F371728

General Info

Members Datasets Scaffolds Average Seq Length
263 167 526 204

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100554983|Ga0068859_1005549832
Length 227
Sequence VPASGDAPGPADLAAEFGGIDIYLFDQLLRGRIRPGMRVLDAGCGTGRNLVYLLRAGYDVCGVDEDAAAIDAVRVLAGRLAPGLPHENFRTESVEAMTFPDDHADVVICSAVLHFARDDSHFQAMLRSAWRVLRPGGLFFARLASTVGLEGRLRQVGERRFVLPDGSTRYLVDESLLAGAAASLGAVLADPLKTTVVHGQRSMTTWVLGKQSGRPAAGPAPPITRAP

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
135 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.56
Nodule 0
Rhizoplane 0.76
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 23.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100554983 3300005617 Bacteria 1243
2 Ga0065715_10005884 3300005293 Bacteria 3413
3 Ga0070658_10671652 3300005327 Unclassified 899
4 Ga0070658_10783788 3300005327 Bacteria 828
5 Ga0070676_10089171 3300005328 Bacteria 1886
6 Ga0070676_10122651 3300005328 Bacteria 1633
7 Ga0070683_100037410 3300005329 Unclassified 4442
8 Ga0070690_100306868 3300005330 Bacteria 1139
9 Ga0070670_100446425 3300005331 Unclassified 1146
10 Ga0070677_10128845 3300005333 Bacteria 1152
11 Ga0070666_10301735 3300005335 Bacteria 1141
12 Ga0068868_100088817 3300005338 Bacteria 2488
13 Ga0070660_100535615 3300005339 Unclassified 976
14 Ga0070689_100076714 3300005340 Bacteria 2618
15 Ga0070689_100118981 3300005340 Bacteria 2108
16 Ga0070689_100123228 3300005340 Bacteria 2072
17 Ga0070689_100442469 3300005340 Unclassified 1105
18 Ga0070691_10472125 3300005341 Bacteria 720
19 Ga0070687_100218228 3300005343 Bacteria 1166
20 Ga0070661_100518621 3300005344 Unclassified 956
21 Ga0070675_100020690 3300005354 Bacteria 5251
22 Ga0070675_100042016 3300005354 Unclassified 3735
23 Ga0070675_100065847 3300005354 Bacteria 2996
24 Ga0070671_100132586 3300005355 Bacteria 2099
25 Ga0070674_100308147 3300005356 Viruses 1265
26 Ga0070673_100064208 3300005364 Bacteria 2924
27 Ga0070673_100140719 3300005364 Bacteria 2035
28 Ga0070673_100155632 3300005364 Unclassified 1940
29 Ga0070688_100070667 3300005365 Bacteria 2233
30 Ga0070688_100101448 3300005365 Bacteria 1898
31 Ga0070667_100216691 3300005367 Bacteria 1703
32 Ga0070701_10107104 3300005438 Bacteria 1557
33 Ga0070701_10561263 3300005438 Bacteria 750
34 Ga0070705_100423558 3300005440 Bacteria 992
35 Ga0070700_100038747 3300005441 Bacteria 2907
36 Ga0070700_100633854 3300005441 Bacteria 842
37 Ga0070694_100002245 3300005444 Bacteria 11413
38 Ga0070694_100106908 3300005444 Unclassified 1988
39 Ga0068867_100063973 3300005459 Bacteria 2734
40 Ga0070707_100466899 3300005468 Unclassified 1223
41 Ga0070698_100319353 3300005471 Bacteria 1484
42 Ga0070698_100753939 3300005471 Bacteria 917
43 Ga0070672_100474337 3300005543 Bacteria 1080
44 Ga0070686_100100898 3300005544 Bacteria 1950
45 Ga0070686_100318523 3300005544 Bacteria 1159
46 Ga0070665_100126477 3300005548 Bacteria 2558
47 Ga0070664_100298789 3300005564 Unclassified 1455
48 Ga0068859_100053718 3300005617 Bacteria 4052
49 Ga0068859_100794916 3300005617 Bacteria 1034
50 Ga0068861_100243859 3300005719 Bacteria 1530
51 Ga0068861_101004108 3300005719 Bacteria 797
52 Ga0068851_10166941 3300005834 Bacteria 1212
53 Ga0068863_100031999 3300005841 Bacteria 5017
54 Ga0068863_100428292 3300005841 Unclassified 1297
55 Ga0068863_101187689 3300005841 Bacteria 769
56 Ga0068858_100017587 3300005842 Bacteria 6704
57 Ga0068858_100323903 3300005842 Bacteria 1473
58 Ga0068858_100357063 3300005842 Bacteria 1400
59 Ga0068860_100034107 3300005843 Unclassified 4881
60 Ga0075365_10185278 3300006038 Unclassified 1456
61 Ga0075368_10055338 3300006042 Bacteria 1581
62 Ga0075364_10055771 3300006051 Bacteria 2586
63 Ga0075367_10005116 3300006178 Bacteria 6473
64 Ga0075367_10053425 3300006178 Bacteria 2393
65 Ga0075366_10003892 3300006195 Bacteria 7959
66 Ga0097621_100051374 3300006237 Bacteria 3355
67 Ga0097621_100525378 3300006237 Bacteria 1075
68 Ga0075428_100001856 3300006844 Bacteria 22643
69 Ga0075428_100022637 3300006844 Bacteria 6957
70 Ga0075430_100006950 3300006846 Bacteria 9540
71 Ga0075430_100510145 3300006846 Unclassified 992
72 Ga0075431_100062855 3300006847 Unclassified 3831
73 Ga0075431_100074528 3300006847 Bacteria 3502
74 Ga0075429_100000948 3300006880 Bacteria 22972
75 Ga0075429_100219969 3300006880 Bacteria 1663
76 Ga0097620_100053718 3300006931 Bacteria 4052
77 Ga0097620_100554888 3300006931 Bacteria 1243
78 Ga0097620_100794912 3300006931 Bacteria 1034
79 Ga0099795_10092077 3300007788 Unclassified 1176
80 Ga0111539_10001068 3300009094 Bacteria 36134
81 Ga0111539_10027005 3300009094 Bacteria 7012
82 Ga0111539_10043084 3300009094 Bacteria 5413
83 Ga0111539_10047827 3300009094 Bacteria 5111
84 Ga0111539_10315544 3300009094 Bacteria 1819
85 Ga0111539_10770533 3300009094 Bacteria 1120
86 Ga0105245_10003870 3300009098 Bacteria 13319
87 Ga0105245_10680738 3300009098 Bacteria 1061
88 Ga0105247_10778065 3300009101 Unclassified 728
89 Ga0114129_10189127 3300009147 Bacteria 2797
90 Ga0105243_10818888 3300009148 Bacteria 919
91 Ga0105242_10006994 3300009176 Bacteria 8711
92 Ga0105242_10846369 3300009176 Bacteria 910
93 Ga0105248_10016714 3300009177 Bacteria 8078
94 Ga0105248_10138624 3300009177 Bacteria 2744
95 Ga0105248_10185200 3300009177 Bacteria 2346
96 Ga0105248_10236264 3300009177 Bacteria 2057
97 Ga0105248_10349030 3300009177 Bacteria 1666
98 Ga0105237_10115050 3300009545 Bacteria 2683
99 Ga0105237_10173909 3300009545 Bacteria 2153
100 Ga0157378_10011524 3300013297 Bacteria 7740
101 Ga0157378_10124662 3300013297 Bacteria 2379
102 Ga0163162_10226998 3300013306 Bacteria 1997
103 Ga0157375_10063863 3300013308 Unclassified 3665
104 Ga0157375_10113692 3300013308 Bacteria 2808
105 Ga0163163_10169192 3300014325 Bacteria 2232
106 Ga0163163_10291145 3300014325 Bacteria 1685
107 Ga0157380_10155953 3300014326 Bacteria 1979
108 Ga0157380_11880418 3300014326 Unclassified 659
109 Ga0157377_10016435 3300014745 Unclassified 3806
110 Ga0157377_10052565 3300014745 Bacteria 2300
111 Ga0157379_10084985 3300014968 Unclassified 2835
112 Ga0157379_10144675 3300014968 Bacteria 2144
113 Ga0157376_10185169 3300014969 Bacteria 1906
114 Ga0163161_10047057 3300017792 Bacteria 3114
115 Ga0207653_10000136 3300025885 Bacteria 52600
116 Ga0207680_10058026 3300025903 Unclassified 2345
117 Ga0207680_10154233 3300025903 Bacteria 1534
118 Ga0207645_10032536 3300025907 Bacteria 3352
119 Ga0207705_10407079 3300025909 Unclassified 1052
120 Ga0207671_10096736 3300025914 Bacteria 2231
121 Ga0207662_10086188 3300025918 Bacteria 1924
122 Ga0207650_10041581 3300025925 Unclassified 3369
123 Ga0207659_10000275 3300025926 Bacteria 31310
124 Ga0207659_10075609 3300025926 Bacteria 2472
125 Ga0207659_10757337 3300025926 Unclassified 833
126 Ga0207687_10005369 3300025927 Bacteria 8477
127 Ga0207687_10310559 3300025927 Bacteria 1273
128 Ga0207686_10026160 3300025934 Bacteria 3402
129 Ga0207686_10128730 3300025934 Bacteria 1733
130 Ga0207686_10142494 3300025934 Bacteria 1659
131 Ga0207686_10365309 3300025934 Unclassified 1090
132 Ga0207670_10127895 3300025936 Unclassified 1856
133 Ga0207669_10598356 3300025937 Bacteria 896
134 Ga0207704_10013941 3300025938 Unclassified 4044
135 Ga0207704_10140612 3300025938 Unclassified 1688
136 Ga0207704_10607591 3300025938 Unclassified 896
137 Ga0207691_10038464 3300025940 Bacteria 4428
138 Ga0207711_10071004 3300025941 Bacteria 3020
139 Ga0207711_10117838 3300025941 Bacteria 2368
140 Ga0207711_10210802 3300025941 Unclassified 1774
141 Ga0207711_10806137 3300025941 Unclassified 874
142 Ga0207689_10221953 3300025942 Bacteria 1562
143 Ga0207689_10452478 3300025942 Unclassified 1073
144 Ga0207679_10142481 3300025945 Bacteria 1939
145 Ga0207679_10975807 3300025945 Bacteria 776
146 Ga0207651_10399367 3300025960 Unclassified 1169
147 Ga0207658_10048057 3300025986 Bacteria 3127
148 Ga0207703_10087087 3300026035 Unclassified 2618
149 Ga0207703_10227971 3300026035 Bacteria 1669
150 Ga0207708_10206801 3300026075 Bacteria 1568
151 Ga0207708_10303325 3300026075 Bacteria 1299
152 Ga0207641_10089215 3300026088 Unclassified 2694
153 Ga0207641_10436116 3300026088 Unclassified 1264
154 Ga0207648_10062479 3300026089 Bacteria 3246
155 Ga0207648_10067172 3300026089 Bacteria 3126
156 Ga0207648_10228187 3300026089 Bacteria 1656
157 Ga0207676_10122986 3300026095 Bacteria 2192
158 Ga0207675_100037971 3300026118 Bacteria 4494
159 Ga0207675_100479074 3300026118 Unclassified 1237
160 Ga0207683_10030348 3300026121 Unclassified 4684
161 Ga0209971_1021529 3300027682 Unclassified 1533
162 Ga0207428_10007039 3300027907 Bacteria 10297
163 Ga0207428_10016120 3300027907 Bacteria 6437
164 Ga0207428_10021846 3300027907 Bacteria 5413
165 Ga0268266_10007877 3300028379 Bacteria 9544
166 Ga0268266_10037708 3300028379 Bacteria 4116
167 Ga0268264_10365216 3300028381 Bacteria 1378
168 Ga0307515_10185364 3300028794 Bacteria 2013
169 Ga0307408_100061214 3300031548 Unclassified 2747
170 Ga0265314_10024604 3300031711 Bacteria 4562
171 Ga0265342_10036764 3300031712 Bacteria 2990
172 Ga0307405_10009682 3300031731 Bacteria 4953
173 Ga0307410_10029311 3300031852 Bacteria 3504
174 Ga0307406_10073362 3300031901 Unclassified 2250
175 Ga0307406_10521906 3300031901 Bacteria 967
176 Ga0307407_10178805 3300031903 Bacteria 1404
177 Ga0307416_101517308 3300032002 Bacteria 776
178 Ga0307411_10299944 3300032005 Bacteria 1288
179 Ga0373953_0050518 3300035117 Bacteria 1680
180 Ga0373957_0050031 3300035120 Bacteria 1596
181 Ga0373955_0077391 3300035172 Bacteria 1873
182 Ga0373931_0275142 3300035691 Bacteria 1032
183 Ga0373935_1267242 3300035692 Unclassified 550
184 Ga0373933_0100899 3300035724 Bacteria 1791
185 Ga0373937_0020783 3300036401 Bacteria 5888
186 Ga0373937_0038421 3300036401 Bacteria 4361
187 Ga0373937_0100952 3300036401 Bacteria 2678
188 Ga0373937_0774143 3300036401 Bacteria 907
189 Ga0451789_0430095 3300041443 Unclassified 745
190 Ga0439450_066024 3300042008 Unclassified 881
191 Ga0439464_0068476 3300042439 Bacteria 1047
192 Ga0466967_0110225 3300045976 Bacteria 2528
193 Ga0495653_0096615 3300046463 Bacteria 2148
194 Ga0495653_0227271 3300046463 Bacteria 1251
195 Ga0495594_0420143 3300046499 Bacteria 760
196 Ga0495608_0106549 3300046511 Bacteria 1804
197 Ga0495618_0313224 3300046514 Unclassified 973
198 Ga0495630_0311489 3300046517 Unclassified 1203
199 Ga0495633_0243245 3300046558 Unclassified 822
200 Ga0495667_0000286 3300046559 Bacteria 32819
201 Ga0495657_0002840 3300046675 Bacteria 14371
202 Ga0495647_0111602 3300046681 Bacteria 1142
203 Ga0495658_0035383 3300046683 Unclassified 2747
204 Ga0495658_0036536 3300046683 Bacteria 2711
205 Ga0495613_0017569 3300046689 Bacteria 5327
206 Ga0495613_0362078 3300046689 Unclassified 994
207 Ga0495600_0207505 3300046809 Bacteria 1256
208 Ga0495604_0288829 3300047317 Unclassified 1105
209 Ga0495674_0055505 3300047319 Bacteria 3474
210 Ga0495684_0135050 3300047471 Bacteria 1851
211 Ga0496113_0409623 3300048916 Bacteria 1089
212 Ga0501297_009886 3300049520 Bacteria 1072
213 Ga0501299_033234 3300049522 Bacteria 1004
214 Ga0501032_0003646 3300049569 Bacteria 11715
215 Ga0501034_0006308 3300049571 Bacteria 12763
216 Ga0501034_0192764 3300049571 Bacteria 1999
217 Ga0501036_0037351 3300049572 Bacteria 4109
218 Ga0501036_0044116 3300049572 Bacteria 3776
219 Ga0501036_0786058 3300049572 Unclassified 784
220 Ga0501037_0017363 3300049573 Bacteria 5300
221 Ga0501037_0046599 3300049573 Bacteria 3179
222 Ga0501038_0010660 3300049574 Bacteria 8404
223 Ga0501039_0003226 3300049575 Bacteria 12197
224 Ga0501039_0174549 3300049575 Bacteria 1690
225 Ga0501043_0004431 3300049579 Bacteria 11407
226 Ga0501046_0005856 3300049580 Bacteria 10959
227 Ga0501047_0003736 3300049581 Bacteria 14337
228 Ga0501067_0031557 3300049583 Unclassified 2939
229 Ga0501068_0002215 3300049584 Bacteria 10341
230 Ga0501069_0019155 3300049585 Bacteria 3697
231 Ga0501070_0120363 3300049586 Bacteria 2170
232 Ga0501072_0023974 3300049588 Bacteria 4743
233 Ga0501072_0041336 3300049588 Unclassified 3621
234 Ga0501073_0008417 3300049589 Bacteria 7651
235 Ga0501073_0238171 3300049589 Bacteria 1257
236 Ga0501080_0001107 3300049742 Bacteria 22213
237 Ga0501035_0006174 3300049822 Bacteria 11279
238 Ga0501035_0054116 3300049822 Bacteria 3586
239 Ga0501044_0006395 3300049823 Bacteria 13019
240 Ga0501044_0094910 3300049823 Bacteria 3006
241 nmdc:mga00v17_463971_c1 3300050491 Unclassified 822
242 nmdc:mga0yw44_90936_c1 3300050492 Unclassified 1928
243 nmdc:mga0k408_165118_c1 3300050493 Bacteria 1319
244 nmdc:mga0k408_261050_c1 3300050493 Bacteria 1034
245 nmdc:mga06z11_283805_c1 3300050494 Bacteria 981
246 nmdc:mga05p37_140503_c1 3300050507 Bacteria 2959
247 nmdc:mga05p37_3578_c1 3300050507 Bacteria 18154
248 nmdc:mga09592_45288_c1 3300050508 Bacteria 3705
249 nmdc:mga09592_4979_c1 3300050508 Bacteria 10767
250 nmdc:mga0qj67_115981_c1 3300050509 Unclassified 2164
251 nmdc:mga0qj67_8176_c1 3300050509 Bacteria 7753
252 nmdc:mga06r32_29872_c1 3300050510 Bacteria 5112
253 nmdc:mga06r32_726833_c1 3300050510 Bacteria 957
254 nmdc:mga08y16_1362_c1 3300050511 Bacteria 24412
255 nmdc:mga08y16_141700_c1 3300050511 Bacteria 2499
256 nmdc:mga08y16_298511_c1 3300050511 Bacteria 1661
257 nmdc:mga08y16_334699_c1 3300050511 Bacteria 1557
258 nmdc:mga08y16_60424_c1 3300050511 Bacteria 3959
259 Ga0495595_0050112 3300053084 Unclassified 1933
260 Ga0495619_0057209 3300053085 Bacteria 2587
261 Ga0500568_0007640 3300053139 Bacteria 5282
262 Ga0501084_0038035 3300054114 Unclassified 4022
263 Ga0501082_0059370 3300060353 Unclassified 3296
264 Ga0068859_100554983
265 Ga0065715_10005884
266 Ga0070658_10671652
267 Ga0070658_10783788
268 Ga0070676_10089171
269 Ga0070676_10122651
270 Ga0070683_100037410
271 Ga0070690_100306868
272 Ga0070670_100446425
273 Ga0070677_10128845
274 Ga0070666_10301735
275 Ga0068868_100088817
276 Ga0070660_100535615
277 Ga0070689_100076714
278 Ga0070689_100118981
279 Ga0070689_100123228
280 Ga0070689_100442469
281 Ga0070691_10472125
282 Ga0070687_100218228
283 Ga0070661_100518621
284 Ga0070675_100020690
285 Ga0070675_100042016
286 Ga0070675_100065847
287 Ga0070671_100132586
288 Ga0070674_100308147
289 Ga0070673_100064208
290 Ga0070673_100140719
291 Ga0070673_100155632
292 Ga0070688_100070667
293 Ga0070688_100101448
294 Ga0070667_100216691
295 Ga0070701_10107104
296 Ga0070701_10561263
297 Ga0070705_100423558
298 Ga0070700_100038747
299 Ga0070700_100633854
300 Ga0070694_100002245
301 Ga0070694_100106908
302 Ga0068867_100063973
303 Ga0070707_100466899
304 Ga0070698_100319353
305 Ga0070698_100753939
306 Ga0070672_100474337
307 Ga0070686_100100898
308 Ga0070686_100318523
309 Ga0070665_100126477
310 Ga0070664_100298789
311 Ga0068859_100053718
312 Ga0068859_100794916
313 Ga0068861_100243859
314 Ga0068861_101004108
315 Ga0068851_10166941
316 Ga0068863_100031999
317 Ga0068863_100428292
318 Ga0068863_101187689
319 Ga0068858_100017587
320 Ga0068858_100323903
321 Ga0068858_100357063
322 Ga0068860_100034107
323 Ga0075365_10185278
324 Ga0075368_10055338
325 Ga0075364_10055771
326 Ga0075367_10005116
327 Ga0075367_10053425
328 Ga0075366_10003892
329 Ga0097621_100051374
330 Ga0097621_100525378
331 Ga0075428_100001856
332 Ga0075428_100022637
333 Ga0075430_100006950
334 Ga0075430_100510145
335 Ga0075431_100062855
336 Ga0075431_100074528
337 Ga0075429_100000948
338 Ga0075429_100219969
339 Ga0097620_100053718
340 Ga0097620_100554888
341 Ga0097620_100794912
342 Ga0099795_10092077
343 Ga0111539_10001068
344 Ga0111539_10027005
345 Ga0111539_10043084
346 Ga0111539_10047827
347 Ga0111539_10315544
348 Ga0111539_10770533
349 Ga0105245_10003870
350 Ga0105245_10680738
351 Ga0105247_10778065
352 Ga0114129_10189127
353 Ga0105243_10818888
354 Ga0105242_10006994
355 Ga0105242_10846369
356 Ga0105248_10016714
357 Ga0105248_10138624
358 Ga0105248_10185200
359 Ga0105248_10236264
360 Ga0105248_10349030
361 Ga0105237_10115050
362 Ga0105237_10173909
363 Ga0157378_10011524
364 Ga0157378_10124662
365 Ga0163162_10226998
366 Ga0157375_10063863
367 Ga0157375_10113692
368 Ga0163163_10169192
369 Ga0163163_10291145
370 Ga0157380_10155953
371 Ga0157380_11880418
372 Ga0157377_10016435
373 Ga0157377_10052565
374 Ga0157379_10084985
375 Ga0157379_10144675
376 Ga0157376_10185169
377 Ga0163161_10047057
378 Ga0207653_10000136
379 Ga0207680_10058026
380 Ga0207680_10154233
381 Ga0207645_10032536
382 Ga0207705_10407079
383 Ga0207671_10096736
384 Ga0207662_10086188
385 Ga0207650_10041581
386 Ga0207659_10000275
387 Ga0207659_10075609
388 Ga0207659_10757337
389 Ga0207687_10005369
390 Ga0207687_10310559
391 Ga0207686_10026160
392 Ga0207686_10128730
393 Ga0207686_10142494
394 Ga0207686_10365309
395 Ga0207670_10127895
396 Ga0207669_10598356
397 Ga0207704_10013941
398 Ga0207704_10140612
399 Ga0207704_10607591
400 Ga0207691_10038464
401 Ga0207711_10071004
402 Ga0207711_10117838
403 Ga0207711_10210802
404 Ga0207711_10806137
405 Ga0207689_10221953
406 Ga0207689_10452478
407 Ga0207679_10142481
408 Ga0207679_10975807
409 Ga0207651_10399367
410 Ga0207658_10048057
411 Ga0207703_10087087
412 Ga0207703_10227971
413 Ga0207708_10206801
414 Ga0207708_10303325
415 Ga0207641_10089215
416 Ga0207641_10436116
417 Ga0207648_10062479
418 Ga0207648_10067172
419 Ga0207648_10228187
420 Ga0207676_10122986
421 Ga0207675_100037971
422 Ga0207675_100479074
423 Ga0207683_10030348
424 Ga0209971_1021529
425 Ga0207428_10007039
426 Ga0207428_10016120
427 Ga0207428_10021846
428 Ga0268266_10007877
429 Ga0268266_10037708
430 Ga0268264_10365216
431 Ga0307515_10185364
432 Ga0307408_100061214
433 Ga0265314_10024604
434 Ga0265342_10036764
435 Ga0307405_10009682
436 Ga0307410_10029311
437 Ga0307406_10073362
438 Ga0307406_10521906
439 Ga0307407_10178805
440 Ga0307416_101517308
441 Ga0307411_10299944
442 Ga0373953_0050518
443 Ga0373957_0050031
444 Ga0373955_0077391
445 Ga0373931_0275142
446 Ga0373935_1267242
447 Ga0373933_0100899
448 Ga0373937_0020783
449 Ga0373937_0038421
450 Ga0373937_0100952
451 Ga0373937_0774143
452 Ga0451789_0430095
453 Ga0439450_066024
454 Ga0439464_0068476
455 Ga0466967_0110225
456 Ga0495653_0096615
457 Ga0495653_0227271
458 Ga0495594_0420143
459 Ga0495608_0106549
460 Ga0495618_0313224
461 Ga0495630_0311489
462 Ga0495633_0243245
463 Ga0495667_0000286
464 Ga0495657_0002840
465 Ga0495647_0111602
466 Ga0495658_0035383
467 Ga0495658_0036536
468 Ga0495613_0017569
469 Ga0495613_0362078
470 Ga0495600_0207505
471 Ga0495604_0288829
472 Ga0495674_0055505
473 Ga0495684_0135050
474 Ga0496113_0409623
475 Ga0501297_009886
476 Ga0501299_033234
477 Ga0501032_0003646
478 Ga0501034_0006308
479 Ga0501034_0192764
480 Ga0501036_0037351
481 Ga0501036_0044116
482 Ga0501036_0786058
483 Ga0501037_0017363
484 Ga0501037_0046599
485 Ga0501038_0010660
486 Ga0501039_0003226
487 Ga0501039_0174549
488 Ga0501043_0004431
489 Ga0501046_0005856
490 Ga0501047_0003736
491 Ga0501067_0031557
492 Ga0501068_0002215
493 Ga0501069_0019155
494 Ga0501070_0120363
495 Ga0501072_0023974
496 Ga0501072_0041336
497 Ga0501073_0008417
498 Ga0501073_0238171
499 Ga0501080_0001107
500 Ga0501035_0006174
501 Ga0501035_0054116
502 Ga0501044_0006395
503 Ga0501044_0094910
504 nmdc:mga00v17_463971_c1
505 nmdc:mga0yw44_90936_c1
506 nmdc:mga0k408_165118_c1
507 nmdc:mga0k408_261050_c1
508 nmdc:mga06z11_283805_c1
509 nmdc:mga05p37_140503_c1
510 nmdc:mga05p37_3578_c1
511 nmdc:mga09592_45288_c1
512 nmdc:mga09592_4979_c1
513 nmdc:mga0qj67_115981_c1
514 nmdc:mga0qj67_8176_c1
515 nmdc:mga06r32_29872_c1
516 nmdc:mga06r32_726833_c1
517 nmdc:mga08y16_1362_c1
518 nmdc:mga08y16_141700_c1
519 nmdc:mga08y16_298511_c1
520 nmdc:mga08y16_334699_c1
521 nmdc:mga08y16_60424_c1
522 Ga0495595_0050112
523 Ga0495619_0057209
524 Ga0500568_0007640
525 Ga0501084_0038035
526 Ga0501082_0059370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

40

141

0.95

PF13649

Methyltransf_25

Methyltransferase domain

39

137

0.94

PF08242

Methyltransf_12

Methyltransferase domain

40

139

0.92

PF13847

Methyltransf_31

Methyltransferase domain

33

162

0.89

PF13489

Methyltransf_23

Methyltransferase domain

22

183

0.88

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

27

154

0.78

PF05175

MTS

Methyltransferase small domain

24

163

0.78

PF03848

TehB

Tellurite resistance protein TehB

30

145

0.71

PF07021

MetW

Methionine biosynthesis protein MetW

25

135

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yr0-assembly2.cif.gz_B crystal structure of hypothetical methyltransferase ttha0223 from thermus thermophilus hb8 0.8642 18 145
4qdj-assembly1.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam 0.8558 15 214
6gkz-assembly1.cif.gz_D crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8401 15 145
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.8054 11 213
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.8027 13 213
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8833 20 144 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8743 20 140 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8713 28 73 3.40.50.150
4qdjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8559 15 214 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.851 27 152 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3B9LNN8-F1-model_v4 Class I SAM-dependent methyltransferase 0.991 1 214 GO:0010420
GO:0032259
AF-A0A6H9KCD0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9898 4 213 GO:0008757
GO:0032259
AF-A0A843SVV1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9894 106 213 GO:0008168
GO:0032259
AF-A0A7L5AEZ1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9889 30 214 GO:0010420
GO:0032259
AF-A0A239CLY3-F1-model_v4 Methyltransferase domain-containing protein 0.9861 4 214 GO:0008757
GO:0032259

Map