F371770

General Info

Members Datasets Scaffolds Average Seq Length
263 157 526 111

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100030519|Ga0075428_1000305197
Length 119
Sequence VRLAAIAVVAGVALMSAAPAVATAKPKGKTIRIYDNYFVPDAVKVKSGATVTWKWPGFDEASGDVHDVKLKSGPKGVKKFHSEAASTDYSFKRKLKVAGKYKIVCTLHEEMRMTIRVRR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 1.9
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 14.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100030519 3300006844 Bacteria 5960
2 JGI25406J46586_10002135 3300003203 Bacteria 9347
3 JGI25407J50210_10008074 3300003373 Bacteria 2648
4 Ga0070658_10144881 3300005327 Bacteria 1986
5 Ga0070658_11503893 3300005327 Bacteria 584
6 Ga0070676_10821614 3300005328 Bacteria 687
7 Ga0070683_100241003 3300005329 Bacteria 1720
8 Ga0070683_100824196 3300005329 Bacteria 890
9 Ga0070683_101149779 3300005329 Bacteria 746
10 Ga0070683_101902347 3300005329 Unclassified 572
11 Ga0070670_101432996 3300005331 Bacteria 634
12 Ga0070670_101678599 3300005331 Bacteria 584
13 Ga0070677_10765151 3300005333 Bacteria 549
14 Ga0068869_100330291 3300005334 Bacteria 1239
15 Ga0070682_101752792 3300005337 Bacteria 541
16 Ga0068868_100130665 3300005338 Bacteria 2055
17 Ga0068868_101402280 3300005338 Unclassified 652
18 Ga0070661_100329475 3300005344 Bacteria 1194
19 Ga0070661_101007429 3300005344 Bacteria 691
20 Ga0070692_10073471 3300005345 Bacteria 1827
21 Ga0070692_10632640 3300005345 Bacteria 712
22 Ga0070692_10847620 3300005345 Bacteria 628
23 Ga0070675_100140528 3300005354 Bacteria 2064
24 Ga0070671_100657364 3300005355 Bacteria 908
25 Ga0070674_100700479 3300005356 Unclassified 866
26 Ga0070659_100110947 3300005366 Bacteria 2214
27 Ga0070659_100254952 3300005366 Bacteria 1455
28 Ga0070667_102361951 3300005367 Unclassified 501
29 Ga0070701_10609750 3300005438 Unclassified 724
30 Ga0070700_100097526 3300005441 Bacteria 1930
31 Ga0070700_100293323 3300005441 Bacteria 1184
32 Ga0070700_100364996 3300005441 Bacteria 1075
33 Ga0070663_100760749 3300005455 Bacteria 828
34 Ga0070663_101109943 3300005455 Unclassified 692
35 Ga0070678_100216424 3300005456 Bacteria 1590
36 Ga0070678_100619424 3300005456 Bacteria 968
37 Ga0068867_100141551 3300005459 Bacteria 1880
38 Ga0068867_101254010 3300005459 Bacteria 683
39 Ga0068867_102036141 3300005459 Unclassified 543
40 Ga0070685_10245892 3300005466 Bacteria 1183
41 Ga0070685_10939582 3300005466 Bacteria 646
42 Ga0070679_101349466 3300005530 Bacteria 659
43 Ga0070684_100256878 3300005535 Bacteria 1598
44 Ga0070684_100690475 3300005535 Bacteria 951
45 Ga0070672_100389896 3300005543 Bacteria 1193
46 Ga0070672_100586620 3300005543 Bacteria 970
47 Ga0070672_101036567 3300005543 Unclassified 728
48 Ga0070665_101956509 3300005548 Bacteria 592
49 Ga0070665_102466905 3300005548 Bacteria 522
50 Ga0070704_101461290 3300005549 Unclassified 628
51 Ga0068855_100764909 3300005563 Bacteria 1029
52 Ga0070664_100068242 3300005564 Bacteria 3040
53 Ga0070664_100112767 3300005564 Bacteria 2375
54 Ga0070664_100453409 3300005564 Bacteria 1178
55 Ga0070664_100863364 3300005564 Bacteria 848
56 Ga0068854_100607176 3300005578 Bacteria 935
57 Ga0070702_100418073 3300005615 Bacteria 964
58 Ga0070702_100443333 3300005615 Bacteria 940
59 Ga0068852_100027882 3300005616 Bacteria 4611
60 Ga0068852_101138328 3300005616 Bacteria 801
61 Ga0068859_102874789 3300005617 Bacteria 528
62 Ga0068864_102556072 3300005618 Bacteria 517
63 Ga0068861_100144268 3300005719 Bacteria 1946
64 Ga0068851_10739243 3300005834 Bacteria 608
65 Ga0068870_11067661 3300005840 Unclassified 579
66 Ga0068858_100336198 3300005842 Bacteria 1445
67 Ga0068858_100598933 3300005842 Bacteria 1069
68 Ga0068860_100790361 3300005843 Bacteria 962
69 Ga0068860_101123993 3300005843 Bacteria 805
70 Ga0081455_10648139 3300005937 Bacteria 681
71 Ga0081538_10018966 3300005981 Bacteria 5138
72 Ga0081538_10039356 3300005981 Viruses 3033
73 Ga0081538_10069584 3300005981 Bacteria 1948
74 Ga0081538_10072734 3300005981 Bacteria 1883
75 Ga0081538_10127293 3300005981 Bacteria 1207
76 Ga0081539_10000740 3300005985 Bacteria 65387
77 Ga0075432_10034920 3300006058 Bacteria 1747
78 Ga0075432_10124485 3300006058 Unclassified 971
79 Ga0068871_102382878 3300006358 Unclassified 505
80 Ga0075428_101282514 3300006844 Unclassified 771
81 Ga0075430_101025538 3300006846 Unclassified 680
82 Ga0075431_100522856 3300006847 Bacteria 1176
83 Ga0075429_100523869 3300006880 Bacteria 1039
84 Ga0068865_100069738 3300006881 Bacteria 2489
85 Ga0068865_100675177 3300006881 Bacteria 880
86 Ga0097620_102874556 3300006931 Bacteria 528
87 Ga0075435_101279904 3300007076 Bacteria 642
88 Ga0111539_10023012 3300009094 Bacteria 7652
89 Ga0111539_10279604 3300009094 Bacteria 1942
90 Ga0111539_10373319 3300009094 Bacteria 1660
91 Ga0111539_10632419 3300009094 Bacteria 1246
92 Ga0111539_13528278 3300009094 Bacteria 502
93 Ga0105245_10041413 3300009098 Bacteria 4106
94 Ga0105245_11109003 3300009098 Bacteria 838
95 Ga0105245_13160386 3300009098 Unclassified 510
96 Ga0114129_11044688 3300009147 Bacteria 1026
97 Ga0114129_11220595 3300009147 Bacteria 936
98 Ga0114129_11509311 3300009147 Unclassified 825
99 Ga0114129_11585846 3300009147 Unclassified 802
100 Ga0105243_10137382 3300009148 Bacteria 2081
101 Ga0105242_10571397 3300009176 Unclassified 1087
102 Ga0105238_11112892 3300009551 Bacteria 813
103 Ga0105249_10367282 3300009553 Bacteria 1462
104 Ga0105249_10427712 3300009553 Bacteria 1359
105 Ga0105249_10586347 3300009553 Bacteria 1168
106 Ga0105239_10256689 3300010375 Bacteria 1964
107 Ga0105239_10577426 3300010375 Bacteria 1281
108 Ga0105239_13159682 3300010375 Unclassified 536
109 Ga0105246_10574153 3300011119 Bacteria 970
110 Ga0157369_12323352 3300013105 Bacteria 543
111 Ga0157378_10938874 3300013297 Unclassified 897
112 Ga0163162_10686271 3300013306 Bacteria 1146
113 Ga0163162_11611762 3300013306 Bacteria 740
114 Ga0157372_10734542 3300013307 Bacteria 1148
115 Ga0157372_12241026 3300013307 Bacteria 627
116 Ga0157375_10577319 3300013308 Bacteria 1285
117 Ga0157375_11688902 3300013308 Bacteria 750
118 Ga0157375_11773016 3300013308 Bacteria 732
119 Ga0163163_11392592 3300014325 Unclassified 763
120 Ga0163163_11423568 3300014325 Bacteria 755
121 Ga0157380_10078364 3300014326 Bacteria 2695
122 Ga0157380_10652793 3300014326 Bacteria 1050
123 Ga0157380_11749454 3300014326 Bacteria 680
124 Ga0157376_12996395 3300014969 Unclassified 511
125 Ga0207426_1054200 3300025302 Bacteria 1181
126 Ga0207656_10637794 3300025321 Bacteria 545
127 Ga0207642_10547096 3300025899 Unclassified 714
128 Ga0207688_10073075 3300025901 Bacteria 1949
129 Ga0207688_10224089 3300025901 Bacteria 1133
130 Ga0207688_10550711 3300025901 Bacteria 725
131 Ga0207643_10348385 3300025908 Bacteria 929
132 Ga0207643_10405173 3300025908 Bacteria 863
133 Ga0207705_10164808 3300025909 Bacteria 1666
134 Ga0207649_10377388 3300025920 Bacteria 1056
135 Ga0207649_10805399 3300025920 Bacteria 733
136 Ga0207649_11658715 3300025920 Bacteria 506
137 Ga0207652_11431179 3300025921 Bacteria 595
138 Ga0207681_10535156 3300025923 Bacteria 963
139 Ga0207659_11324294 3300025926 Bacteria 618
140 Ga0207687_11168483 3300025927 Bacteria 661
141 Ga0207690_10133706 3300025932 Bacteria 1819
142 Ga0207690_11482416 3300025932 Bacteria 567
143 Ga0207706_10042055 3300025933 Bacteria 4049
144 Ga0207706_10074324 3300025933 Bacteria 2989
145 Ga0207706_11078798 3300025933 Bacteria 672
146 Ga0207686_10446291 3300025934 Unclassified 994
147 Ga0207709_10123574 3300025935 Bacteria 1752
148 Ga0207709_10343935 3300025935 Unclassified 1124
149 Ga0207709_10377093 3300025935 Bacteria 1078
150 Ga0207669_10155991 3300025937 Bacteria 1606
151 Ga0207691_10424549 3300025940 Bacteria 1133
152 Ga0207691_10703908 3300025940 Unclassified 852
153 Ga0207689_10829310 3300025942 Bacteria 780
154 Ga0207689_10842541 3300025942 Bacteria 774
155 Ga0207661_10260278 3300025944 Bacteria 1545
156 Ga0207661_10605173 3300025944 Bacteria 1006
157 Ga0207661_11574815 3300025944 Bacteria 601
158 Ga0207679_10033596 3300025945 Bacteria 3611
159 Ga0207679_10195241 3300025945 Bacteria 1686
160 Ga0207712_10311970 3300025961 Bacteria 1294
161 Ga0207668_10191896 3300025972 Bacteria 1620
162 Ga0207640_10388940 3300025981 Bacteria 1132
163 Ga0207677_10258399 3300026023 Bacteria 1418
164 Ga0207703_10646395 3300026035 Bacteria 1003
165 Ga0207678_10065942 3300026067 Bacteria 3108
166 Ga0207678_10571716 3300026067 Bacteria 990
167 Ga0207708_10064688 3300026075 Bacteria 2795
168 Ga0207708_10322471 3300026075 Bacteria 1261
169 Ga0207648_10095280 3300026089 Bacteria 2603
170 Ga0207648_10740232 3300026089 Bacteria 913
171 Ga0207648_10868164 3300026089 Bacteria 842
172 Ga0207676_12343517 3300026095 Bacteria 531
173 Ga0207676_12568623 3300026095 Unclassified 506
174 Ga0207674_10288656 3300026116 Bacteria 1589
175 Ga0207675_100018689 3300026118 Bacteria 6469
176 Ga0207675_101161711 3300026118 Bacteria 792
177 Ga0207683_10274433 3300026121 Bacteria 1540
178 Ga0207683_10333666 3300026121 Bacteria 1390
179 Ga0207683_10716309 3300026121 Bacteria 928
180 Ga0207698_10147569 3300026142 Bacteria 2036
181 Ga0207698_11843602 3300026142 Bacteria 620
182 Ga0207428_10378438 3300027907 Bacteria 1039
183 Ga0207428_10742686 3300027907 Unclassified 700
184 Ga0268266_10077200 3300028379 Bacteria 2896
185 Ga0268265_12488077 3300028380 Bacteria 524
186 Ga0307408_101237421 3300031548 Bacteria 698
187 Ga0307408_101859157 3300031548 Bacteria 577
188 Ga0307405_10155861 3300031731 Bacteria 1612
189 Ga0307413_10055319 3300031824 Bacteria 2414
190 Ga0307413_10483005 3300031824 Bacteria 991
191 Ga0307410_10248976 3300031852 Bacteria 1381
192 Ga0326468_10012098 3300031889 Bacteria 902
193 Ga0307406_10265160 3300031901 Unclassified 1302
194 Ga0307406_11119361 3300031901 Bacteria 681
195 Ga0307407_10258112 3300031903 Bacteria 1197
196 Ga0307407_11472157 3300031903 Bacteria 538
197 Ga0307409_100028771 3300031995 Bacteria 3966
198 Ga0307409_100182591 3300031995 Unclassified 1859
199 Ga0307409_100864252 3300031995 Bacteria 916
200 Ga0307416_101079670 3300032002 Bacteria 907
201 Ga0307411_12307092 3300032005 Unclassified 506
202 Ga0373931_0540597 3300035691 Bacteria 756
203 Ga0439453_0190242 3300041408 Bacteria 505
204 Ga0451800_0859455 3300041459 Bacteria 560
205 Ga0451843_1479573 3300041509 Bacteria 566
206 Ga0451853_1561196 3300041512 Bacteria 866
207 Ga0439450_003123 3300042008 Bacteria 2701
208 Ga0439459_0132516 3300042438 Bacteria 638
209 Ga0466960_0627565 3300044901 Bacteria 640
210 Ga0466967_0043942 3300045976 Bacteria 3872
211 Ga0495641_0192237 3300046461 Bacteria 915
212 Ga0496102_1128165 3300048905 Unclassified 704
213 Ga0496109_0335904 3300048912 Bacteria 1427
214 Ga0496109_1080249 3300048912 Bacteria 740
215 Ga0496111_0093291 3300048914 Bacteria 2207
216 Ga0496121_0826013 3300048924 Archaea 542
217 Ga0496126_1309437 3300048929 Bacteria 527
218 Ga0501032_0256751 3300049569 Unclassified 1134
219 Ga0501033_0429072 3300049570 Unclassified 920
220 Ga0501036_0375860 3300049572 Unclassified 1186
221 Ga0501038_0239694 3300049574 Bacteria 1440
222 Ga0501039_0027736 3300049575 Bacteria 4355
223 Ga0501039_0042865 3300049575 Bacteria 3496
224 Ga0501039_0159376 3300049575 Bacteria 1773
225 Ga0501039_0685862 3300049575 Bacteria 801
226 Ga0501040_0184790 3300049576 Bacteria 1478
227 Ga0501041_0248804 3300049577 Bacteria 1117
228 Ga0501042_0022296 3300049578 Bacteria 4424
229 Ga0501042_0195277 3300049578 Bacteria 1460
230 Ga0501043_0934146 3300049579 Bacteria 620
231 Ga0501046_0136876 3300049580 Bacteria 1855
232 Ga0501048_0029092 3300049582 Bacteria 4009
233 Ga0501048_0052156 3300049582 Bacteria 2910
234 Ga0501048_0076924 3300049582 Bacteria 2355
235 Ga0501069_0187357 3300049585 Bacteria 1197
236 Ga0501070_1334579 3300049586 Bacteria 547
237 Ga0501071_0006091 3300049587 Bacteria 7819
238 Ga0501071_0171244 3300049587 Bacteria 1625
239 Ga0501071_0279873 3300049587 Bacteria 1262
240 Ga0501072_0051504 3300049588 Bacteria 3241
241 Ga0501072_0170750 3300049588 Bacteria 1735
242 Ga0501072_0178831 3300049588 Bacteria 1692
243 Ga0501074_0072240 3300049590 Bacteria 2479
244 Ga0501074_0378552 3300049590 Bacteria 1004
245 Ga0501076_0034244 3300049592 Bacteria 3969
246 Ga0501076_0223316 3300049592 Bacteria 1539
247 Ga0501077_0135394 3300049593 Bacteria 1562
248 Ga0501077_0528882 3300049593 Bacteria 756
249 Ga0501081_0020911 3300049743 Bacteria 4367
250 Ga0501081_0150920 3300049743 Bacteria 1669
251 Ga0501083_0134875 3300049744 Bacteria 1618
252 Ga0501035_0338152 3300049822 Bacteria 1262
253 Ga0501035_0589544 3300049822 Unclassified 907
254 nmdc:mga09592_398920_c1 3300050508 Unclassified 1189
255 nmdc:mga09592_501825_c1 3300050508 Bacteria 1045
256 nmdc:mga06r32_501870_c1 3300050510 Bacteria 1190
257 nmdc:mga08y16_1227255_c1 3300050511 Bacteria 719
258 nmdc:mga08y16_355840_c1 3300050511 Bacteria 1503
259 Ga0501084_0032118 3300054114 Bacteria 4391
260 Ga0501084_0046709 3300054114 Bacteria 3627
261 Ga0501082_0043516 3300060353 Bacteria 3872
262 Ga0501082_0189746 3300060353 Bacteria 1788
263 Ga0530510_0087737 3300061734 Bacteria 2267
264 Ga0075428_100030519
265 JGI25406J46586_10002135
266 JGI25407J50210_10008074
267 Ga0070658_10144881
268 Ga0070658_11503893
269 Ga0070676_10821614
270 Ga0070683_100241003
271 Ga0070683_100824196
272 Ga0070683_101149779
273 Ga0070683_101902347
274 Ga0070670_101432996
275 Ga0070670_101678599
276 Ga0070677_10765151
277 Ga0068869_100330291
278 Ga0070682_101752792
279 Ga0068868_100130665
280 Ga0068868_101402280
281 Ga0070661_100329475
282 Ga0070661_101007429
283 Ga0070692_10073471
284 Ga0070692_10632640
285 Ga0070692_10847620
286 Ga0070675_100140528
287 Ga0070671_100657364
288 Ga0070674_100700479
289 Ga0070659_100110947
290 Ga0070659_100254952
291 Ga0070667_102361951
292 Ga0070701_10609750
293 Ga0070700_100097526
294 Ga0070700_100293323
295 Ga0070700_100364996
296 Ga0070663_100760749
297 Ga0070663_101109943
298 Ga0070678_100216424
299 Ga0070678_100619424
300 Ga0068867_100141551
301 Ga0068867_101254010
302 Ga0068867_102036141
303 Ga0070685_10245892
304 Ga0070685_10939582
305 Ga0070679_101349466
306 Ga0070684_100256878
307 Ga0070684_100690475
308 Ga0070672_100389896
309 Ga0070672_100586620
310 Ga0070672_101036567
311 Ga0070665_101956509
312 Ga0070665_102466905
313 Ga0070704_101461290
314 Ga0068855_100764909
315 Ga0070664_100068242
316 Ga0070664_100112767
317 Ga0070664_100453409
318 Ga0070664_100863364
319 Ga0068854_100607176
320 Ga0070702_100418073
321 Ga0070702_100443333
322 Ga0068852_100027882
323 Ga0068852_101138328
324 Ga0068859_102874789
325 Ga0068864_102556072
326 Ga0068861_100144268
327 Ga0068851_10739243
328 Ga0068870_11067661
329 Ga0068858_100336198
330 Ga0068858_100598933
331 Ga0068860_100790361
332 Ga0068860_101123993
333 Ga0081455_10648139
334 Ga0081538_10018966
335 Ga0081538_10039356
336 Ga0081538_10069584
337 Ga0081538_10072734
338 Ga0081538_10127293
339 Ga0081539_10000740
340 Ga0075432_10034920
341 Ga0075432_10124485
342 Ga0068871_102382878
343 Ga0075428_101282514
344 Ga0075430_101025538
345 Ga0075431_100522856
346 Ga0075429_100523869
347 Ga0068865_100069738
348 Ga0068865_100675177
349 Ga0097620_102874556
350 Ga0075435_101279904
351 Ga0111539_10023012
352 Ga0111539_10279604
353 Ga0111539_10373319
354 Ga0111539_10632419
355 Ga0111539_13528278
356 Ga0105245_10041413
357 Ga0105245_11109003
358 Ga0105245_13160386
359 Ga0114129_11044688
360 Ga0114129_11220595
361 Ga0114129_11509311
362 Ga0114129_11585846
363 Ga0105243_10137382
364 Ga0105242_10571397
365 Ga0105238_11112892
366 Ga0105249_10367282
367 Ga0105249_10427712
368 Ga0105249_10586347
369 Ga0105239_10256689
370 Ga0105239_10577426
371 Ga0105239_13159682
372 Ga0105246_10574153
373 Ga0157369_12323352
374 Ga0157378_10938874
375 Ga0163162_10686271
376 Ga0163162_11611762
377 Ga0157372_10734542
378 Ga0157372_12241026
379 Ga0157375_10577319
380 Ga0157375_11688902
381 Ga0157375_11773016
382 Ga0163163_11392592
383 Ga0163163_11423568
384 Ga0157380_10078364
385 Ga0157380_10652793
386 Ga0157380_11749454
387 Ga0157376_12996395
388 Ga0207426_1054200
389 Ga0207656_10637794
390 Ga0207642_10547096
391 Ga0207688_10073075
392 Ga0207688_10224089
393 Ga0207688_10550711
394 Ga0207643_10348385
395 Ga0207643_10405173
396 Ga0207705_10164808
397 Ga0207649_10377388
398 Ga0207649_10805399
399 Ga0207649_11658715
400 Ga0207652_11431179
401 Ga0207681_10535156
402 Ga0207659_11324294
403 Ga0207687_11168483
404 Ga0207690_10133706
405 Ga0207690_11482416
406 Ga0207706_10042055
407 Ga0207706_10074324
408 Ga0207706_11078798
409 Ga0207686_10446291
410 Ga0207709_10123574
411 Ga0207709_10343935
412 Ga0207709_10377093
413 Ga0207669_10155991
414 Ga0207691_10424549
415 Ga0207691_10703908
416 Ga0207689_10829310
417 Ga0207689_10842541
418 Ga0207661_10260278
419 Ga0207661_10605173
420 Ga0207661_11574815
421 Ga0207679_10033596
422 Ga0207679_10195241
423 Ga0207712_10311970
424 Ga0207668_10191896
425 Ga0207640_10388940
426 Ga0207677_10258399
427 Ga0207703_10646395
428 Ga0207678_10065942
429 Ga0207678_10571716
430 Ga0207708_10064688
431 Ga0207708_10322471
432 Ga0207648_10095280
433 Ga0207648_10740232
434 Ga0207648_10868164
435 Ga0207676_12343517
436 Ga0207676_12568623
437 Ga0207674_10288656
438 Ga0207675_100018689
439 Ga0207675_101161711
440 Ga0207683_10274433
441 Ga0207683_10333666
442 Ga0207683_10716309
443 Ga0207698_10147569
444 Ga0207698_11843602
445 Ga0207428_10378438
446 Ga0207428_10742686
447 Ga0268266_10077200
448 Ga0268265_12488077
449 Ga0307408_101237421
450 Ga0307408_101859157
451 Ga0307405_10155861
452 Ga0307413_10055319
453 Ga0307413_10483005
454 Ga0307410_10248976
455 Ga0326468_10012098
456 Ga0307406_10265160
457 Ga0307406_11119361
458 Ga0307407_10258112
459 Ga0307407_11472157
460 Ga0307409_100028771
461 Ga0307409_100182591
462 Ga0307409_100864252
463 Ga0307416_101079670
464 Ga0307411_12307092
465 Ga0373931_0540597
466 Ga0439453_0190242
467 Ga0451800_0859455
468 Ga0451843_1479573
469 Ga0451853_1561196
470 Ga0439450_003123
471 Ga0439459_0132516
472 Ga0466960_0627565
473 Ga0466967_0043942
474 Ga0495641_0192237
475 Ga0496102_1128165
476 Ga0496109_0335904
477 Ga0496109_1080249
478 Ga0496111_0093291
479 Ga0496121_0826013
480 Ga0496126_1309437
481 Ga0501032_0256751
482 Ga0501033_0429072
483 Ga0501036_0375860
484 Ga0501038_0239694
485 Ga0501039_0027736
486 Ga0501039_0042865
487 Ga0501039_0159376
488 Ga0501039_0685862
489 Ga0501040_0184790
490 Ga0501041_0248804
491 Ga0501042_0022296
492 Ga0501042_0195277
493 Ga0501043_0934146
494 Ga0501046_0136876
495 Ga0501048_0029092
496 Ga0501048_0052156
497 Ga0501048_0076924
498 Ga0501069_0187357
499 Ga0501070_1334579
500 Ga0501071_0006091
501 Ga0501071_0171244
502 Ga0501071_0279873
503 Ga0501072_0051504
504 Ga0501072_0170750
505 Ga0501072_0178831
506 Ga0501074_0072240
507 Ga0501074_0378552
508 Ga0501076_0034244
509 Ga0501076_0223316
510 Ga0501077_0135394
511 Ga0501077_0528882
512 Ga0501081_0020911
513 Ga0501081_0150920
514 Ga0501083_0134875
515 Ga0501035_0338152
516 Ga0501035_0589544
517 nmdc:mga09592_398920_c1
518 nmdc:mga09592_501825_c1
519 nmdc:mga06r32_501870_c1
520 nmdc:mga08y16_1227255_c1
521 nmdc:mga08y16_355840_c1
522 Ga0501084_0032118
523 Ga0501084_0046709
524 Ga0501082_0043516
525 Ga0501082_0189746
526 Ga0530510_0087737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00127

Copper-bind

Copper binding proteins, plastocyanin/azurin family

29

118

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rym-assembly4.cif.gz_D structure of oxidized m98k mutant of amicyanin 0.8742 25 114
1mg3-assembly1.cif.gz_C mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin 0.8737 25 114
2idu-assembly1.cif.gz_A structure of m98q mutant of amicyanin, cu(i) 0.8705 25 114
3ie9-assembly1.cif.gz_A structure of oxidized m98l mutant of amicyanin 0.8684 26 114
1sf5-assembly1.cif.gz_A structure of oxidized state of the p94a mutant of amicyanin 0.8669 25 114
ID Description Score Start End Superfamily
5ysgA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8596 25 114 2.60.40.420
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8373 26 114 2.60.40.420
af_Q54Z78_22_111_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8254 22 114 2.60.40.420
1mdaA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8253 20 114 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8156 23 114 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A538CUS1-F1-model_v4 Copper-binding protein 0.9947 26 115 GO:0005507
GO:0009055
AF-A0A538CUS1-F1-model_v4 Copper-binding protein 0.9836 26 115 GO:0005507
GO:0009055
AF-A0A355URM7-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9258 25 115 GO:0005507
GO:0009055
GO:0042597
AF-A0A1I4BYP3-F1-model_v4 Copper binding protein, plastocyanin/azurin family 0.9225 29 114 GO:0005507
GO:0009055
GO:0042597
AF-A0A519C345-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9175 24 115 GO:0005507
GO:0009055
GO:0042597

Map