bacteria | 11586 |
| 52 | Ga0068864_100061342 | 3300005618 | Bacteria | 3257 |
| 53 | Ga0068861_100085073 | 3300005719 | Bacteria | 2483 |
| 54 | Ga0068861_100243265 | 3300005719 | Bacteria | 1531 |
| 55 | Ga0068851_10054590 | 3300005834 | Bacteria | 2035 |
| 56 | Ga0068863_100000238 | 3300005841 | Bacteria | 58572 |
| 57 | Ga0068863_100001120 | 3300005841 | Bacteria | 26763 |
| 58 | Ga0068863_100002124 | 3300005841 | Bacteria | 19659 |
| 59 | Ga0068858_100001102 | 3300005842 | Bacteria | 27941 |
| 60 | Ga0068858_100002757 | 3300005842 | Bacteria | 17656 |
| 61 | Ga0068858_100425606 | 3300005842 | Bacteria | 1277 |
| 62 | Ga0068860_100000270 | 3300005843 | Bacteria | 75836 |
| 63 | Ga0068860_100001877 | 3300005843 | Bacteria | 22327 |
| 64 | Ga0068860_100064026 | 3300005843 | Bacteria | 3493 |
| 65 | Ga0068860_100095951 | 3300005843 | Bacteria | 2826 |
| 66 | Ga0068862_100014465 | 3300005844 | Bacteria | 6548 |
| 67 | Ga0068862_100080627 | 3300005844 | Bacteria | 2822 |
| 68 | Ga0081455_10000663 | 3300005937 | Bacteria | 44594 |
| 69 | Ga0081539_10063481 | 3300005985 | Bacteria | 2015 |
| 70 | Ga0097621_100004963 | 3300006237 | Bacteria | 9327 |
| 71 | Ga0097621_100109508 | 3300006237 | Bacteria | 2333 |
| 72 | Ga0068871_100017580 | 3300006358 | Bacteria | 5415 |
| 73 | Ga0068871_100028282 | 3300006358 | Bacteria | 4394 |
| 74 | Ga0075428_100154298 | 3300006844 | Bacteria | 2495 |
| 75 | Ga0075428_100300552 | 3300006844 | Bacteria | 1725 |
| 76 | Ga0097620_100002762 | 3300006931 | Bacteria | 17790 |
| 77 | Ga0097620_100017284 | 3300006931 | Bacteria | 7243 |
| 78 | Ga0097620_100064313 | 3300006931 | Bacteria | 3701 |
| 79 | Ga0097620_100124228 | 3300006931 | Bacteria | 2649 |
| 80 | Ga0097620_100133884 | 3300006931 | Bacteria | 2550 |
| 81 | Ga0105240_10082841 | 3300009093 | Bacteria | 3939 |
| 82 | Ga0105240_10088735 | 3300009093 | Bacteria | 3783 |
| 83 | Ga0105240_10353054 | 3300009093 | Bacteria | 1668 |
| 84 | Ga0111539_10227169 | 3300009094 | Bacteria | 2174 |
| 85 | Ga0105245_10002520 | 3300009098 | Bacteria | 16517 |
| 86 | Ga0105247_10000126 | 3300009101 | Bacteria | 74123 |
| 87 | Ga0105247_10046923 | 3300009101 | Bacteria | 2652 |
| 88 | Ga0105243_10146388 | 3300009148 | Bacteria | 2021 |
| 89 | Ga0105243_10184834 | 3300009148 | Bacteria | 1815 |
| 90 | Ga0105241_10251524 | 3300009174 | Bacteria | 1498 |
| 91 | Ga0105241_10278830 | 3300009174 | Bacteria | 1427 |
| 92 | Ga0105241_10304402 | 3300009174 | Bacteria | 1369 |
| 93 | Ga0105248_10001120 | 3300009177 | Bacteria | 29831 |
| 94 | Ga0105237_10192334 | 3300009545 | Bacteria | 2040 |
| 95 | Ga0105237_10961811 | 3300009545 | Bacteria | 861 |
| 96 | Ga0105238_10016040 | 3300009551 | Bacteria | 7576 |
| 97 | Ga0105238_10126884 | 3300009551 | Bacteria | 2530 |
| 98 | Ga0105249_10044713 | 3300009553 | Bacteria | 4026 |
| 99 | Ga0105249_10421677 | 3300009553 | Bacteria | 1368 |
| 100 | Ga0105239_10019344 | 3300010375 | Bacteria | 7520 |
| 101 | Ga0105246_10000898 | 3300011119 | Bacteria | 17066 |
| 102 | Ga0157374_10001917 | 3300013296 | Bacteria | 17432 |
| 103 | Ga0157374_10691360 | 3300013296 | Bacteria | 1033 |
| 104 | Ga0157378_10223181 | 3300013297 | Bacteria | 1792 |
| 105 | Ga0163162_10001076 | 3300013306 | Bacteria | 25422 |
| 106 | Ga0163162_10054238 | 3300013306 | Bacteria | 4032 |
| 107 | Ga0157375_10003406 | 3300013308 | Bacteria | 13779 |
| 108 | Ga0163163_10001074 | 3300014325 | Bacteria | 23194 |
| 109 | Ga0163163_10001397 | 3300014325 | Bacteria | 20390 |
| 110 | Ga0163163_10025535 | 3300014325 | Bacteria | 5633 |
| 111 | Ga0163163_10703432 | 3300014325 | Bacteria | 1074 |
| 112 | Ga0157380_10032268 | 3300014326 | Bacteria | 4028 |
| 113 | Ga0157380_10049889 | 3300014326 | Bacteria | 3303 |
| 114 | Ga0157380_10157164 | 3300014326 | Bacteria | 1972 |
| 115 | Ga0157380_10175721 | 3300014326 | Bacteria | 1876 |
| 116 | Ga0157377_10235991 | 3300014745 | Bacteria | 1178 |
| 117 | Ga0157379_10001859 | 3300014968 | Bacteria | 17475 |
| 118 | Ga0157379_10031511 | 3300014968 | Bacteria | 4723 |
| 119 | Ga0157379_10033325 | 3300014968 | Bacteria | 4595 |
| 120 | Ga0157379_10242561 | 3300014968 | Bacteria | 1634 |
| 121 | Ga0213876_10039611 | 3300021384 | Bacteria | 2490 |
| 122 | Ga0207656_10021168 | 3300025321 | Bacteria | 2595 |
| 123 | Ga0207710_10001964 | 3300025900 | Bacteria | 9825 |
| 124 | Ga0207680_10078821 | 3300025903 | Bacteria | 2064 |
| 125 | Ga0207680_10103808 | 3300025903 | Bacteria | 1831 |
| 126 | Ga0207680_10377378 | 3300025903 | Bacteria | 999 |
| 127 | Ga0207647_10034952 | 3300025904 | Bacteria | 3205 |
| 128 | Ga0207695_10074787 | 3300025913 | Bacteria | 3448 |
| 129 | Ga0207695_10109501 | 3300025913 | Bacteria | 2744 |
| 130 | Ga0207663_10246640 | 3300025916 | Bacteria | 1312 |
| 131 | Ga0207662_10135868 | 3300025918 | Bacteria | 1554 |
| 132 | Ga0207649_10006436 | 3300025920 | Bacteria | 6379 |
| 133 | Ga0207694_10119045 | 3300025924 | Bacteria | 2107 |
| 134 | Ga0207694_10407476 | 3300025924 | Bacteria | 1131 |
| 135 | Ga0207650_10341884 | 3300025925 | Bacteria | 1229 |
| 136 | Ga0207659_10407230 | 3300025926 | Bacteria | 1139 |
| 137 | Ga0207687_10008849 | 3300025927 | Bacteria | 6581 |
| 138 | Ga0207644_10023911 | 3300025931 | Bacteria | 4190 |
| 139 | Ga0207706_10670414 | 3300025933 | Bacteria | 887 |
| 140 | Ga0207709_10033274 | 3300025935 | Bacteria | 3025 |
| 141 | Ga0207670_10045783 | 3300025936 | Bacteria | 2902 |
| 142 | Ga0207711_10022143 | 3300025941 | Bacteria | 5312 |
| 143 | Ga0207661_10017644 | 3300025944 | Bacteria | 5288 |
| 144 | Ga0207679_10377538 | 3300025945 | Bacteria | 1242 |
| 145 | Ga0207667_10485279 | 3300025949 | Bacteria | 1254 |
| 146 | Ga0207651_10014682 | 3300025960 | Bacteria | 4531 |
| 147 | Ga0207712_10034126 | 3300025961 | Bacteria | 3445 |
| 148 | Ga0207640_10412924 | 3300025981 | Bacteria | 1102 |
| 149 | Ga0207658_10003397 | 3300025986 | Bacteria | 11266 |
| 150 | Ga0207658_10216783 | 3300025986 | Bacteria | 1607 |
| 151 | Ga0207703_10000299 | 3300026035 | Bacteria | 54610 |
| 152 | Ga0207703_10006867 | 3300026035 | Bacteria | 9065 |
| 153 | Ga0207703_10013696 | 3300026035 | Bacteria | 6320 |
| 154 | Ga0207639_10036484 | 3300026041 | Bacteria | 3643 |
| 155 | Ga0207678_10040928 | 3300026067 | Bacteria | 4017 |
| 156 | Ga0207708_10009569 | 3300026075 | Bacteria | 7185 |
| 157 | Ga0207641_10000189 | 3300026088 | Bacteria | 86363 |
| 158 | Ga0207641_10000934 | 3300026088 | Bacteria | 30167 |
| 159 | Ga0207641_10029991 | 3300026088 | Bacteria | 4501 |
| 160 | Ga0207641_10398240 | 3300026088 | Bacteria | 1321 |
| 161 | Ga0207676_10036330 | 3300026095 | Bacteria | 3746 |
| 162 | Ga0207676_10346483 | 3300026095 | Bacteria | 1372 |
| 163 | Ga0207675_100009227 | 3300026118 | Bacteria | 9250 |
| 164 | Ga0207675_100134266 | 3300026118 | Bacteria | 2347 |
| 165 | Ga0209966_1015158 | 3300027695 | Bacteria | 1446 |
| 166 | Ga0268266_10011152 | 3300028379 | Bacteria | 7823 |
| 167 | Ga0268266_10152780 | 3300028379 | Bacteria | 2082 |
| 168 | Ga0268265_10003985 | 3300028380 | Bacteria | 10401 |
| 169 | Ga0268265_10196014 | 3300028380 | Bacteria | 1748 |
| 170 | Ga0268264_10000164 | 3300028381 | Bacteria | 147861 |
| 171 | Ga0268264_10006996 | 3300028381 | Bacteria | 9468 |
| 172 | Ga0268264_10526659 | 3300028381 | Bacteria | 1156 |
| 173 | Ga0307515_10143944 | 3300028794 | Bacteria | 2538 |
| 174 | Ga0307511_10000629 | 3300030521 | Bacteria | 37797 |
| 175 | Ga0307511_10052571 | 3300030521 | Bacteria | 3244 |
| 176 | Ga0307509_10005253 | 3300031507 | Bacteria | 18134 |
| 177 | Ga0307509_10021518 | 3300031507 | Bacteria | 7287 |
| 178 | Ga0307509_10206550 | 3300031507 | Bacteria | 1794 |
| 179 | Ga0307508_10189394 | 3300031616 | Bacteria | 1659 |
| 180 | Ga0316579_10001368 | 3300031691 | Bacteria | 8836 |
| 181 | Ga0316579_10178679 | 3300031691 | Bacteria | 1026 |
| 182 | Ga0316576_10047613 | 3300031727 | Bacteria | 3107 |
| 183 | Ga0316576_10057235 | 3300031727 | Bacteria | 2848 |
| 184 | Ga0316578_10000462 | 3300031728 | Bacteria | 13535 |
| 185 | Ga0316578_10000657 | 3300031728 | Bacteria | 12257 |
| 186 | Ga0316577_10016681 | 3300031733 | Bacteria | 4052 |
| 187 | Ga0316577_10146119 | 3300031733 | Bacteria | 1332 |
| 188 | Ga0307406_10438405 | 3300031901 | Bacteria | 1045 |
| 189 | Ga0307409_100680321 | 3300031995 | Unclassified | 1026 |
| 190 | Ga0307411_10299872 | 3300032005 | Bacteria | 1288 |
| 191 | Ga0316583_10003176 | 3300032133 | Bacteria | 5775 |
| 192 | Ga0316585_10000348 | 3300032137 | Bacteria | 10541 |
| 193 | Ga0316580_10003352 | 3300032139 | Bacteria | 4535 |
| 194 | Ga0316593_10016445 | 3300032168 | Bacteria | 2243 |
| 195 | Ga0316593_10019228 | 3300032168 | Bacteria | 2109 |
| 196 | Ga0316593_10061622 | 3300032168 | Bacteria | 1283 |
| 197 | Ga0307510_10017214 | 3300033180 | Bacteria | 8527 |
| 198 | Ga0316592_1008573 | 3300033524 | Bacteria | 2026 |
| 199 | Ga0316592_1019440 | 3300033524 | Bacteria | 1436 |
| 200 | Ga0316588_1008455 | 3300033528 | Bacteria | 2120 |
| 201 | Ga0316588_1009784 | 3300033528 | Bacteria | 2007 |
| 202 | Ga0316596_1003819 | 3300033541 | Bacteria | 3332 |
| 203 | Ga0316596_1007618 | 3300033541 | Bacteria | 2563 |
| 204 | Ga0316596_1039330 | 3300033541 | Bacteria | 1241 |
| 205 | Ga0373940_0106037 | 3300035088 | Bacteria | 858 |
| 206 | Ga0316574_0005283 | 3300035398 | Bacteria | 6878 |
| 207 | Ga0373931_0055200 | 3300035691 | Bacteria | 2125 |
| 208 | Ga0316582_0002776 | 3300036647 | Bacteria | 8338 |
| 209 | Ga0316582_0035707 | 3300036647 | Bacteria | 3072 |
| 210 | Ga0316582_0209194 | 3300036647 | Bacteria | 1332 |
| 211 | Ga0316584_0002544 | 3300036712 | Bacteria | 11577 |
| 212 | Ga0316584_0007919 | 3300036712 | Bacteria | 7292 |
| 213 | Ga0316584_0042450 | 3300036712 | Bacteria | 3391 |
| 214 | Ga0316581_0071630 | 3300037588 | Bacteria | 1065 |
| 215 | Ga0400483_035656 | 3300039062 | Bacteria | 8570 |
| 216 | Ga0400483_154665 | 3300039062 | Bacteria | 8820 |
| 217 | Ga0436365_0292777 | 3300039437 | Bacteria | 7278 |
| 218 | Ga0436363_0892344 | 3300039450 | Bacteria | 2268 |
| 219 | Ga0451791_0604978 | 3300041451 | Bacteria | 3533 |
| 220 | Ga0451791_1651729 | 3300041451 | Bacteria | 997 |
| 221 | Ga0451797_0713288 | 3300041453 | Bacteria | 1792 |
| 222 | Ga0451802_0420246 | 3300041460 | Bacteria | 2631 |
| 223 | Ga0451807_0472349 | 3300041486 | Bacteria | 1557 |
| 224 | Ga0451807_0605089 | 3300041486 | Bacteria | 4839 |
| 225 | Ga0451837_0846489 | 3300041494 | Bacteria | 1677 |
| 226 | Ga0466969_0029678 | 3300044656 | Bacteria | 2791 |
| 227 | Ga0466965_0315498 | 3300044683 | Bacteria | 851 |
| 228 | Ga0466961_0066548 | 3300044693 | Bacteria | 2288 |
| 229 | Ga0466971_0003446 | 3300044719 | Bacteria | 6755 |
| 230 | Ga0466957_0109908 | 3300044842 | Bacteria | 1747 |
| 231 | Ga0466958_0075327 | 3300045836 | Bacteria | 2070 |
| 232 | Ga0495590_0007379 | 3300046457 | Bacteria | 4244 |
| 233 | Ga0495638_0133389 | 3300046460 | Bacteria | 1457 |
| 234 | Ga0495686_0130036 | 3300047472 | Bacteria | 1494 |
| 235 | Ga0496101_0138305 | 3300048904 | Bacteria | 1855 |
| 236 | Ga0496102_0084657 | 3300048905 | Bacteria | 2927 |
| 237 | Ga0496104_0028763 | 3300048907 | Bacteria | 5151 |
| 238 | Ga0496106_0376815 | 3300048909 | Bacteria | 1140 |
| 239 | Ga0496108_0021311 | 3300048911 | Bacteria | 5327 |
| 240 | Ga0496109_0010404 | 3300048912 | Bacteria | 7946 |
| 241 | Ga0496111_0114092 | 3300048914 | Bacteria | 1992 |
| 242 | Ga0496114_0002009 | 3300048917 | Bacteria | 15468 |
| 243 | Ga0496114_0152068 | 3300048917 | Bacteria | 2008 |
| 244 | Ga0496114_0175294 | 3300048917 | Bacteria | 1871 |
| 245 | Ga0496115_0144617 | 3300048918 | Bacteria | 1962 |
| 246 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 247 | Ga0496121_0000126 | 3300048924 | Bacteria | 168873 |
| 248 | Ga0496125_0001270 | 3300048928 | Bacteria | 37575 |
| 249 | Ga0496125_0026797 | 3300048928 | Bacteria | 5237 |
| 250 | Ga0496126_0067446 | 3300048929 | Bacteria | 3197 |
| 251 | Ga0501034_0175537 | 3300049571 | Bacteria | 2109 |
| 252 | Ga0501072_0157411 | 3300049588 | Bacteria | 1812 |
| 253 | Ga0501073_0220197 | 3300049589 | Bacteria | 1311 |
| 254 | Ga0501045_0182242 | 3300049824 | Bacteria | 1565 |
| 255 | nmdc:mga09592_422996_c1 | 3300050508 | Bacteria | 1150 |
| 256 | nmdc:mga08y16_92846_c1 | 3300050511 | Bacteria | 3145 |
| 257 | nmdc:mga0a205_269454_c1 | 3300050515 | Bacteria | 1580 |
| 258 | Ga0495601_0020338 | 3300053077 | Bacteria | 4054 |
| 259 | Ga0500641_0009063 | 3300053096 | Bacteria | 3568 |
| 260 | Ga0500591_112177 | 3300053115 | Unclassified | 1140 |
| 261 | Ga0500639_113531 | 3300053163 | Bacteria | 1314 |
| 262 | Ga0500576_108267 | 3300053725 | Bacteria | 1119 |
| 263 | Ga0466962_0005292 | 3300061719 | Bacteria | 6202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005842 | Ga0068858_100425606 | Ga0068858_1004256062 | 210 |
| 2 | 3300005439 | Ga0070711_100321171 | Ga0070711_1003211711 | 215 |
| 3 | 3300032168 | Ga0316593_10016445 | Ga0316593_100164451 | 215 |
| 4 | 3300033180 | Ga0307510_10017214 | Ga0307510_100172146 | 225 |
| 5 | 3300033541 | Ga0316596_1003819 | Ga0316596_10038193 | 228 |
| 6 | 3300048919 | Ga0496116_0000005 | Ga0496116_0000005_272193_272891 | 229 |
| 7 | 3300048924 | Ga0496121_0000126 | Ga0496121_0000126_51410_52108 | 229 |
| 8 | 3300044656 | Ga0466969_0029678 | Ga0466969_0029678_1514_2266 | 231 |
| 9 | 3300044693 | Ga0466961_0066548 | Ga0466961_0066548_1038_1790 | 231 |
| 10 | 3300044719 | Ga0466971_0003446 | Ga0466971_0003446_2642_3394 | 231 |
| 11 | 3300044842 | Ga0466957_0109908 | Ga0466957_0109908_813_1565 | 231 |
| 12 | 3300045836 | Ga0466958_0075327 | Ga0466958_0075327_892_1644 | 231 |
| 13 | 3300061719 | Ga0466962_0005292 | Ga0466962_0005292_4923_5675 | 231 |
| 14 | 3300028794 | Ga0307515_10143944 | Ga0307515_101439442 | 232 |
| 15 | 3300036647 | Ga0316582_0035707 | Ga0316582_0035707_1018_1722 | 232 |
| 16 | 3300036647 | Ga0316582_0209194 | Ga0316582_0209194_35_739 | 232 |
| 17 | 3300044683 | Ga0466965_0315498 | Ga0466965_0315498_34_786 | 232 |
| 18 | 3300046457 | Ga0495590_0007379 | Ga0495590_0007379_999_1709 | 234 |
| 19 | 3300046460 | Ga0495638_0133389 | Ga0495638_0133389_388_1098 | 234 |
| 20 | 3300005335 | Ga0070666_10047249 | Ga0070666_100472492 | 235 |
| 21 | 3300005539 | Ga0068853_100134823 | Ga0068853_1001348232 | 235 |
| 22 | 3300005564 | Ga0070664_100370113 | Ga0070664_1003701132 | 235 |
| 23 | 3300005614 | Ga0068856_100093613 | Ga0068856_1000936131 | 235 |
| 24 | 3300005617 | Ga0068859_100124230 | Ga0068859_1001242302 | 235 |
| 25 | 3300005841 | Ga0068863_100000238 | Ga0068863_10000023838 | 235 |
| 26 | 3300005843 | Ga0068860_100000270 | Ga0068860_10000027016 | 235 |
| 27 | 3300006931 | Ga0097620_100124228 | Ga0097620_1001242282 | 235 |
| 28 | 3300009174 | Ga0105241_10251524 | Ga0105241_102515242 | 235 |
| 29 | 3300009545 | Ga0105237_10192334 | Ga0105237_101923342 | 235 |
| 30 | 3300009551 | Ga0105238_10126884 | Ga0105238_101268842 | 235 |
| 31 | 3300009553 | Ga0105249_10421677 | Ga0105249_104216772 | 235 |
| 32 | 3300013296 | Ga0157374_10691360 | Ga0157374_106913602 | 235 |
| 33 | 3300013306 | Ga0163162_10054238 | Ga0163162_100542383 | 235 |
| 34 | 3300014325 | Ga0163163_10025535 | Ga0163163_100255351 | 235 |
| 35 | 3300014325 | Ga0163163_10703432 | Ga0163163_107034322 | 235 |
| 36 | 3300014326 | Ga0157380_10157164 | Ga0157380_101571642 | 235 |
| 37 | 3300014968 | Ga0157379_10033325 | Ga0157379_100333252 | 235 |
| 38 | 3300025903 | Ga0207680_10078821 | Ga0207680_100788212 | 235 |
| 39 | 3300025903 | Ga0207680_10103808 | Ga0207680_101038081 | 235 |
| 40 | 3300025904 | Ga0207647_10034952 | Ga0207647_100349523 | 235 |
| 41 | 3300025913 | Ga0207695_10074787 | Ga0207695_100747873 | 235 |
| 42 | 3300025924 | Ga0207694_10119045 | Ga0207694_101190452 | 235 |
| 43 | 3300025945 | Ga0207679_10377538 | Ga0207679_103775382 | 235 |
| 44 | 3300025949 | Ga0207667_10485279 | Ga0207667_104852792 | 235 |
| 45 | 3300025981 | Ga0207640_10412924 | Ga0207640_104129241 | 235 |
| 46 | 3300026041 | Ga0207639_10036484 | Ga0207639_100364842 | 235 |
| 47 | 3300026067 | Ga0207678_10040928 | Ga0207678_100409283 | 235 |
| 48 | 3300026088 | Ga0207641_10000189 | Ga0207641_1000018945 | 235 |
| 49 | 3300028381 | Ga0268264_10000164 | Ga0268264_10000164105 | 235 |
| 50 | 3300039062 | Ga0400483_035656 | Ga0400483_035656_6208_6924 | 235 |
| 51 | 3300039062 | Ga0400483_154665 | Ga0400483_154665_2979_3695 | 235 |
| 52 | 3300047472 | Ga0495686_0130036 | Ga0495686_0130036_510_1223 | 235 |
| 53 | 3300053725 | Ga0500576_108267 | Ga0500576_108267_363_1076 | 235 |
| 54 | 3300005353 | Ga0070669_100173114 | Ga0070669_1001731142 | 236 |
| 55 | 3300005353 | Ga0070669_100623508 | Ga0070669_1006235081 | 236 |
| 56 | 3300006844 | Ga0075428_100154298 | Ga0075428_1001542983 | 236 |
| 57 | 3300005518 | Ga0070699_100508090 | Ga0070699_1005080901 | 237 |
| 58 | 3300009174 | Ga0105241_10278830 | Ga0105241_102788302 | 237 |
| 59 | 3300031901 | Ga0307406_10438405 | Ga0307406_104384051 | 237 |
| 60 | 3300005985 | Ga0081539_10063481 | Ga0081539_100634813 | 239 |
| 61 | 3300041451 | Ga0451791_0604978 | Ga0451791_0604978_1977_2699 | 239 |
| 62 | 3300041453 | Ga0451797_0713288 | Ga0451797_0713288_166_888 | 239 |
| 63 | 3300041460 | Ga0451802_0420246 | Ga0451802_0420246_1298_2020 | 239 |
| 64 | 3300041486 | Ga0451807_0605089 | Ga0451807_0605089_2845_3567 | 239 |
| 65 | 3300041494 | Ga0451837_0846489 | Ga0451837_0846489_502_1224 | 239 |
| 66 | 3300031691 | Ga0316579_10178679 | Ga0316579_101786791 | 240 |
| 67 | 3300031727 | Ga0316576_10057235 | Ga0316576_100572352 | 240 |
| 68 | 3300031728 | Ga0316578_10000657 | Ga0316578_100006573 | 240 |
| 69 | 3300032139 | Ga0316580_10003352 | Ga0316580_100033522 | 240 |
| 70 | 3300032168 | Ga0316593_10061622 | Ga0316593_100616222 | 240 |
| 71 | 3300033524 | Ga0316592_1019440 | Ga0316592_10194401 | 240 |
| 72 | 3300033528 | Ga0316588_1008455 | Ga0316588_10084551 | 240 |
| 73 | 3300036712 | Ga0316584_0002544 | Ga0316584_0002544_3166_3903 | 240 |
| 74 | 3300041486 | Ga0451807_0472349 | Ga0451807_0472349_784_1512 | 241 |
| 75 | 3300006237 | Ga0097621_100109508 | Ga0097621_1001095083 | 242 |
| 76 | 3300006358 | Ga0068871_100017580 | Ga0068871_1000175803 | 242 |
| 77 | 3300031691 | Ga0316579_10001368 | Ga0316579_100013681 | 242 |
| 78 | 3300031728 | Ga0316578_10000462 | Ga0316578_1000046210 | 242 |
| 79 | 3300031733 | Ga0316577_10016681 | Ga0316577_100166812 | 242 |
| 80 | 3300032133 | Ga0316583_10003176 | Ga0316583_100031762 | 242 |
| 81 | 3300032137 | Ga0316585_10000348 | Ga0316585_100003484 | 242 |
| 82 | 3300032168 | Ga0316593_10019228 | Ga0316593_100192282 | 242 |
| 83 | 3300033524 | Ga0316592_1008573 | Ga0316592_10085731 | 242 |
| 84 | 3300033528 | Ga0316588_1009784 | Ga0316588_10097842 | 242 |
| 85 | 3300033541 | Ga0316596_1039330 | Ga0316596_10393301 | 242 |
| 86 | 3300035398 | Ga0316574_0005283 | Ga0316574_0005283_2676_3413 | 242 |
| 87 | 3300036647 | Ga0316582_0002776 | Ga0316582_0002776_1908_2645 | 242 |
| 88 | 3300036712 | Ga0316584_0042450 | Ga0316584_0042450_1204_1941 | 242 |
| 89 | 3300037588 | Ga0316581_0071630 | Ga0316581_0071630_241_978 | 242 |
| 90 | 3300041451 | Ga0451791_1651729 | Ga0451791_1651729_199_939 | 242 |
| 91 | 3300048917 | Ga0496114_0152068 | Ga0496114_0152068_505_1248 | 242 |
| 92 | 3300005330 | Ga0070690_100016077 | Ga0070690_1000160774 | 243 |
| 93 | 3300005340 | Ga0070689_100004275 | Ga0070689_1000042758 | 243 |
| 94 | 3300005438 | Ga0070701_10043674 | Ga0070701_100436742 | 243 |
| 95 | 3300005440 | Ga0070705_100064235 | Ga0070705_1000642352 | 243 |
| 96 | 3300005459 | Ga0068867_100278768 | Ga0068867_1002787682 | 243 |
| 97 | 3300005544 | Ga0070686_100007297 | Ga0070686_1000072974 | 243 |
| 98 | 3300005546 | Ga0070696_100297846 | Ga0070696_1002978461 | 243 |
| 99 | 3300005617 | Ga0068859_100133878 | Ga0068859_1001338782 | 243 |
| 100 | 3300005618 | Ga0068864_100061342 | Ga0068864_1000613423 | 243 |
| 101 | 3300005719 | Ga0068861_100085073 | Ga0068861_1000850732 | 243 |
| 102 | 3300005843 | Ga0068860_100064026 | Ga0068860_1000640262 | 243 |
| 103 | 3300005844 | Ga0068862_100080627 | Ga0068862_1000806273 | 243 |
| 104 | 3300005937 | Ga0081455_10000663 | Ga0081455_1000066313 | 243 |
| 105 | 3300006931 | Ga0097620_100133884 | Ga0097620_1001338844 | 243 |
| 106 | 3300014326 | Ga0157380_10175721 | Ga0157380_101757212 | 243 |
| 107 | 3300025936 | Ga0207670_10045783 | Ga0207670_100457833 | 243 |
| 108 | 3300026088 | Ga0207641_10398240 | Ga0207641_103982401 | 243 |
| 109 | 3300026095 | Ga0207676_10346483 | Ga0207676_103464832 | 243 |
| 110 | 3300026118 | Ga0207675_100009227 | Ga0207675_1000092278 | 243 |
| 111 | 3300028380 | Ga0268265_10196014 | Ga0268265_101960142 | 243 |
| 112 | 3300031507 | Ga0307509_10021518 | Ga0307509_100215185 | 243 |
| 113 | 3300031507 | Ga0307509_10206550 | Ga0307509_102065503 | 243 |
| 114 | 3300031727 | Ga0316576_10047613 | Ga0316576_100476131 | 243 |
| 115 | 3300049571 | Ga0501034_0175537 | Ga0501034_0175537_770_1510 | 243 |
| 116 | 3300005616 | Ga0068852_100461647 | Ga0068852_1004616471 | 244 |
| 117 | 3300048917 | Ga0496114_0175294 | Ga0496114_0175294_63_812 | 244 |
| 118 | 3300005614 | Ga0068856_100384401 | Ga0068856_1003844012 | 245 |
| 119 | 3300014326 | Ga0157380_10049889 | Ga0157380_100498893 | 245 |
| 120 | 3300014968 | Ga0157379_10242561 | Ga0157379_102425611 | 245 |
| 121 | 3300031733 | Ga0316577_10146119 | Ga0316577_101461192 | 245 |
| 122 | 3300033541 | Ga0316596_1007618 | Ga0316596_10076182 | 245 |
| 123 | 3300036712 | Ga0316584_0007919 | Ga0316584_0007919_5380_6126 | 245 |
| 124 | 3300049588 | Ga0501072_0157411 | Ga0501072_0157411_440_1180 | 245 |
| 125 | 3300049824 | Ga0501045_0182242 | Ga0501045_0182242_655_1395 | 245 |
| 126 | 3300050515 | nmdc:mga0a205_269454_c1 | nmdc:mga0a205_269454_c1_722_1471 | 245 |
| 127 | 3300005456 | Ga0070678_100197424 | Ga0070678_1001974242 | 246 |
| 128 | 3300005466 | Ga0070685_10414406 | Ga0070685_104144061 | 246 |
| 129 | 3300009094 | Ga0111539_10227169 | Ga0111539_102271693 | 246 |
| 130 | 3300025926 | Ga0207659_10407230 | Ga0207659_104072301 | 246 |
| 131 | 3300031995 | Ga0307409_100680321 | Ga0307409_1006803211 | 246 |
| 132 | 3300032005 | Ga0307411_10299872 | Ga0307411_102998721 | 246 |
| 133 | 3300005336 | Ga0070680_100044178 | Ga0070680_1000441784 | 247 |
| 134 | 3300005355 | Ga0070671_100000102 | Ga0070671_10000010214 | 247 |
| 135 | 3300005367 | Ga0070667_100000545 | Ga0070667_10000054528 | 247 |
| 136 | 3300005455 | Ga0070663_100071637 | Ga0070663_1000716372 | 247 |
| 137 | 3300005548 | Ga0070665_100317353 | Ga0070665_1003173532 | 247 |
| 138 | 3300005617 | Ga0068859_100002762 | Ga0068859_1000027628 | 247 |
| 139 | 3300005841 | Ga0068863_100001120 | Ga0068863_10000112015 | 247 |
| 140 | 3300005842 | Ga0068858_100001102 | Ga0068858_10000110215 | 247 |
| 141 | 3300005843 | Ga0068860_100001877 | Ga0068860_1000018773 | 247 |
| 142 | 3300005844 | Ga0068862_100014465 | Ga0068862_1000144653 | 247 |
| 143 | 3300006844 | Ga0075428_100300552 | Ga0075428_1003005522 | 247 |
| 144 | 3300006931 | Ga0097620_100002762 | Ga0097620_1000027628 | 247 |
| 145 | 3300009093 | Ga0105240_10088735 | Ga0105240_100887352 | 247 |
| 146 | 3300009093 | Ga0105240_10353054 | Ga0105240_103530542 | 247 |
| 147 | 3300009101 | Ga0105247_10000126 | Ga0105247_1000012611 | 247 |
| 148 | 3300009545 | Ga0105237_10961811 | Ga0105237_109618111 | 247 |
| 149 | 3300009553 | Ga0105249_10044713 | Ga0105249_100447133 | 247 |
| 150 | 3300014325 | Ga0163163_10001074 | Ga0163163_1000107417 | 247 |
| 151 | 3300014968 | Ga0157379_10001859 | Ga0157379_100018594 | 247 |
| 152 | 3300025900 | Ga0207710_10001964 | Ga0207710_100019643 | 247 |
| 153 | 3300025913 | Ga0207695_10109501 | Ga0207695_101095013 | 247 |
| 154 | 3300025961 | Ga0207712_10034126 | Ga0207712_100341263 | 247 |
| 155 | 3300025986 | Ga0207658_10003397 | Ga0207658_100033976 | 247 |
| 156 | 3300026035 | Ga0207703_10000299 | Ga0207703_1000029913 | 247 |
| 157 | 3300026088 | Ga0207641_10000934 | Ga0207641_100009347 | 247 |
| 158 | 3300028379 | Ga0268266_10011152 | Ga0268266_100111526 | 247 |
| 159 | 3300028380 | Ga0268265_10003985 | Ga0268265_100039853 | 247 |
| 160 | 3300028381 | Ga0268264_10006996 | Ga0268264_100069963 | 247 |
| 161 | 3300030521 | Ga0307511_10000629 | Ga0307511_1000062931 | 247 |
| 162 | 3300031507 | Ga0307509_10005253 | Ga0307509_100052538 | 247 |
| 163 | 3300031616 | Ga0307508_10189394 | Ga0307508_101893942 | 247 |
| 164 | 3300048905 | Ga0496102_0084657 | Ga0496102_0084657_1742_2494 | 247 |
| 165 | 3300048911 | Ga0496108_0021311 | Ga0496108_0021311_3621_4373 | 247 |
| 166 | 3300048928 | Ga0496125_0026797 | Ga0496125_0026797_245_997 | 247 |
| 167 | 3300049589 | Ga0501073_0220197 | Ga0501073_0220197_28_783 | 247 |
| 168 | 3300050508 | nmdc:mga09592_422996_c1 | nmdc:mga09592_422996_c1_298_1044 | 247 |
| 169 | 3300050511 | nmdc:mga08y16_92846_c1 | nmdc:mga08y16_92846_c1_150_896 | 247 |
| 170 | 3300005343 | Ga0070687_100113239 | Ga0070687_1001132392 | 248 |
| 171 | 3300005353 | Ga0070669_100324000 | Ga0070669_1003240002 | 248 |
| 172 | 3300005441 | Ga0070700_100003343 | Ga0070700_1000033435 | 248 |
| 173 | 3300005549 | Ga0070704_100003086 | Ga0070704_1000030866 | 248 |
| 174 | 3300005617 | Ga0068859_100064316 | Ga0068859_1000643162 | 248 |
| 175 | 3300005719 | Ga0068861_100243265 | Ga0068861_1002432653 | 248 |
| 176 | 3300006931 | Ga0097620_100064313 | Ga0097620_1000643132 | 248 |
| 177 | 3300009101 | Ga0105247_10046923 | Ga0105247_100469232 | 248 |
| 178 | 3300009148 | Ga0105243_10184834 | Ga0105243_101848342 | 248 |
| 179 | 3300014326 | Ga0157380_10032268 | Ga0157380_100322684 | 248 |
| 180 | 3300025918 | Ga0207662_10135868 | Ga0207662_101358682 | 248 |
| 181 | 3300026035 | Ga0207703_10013696 | Ga0207703_100136966 | 248 |
| 182 | 3300026075 | Ga0207708_10009569 | Ga0207708_100095696 | 248 |
| 183 | 3300026118 | Ga0207675_100134266 | Ga0207675_1001342661 | 248 |
| 184 | 3300027695 | Ga0209966_1015158 | Ga0209966_10151582 | 248 |
| 185 | 3300048928 | Ga0496125_0001270 | Ga0496125_0001270_6592_7347 | 248 |
| 186 | 3300048929 | Ga0496126_0067446 | Ga0496126_0067446_1992_2747 | 248 |
| 187 | 3300053077 | Ga0495601_0020338 | Ga0495601_0020338_692_1453 | 249 |
| 188 | 3300053096 | Ga0500641_0009063 | Ga0500641_0009063_2254_3015 | 249 |
| 189 | 3300005329 | Ga0070683_100034275 | Ga0070683_1000342752 | 250 |
| 190 | 3300005331 | Ga0070670_100003186 | Ga0070670_1000031865 | 250 |
| 191 | 3300005335 | Ga0070666_10068047 | Ga0070666_100680473 | 250 |
| 192 | 3300005338 | Ga0068868_100000140 | Ga0068868_10000014040 | 250 |
| 193 | 3300005340 | Ga0070689_100173383 | Ga0070689_1001733832 | 250 |
| 194 | 3300005343 | Ga0070687_100041958 | Ga0070687_1000419583 | 250 |
| 195 | 3300005344 | Ga0070661_100004974 | Ga0070661_1000049744 | 250 |
| 196 | 3300005355 | Ga0070671_100034970 | Ga0070671_1000349704 | 250 |
| 197 | 3300005364 | Ga0070673_100024242 | Ga0070673_1000242424 | 250 |
| 198 | 3300005367 | Ga0070667_100004709 | Ga0070667_1000047092 | 250 |
| 199 | 3300005439 | Ga0070711_100020773 | Ga0070711_1000207732 | 250 |
| 200 | 3300005535 | Ga0070684_100014147 | Ga0070684_1000141472 | 250 |
| 201 | 3300005544 | Ga0070686_100009063 | Ga0070686_1000090633 | 250 |
| 202 | 3300005548 | Ga0070665_100033659 | Ga0070665_1000336592 | 250 |
| 203 | 3300005563 | Ga0068855_100926491 | Ga0068855_1009264912 | 250 |
| 204 | 3300005564 | Ga0070664_100001539 | Ga0070664_1000015394 | 250 |
| 205 | 3300005615 | Ga0070702_100001690 | Ga0070702_1000016902 | 250 |
| 206 | 3300005617 | Ga0068859_100017284 | Ga0068859_1000172846 | 250 |
| 207 | 3300005618 | Ga0068864_100004386 | Ga0068864_1000043865 | 250 |
| 208 | 3300005834 | Ga0068851_10054590 | Ga0068851_100545902 | 250 |
| 209 | 3300005841 | Ga0068863_100002124 | Ga0068863_10000212410 | 250 |
| 210 | 3300005842 | Ga0068858_100002757 | Ga0068858_1000027576 | 250 |
| 211 | 3300005843 | Ga0068860_100095951 | Ga0068860_1000959511 | 250 |
| 212 | 3300006237 | Ga0097621_100004963 | Ga0097621_1000049636 | 250 |
| 213 | 3300006358 | Ga0068871_100028282 | Ga0068871_1000282823 | 250 |
| 214 | 3300006931 | Ga0097620_100017284 | Ga0097620_1000172846 | 250 |
| 215 | 3300009093 | Ga0105240_10082841 | Ga0105240_100828414 | 250 |
| 216 | 3300009098 | Ga0105245_10002520 | Ga0105245_100025203 | 250 |
| 217 | 3300009148 | Ga0105243_10146388 | Ga0105243_101463882 | 250 |
| 218 | 3300009174 | Ga0105241_10304402 | Ga0105241_103044021 | 250 |
| 219 | 3300009177 | Ga0105248_10001120 | Ga0105248_1000112023 | 250 |
| 220 | 3300009551 | Ga0105238_10016040 | Ga0105238_100160404 | 250 |
| 221 | 3300010375 | Ga0105239_10019344 | Ga0105239_100193443 | 250 |
| 222 | 3300011119 | Ga0105246_10000898 | Ga0105246_100008986 | 250 |
| 223 | 3300013296 | Ga0157374_10001917 | Ga0157374_100019174 | 250 |
| 224 | 3300013297 | Ga0157378_10223181 | Ga0157378_102231812 | 250 |
| 225 | 3300013306 | Ga0163162_10001076 | Ga0163162_100010767 | 250 |
| 226 | 3300013308 | Ga0157375_10003406 | Ga0157375_1000340611 | 250 |
| 227 | 3300014325 | Ga0163163_10001397 | Ga0163163_1000139724 | 250 |
| 228 | 3300014745 | Ga0157377_10235991 | Ga0157377_102359911 | 250 |
| 229 | 3300014968 | Ga0157379_10031511 | Ga0157379_100315114 | 250 |
| 230 | 3300021384 | Ga0213876_10039611 | Ga0213876_100396112 | 250 |
| 231 | 3300025321 | Ga0207656_10021168 | Ga0207656_100211682 | 250 |
| 232 | 3300025903 | Ga0207680_10377378 | Ga0207680_103773782 | 250 |
| 233 | 3300025916 | Ga0207663_10246640 | Ga0207663_102466402 | 250 |
| 234 | 3300025920 | Ga0207649_10006436 | Ga0207649_100064362 | 250 |
| 235 | 3300025924 | Ga0207694_10407476 | Ga0207694_104074762 | 250 |
| 236 | 3300025925 | Ga0207650_10341884 | Ga0207650_103418842 | 250 |
| 237 | 3300025927 | Ga0207687_10008849 | Ga0207687_100088494 | 250 |
| 238 | 3300025931 | Ga0207644_10023911 | Ga0207644_100239112 | 250 |
| 239 | 3300025933 | Ga0207706_10670414 | Ga0207706_106704141 | 250 |
| 240 | 3300025935 | Ga0207709_10033274 | Ga0207709_100332742 | 250 |
| 241 | 3300025941 | Ga0207711_10022143 | Ga0207711_100221435 | 250 |
| 242 | 3300025944 | Ga0207661_10017644 | Ga0207661_100176441 | 250 |
| 243 | 3300025960 | Ga0207651_10014682 | Ga0207651_100146824 | 250 |
| 244 | 3300025986 | Ga0207658_10216783 | Ga0207658_102167831 | 250 |
| 245 | 3300026035 | Ga0207703_10006867 | Ga0207703_100068674 | 250 |
| 246 | 3300026088 | Ga0207641_10029991 | Ga0207641_100299914 | 250 |
| 247 | 3300026095 | Ga0207676_10036330 | Ga0207676_100363302 | 250 |
| 248 | 3300028379 | Ga0268266_10152780 | Ga0268266_101527802 | 250 |
| 249 | 3300028381 | Ga0268264_10526659 | Ga0268264_105266591 | 250 |
| 250 | 3300030521 | Ga0307511_10052571 | Ga0307511_100525712 | 250 |
| 251 | 3300035088 | Ga0373940_0106037 | Ga0373940_0106037_27_779 | 250 |
| 252 | 3300035691 | Ga0373931_0055200 | Ga0373931_0055200_881_1633 | 250 |
| 253 | 3300039437 | Ga0436365_0292777 | Ga0436365_0292777_1801_2568 | 250 |
| 254 | 3300039450 | Ga0436363_0892344 | Ga0436363_0892344_16_783 | 250 |
| 255 | 3300048904 | Ga0496101_0138305 | Ga0496101_0138305_726_1493 | 250 |
| 256 | 3300048907 | Ga0496104_0028763 | Ga0496104_0028763_1977_2744 | 250 |
| 257 | 3300048909 | Ga0496106_0376815 | Ga0496106_0376815_302_1054 | 250 |
| 258 | 3300048912 | Ga0496109_0010404 | Ga0496109_0010404_4895_5647 | 250 |
| 259 | 3300048914 | Ga0496111_0114092 | Ga0496111_0114092_1032_1784 | 250 |
| 260 | 3300048917 | Ga0496114_0002009 | Ga0496114_0002009_5285_6052 | 250 |
| 261 | 3300048918 | Ga0496115_0144617 | Ga0496115_0144617_321_1088 | 250 |
| 262 | 3300053115 | Ga0500591_112177 | Ga0500591_112177_227_1000 | 250 |
| 263 | 3300053163 | Ga0500639_113531 | Ga0500639_113531_277_1050 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j53-assembly1.cif.gz_A | structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 | 0.9715 | 3 | 171 |
| 2ido-assembly1.cif.gz_A | structure of the e. coli pol iii epsilon-hot proofreading complex | 0.9524 | 1 | 171 |
| 2ido-assembly1.cif.gz_A | structure of the e. coli pol iii epsilon-hot proofreading complex | 0.9415 | 1 | 171 |
| 1j53-assembly1.cif.gz_A | structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 | 0.9387 | 3 | 171 |
| 8h2f-assembly1.cif.gz_A | crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 | 0.8945 | 2 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j54A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9715 | 3 | 171 | 3.30.420.10 |
| af_B0G161_292_467_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9539 | 2 | 167 | 3.30.420.10 |
| 1j54A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9386 | 3 | 171 | 3.30.420.10 |
| 2p1jB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9128 | 4 | 144 | 3.30.420.10 |
| af_Q2FWZ6_2_173_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9052 | 2 | 175 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382PCW3-F1-model_v4 | Exonuclease domain-containing protein | 1.001 | 1 | 83 |
GO:0003677
GO:0003887 GO:0005829 GO:0008408 GO:0045004 |
| AF-A0A7X4JCP6-F1-model_v4 | DNA polymerase III subunit epsilon (EC 2.7.7.7) | 0.9968 | 7 | 156 |
GO:0003677
GO:0003887 GO:0005829 GO:0008408 GO:0045004 GO:0046872 |
| AF-E2XR20-F1-model_v4 | deleted | 0.994 | 1 | 88 |
|
| AF-A0A6B2JL20-F1-model_v4 | DNA polymerase III subunit epsilon | 0.9935 | 1 | 73 |
GO:0003676
GO:0005829 GO:0008408 GO:0016779 GO:0045004 |
| AF-A0A3C1SQ90-F1-model_v4 | DNA polymerase III subunit epsilon | 0.9924 | 2 | 93 |
GO:0003677
GO:0003887 GO:0005829 GO:0008408 GO:0045004 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar