F371628

General Info

Members Datasets Scaffolds Average Seq Length
263 157 263 131

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100000180|Ga0070660_10000018031
Length 142
Sequence MFTTARARYTTSMQDSIFTQIIRGEIPCHKIYEDDKTLAFLDIHPIQPGHTLVIPKKQIEFVWDLDSEDYQAVMATAQKVALRLREVFSTPYIGSQVVGVDVPHAHIHLIPFATTAELRNQPDMQAEPDHAALAELAKKLAF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
77 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
78 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
79 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
92 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
143 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
148 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
154 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
155 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
156 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.25
Nodule 0
Rhizoplane 0.76
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6338588 2162886012 Unclassified 1445
2 JGI24736J21556_1016979 3300001904 Unclassified 1155
3 JGI24739J22299_10028872 3300001989 Bacteria 1932
4 Ga0070658_10000366 3300005327 Bacteria 39386
5 Ga0070658_10000737 3300005327 Bacteria 28059
6 Ga0070658_10013613 3300005327 Bacteria 6526
7 Ga0070658_10146287 3300005327 Bacteria 1976
8 Ga0070658_10758441 3300005327 Bacteria 843
9 Ga0070658_10820846 3300005327 Unclassified 808
10 Ga0070683_100093226 3300005329 Bacteria 2829
11 Ga0070670_100043573 3300005331 Bacteria 3857
12 Ga0070670_100110786 3300005331 Bacteria 2365
13 Ga0070670_100922363 3300005331 Unclassified 792
14 Ga0070680_100031051 3300005336 Unclassified 4294
15 Ga0070680_100273858 3300005336 Bacteria 1429
16 Ga0070682_100302178 3300005337 Bacteria 1175
17 Ga0070660_100000180 3300005339 Bacteria 41683
18 Ga0070660_100000721 3300005339 Bacteria 21933
19 Ga0070660_100007696 3300005339 Bacteria 7509
20 Ga0070660_100207934 3300005339 Bacteria 1588
21 Ga0070691_10001845 3300005341 Bacteria 9235
22 Ga0070671_100000001 3300005355 Bacteria 1228151
23 Ga0070659_100000131 3300005366 Bacteria 57281
24 Ga0070659_100137283 3300005366 Bacteria 1989
25 Ga0070667_100000001 3300005367 Bacteria 1108638
26 Ga0070714_101338857 3300005435 Unclassified 699
27 Ga0070681_10009681 3300005458 Bacteria 9482
28 Ga0070681_10122061 3300005458 Unclassified 2539
29 Ga0070681_10176121 3300005458 Bacteria 2061
30 Ga0070699_100859629 3300005518 Bacteria 830
31 Ga0070679_100002974 3300005530 Bacteria 15459
32 Ga0070679_100044713 3300005530 Bacteria 4412
33 Ga0070684_100053121 3300005535 Bacteria 3526
34 Ga0068855_100000324 3300005563 Bacteria 59520
35 Ga0068855_100006818 3300005563 Bacteria 13854
36 Ga0068857_100000001 3300005577 Bacteria 254081
37 Ga0068857_100070060 3300005577 Bacteria 3123
38 Ga0068857_100104209 3300005577 Bacteria 2547
39 Ga0068857_100804119 3300005577 Bacteria 898
40 Ga0068854_100032492 3300005578 Bacteria 3632
41 Ga0068856_100000002 3300005614 Bacteria 372816
42 Ga0068856_100156229 3300005614 Bacteria 2291
43 Ga0068860_100006258 3300005843 Bacteria 11955
44 Ga0081455_10000020 3300005937 Bacteria 172997
45 Ga0081539_10061792 3300005985 Unclassified 2050
46 Ga0070717_10742677 3300006028 Unclassified 892
47 Ga0075365_10001941 3300006038 Bacteria 9761
48 Ga0075365_10006489 3300006038 Bacteria 6441
49 Ga0075365_10009623 3300006038 Bacteria 5574
50 Ga0075365_10238660 3300006038 Bacteria 1276
51 Ga0075365_11266821 3300006038 Unclassified 518
52 Ga0075368_10000136 3300006042 Bacteria 19579
53 Ga0075364_10004001 3300006051 Bacteria 8464
54 Ga0075364_10082972 3300006051 Bacteria 2121
55 Ga0075362_10135744 3300006177 Bacteria 1173
56 Ga0075362_10678494 3300006177 Unclassified 536
57 Ga0075367_10000135 3300006178 Bacteria 22004
58 Ga0075369_10000062 3300006186 Bacteria 27945
59 Ga0075366_10433724 3300006195 Bacteria 810
60 Ga0075366_10497024 3300006195 Bacteria 754
61 Ga0075370_10003033 3300006353 Bacteria 7916
62 Ga0105240_10000030 3300009093 Bacteria 321312
63 Ga0105240_10425978 3300009093 Bacteria 1490
64 Ga0105245_10289896 3300009098 Unclassified 1603
65 Ga0105245_10788177 3300009098 Bacteria 988
66 Ga0105247_10482321 3300009101 Bacteria 900
67 Ga0105241_10150545 3300009174 Bacteria 1903
68 Ga0105241_10931391 3300009174 Bacteria 809
69 Ga0105248_10724450 3300009177 Bacteria 1122
70 Ga0105237_10000001 3300009545 Bacteria 1009213
71 Ga0105238_10026134 3300009551 Bacteria 5949
72 Ga0105238_10072781 3300009551 Bacteria 3431
73 Ga0105238_10119990 3300009551 Bacteria 2609
74 Ga0105238_10528486 3300009551 Bacteria 1183
75 Ga0105032_100010 3300009979 Bacteria 81059
76 Ga0105239_11342391 3300010375 Bacteria 825
77 Ga0157373_10247451 3300013100 Bacteria 1261
78 Ga0157373_11151020 3300013100 Bacteria 583
79 Ga0157371_10009914 3300013102 Bacteria 7459
80 Ga0157371_10065123 3300013102 Unclassified 2581
81 Ga0157371_11015267 3300013102 Unclassified 633
82 Ga0157370_10001312 3300013104 Bacteria 30999
83 Ga0157370_10487144 3300013104 Bacteria 1133
84 Ga0157370_10777400 3300013104 Bacteria 872
85 Ga0157369_10000003 3300013105 Bacteria 507337
86 Ga0157369_12622332 3300013105 Bacteria 509
87 Ga0157374_10249860 3300013296 Bacteria 1745
88 Ga0157372_10000007 3300013307 Bacteria 340690
89 Ga0157372_10000027 3300013307 Bacteria 186906
90 Ga0157372_10023867 3300013307 Bacteria 6636
91 Ga0157372_10177542 3300013307 Unclassified 2465
92 Ga0157372_10288085 3300013307 Unclassified 1910
93 Ga0207710_10370911 3300025900 Bacteria 731
94 Ga0207647_10004673 3300025904 Bacteria 10145
95 Ga0207705_10000019 3300025909 Bacteria 317770
96 Ga0207705_10003855 3300025909 Bacteria 11406
97 Ga0207705_10020953 3300025909 Bacteria 4664
98 Ga0207705_10269410 3300025909 Bacteria 1302
99 Ga0207654_10162379 3300025911 Bacteria 1444
100 Ga0207654_10325677 3300025911 Unclassified 1051
101 Ga0207707_10031112 3300025912 Bacteria 4669
102 Ga0207707_10633729 3300025912 Bacteria 902
103 Ga0207695_10000009 3300025913 Bacteria 1034276
104 Ga0207671_10000003 3300025914 Bacteria 1065461
105 Ga0207671_10670204 3300025914 Bacteria 825
106 Ga0207660_10000180 3300025917 Bacteria 40305
107 Ga0207660_10021578 3300025917 Unclassified 4332
108 Ga0207657_10000265 3300025919 Bacteria 55647
109 Ga0207657_10000502 3300025919 Bacteria 41290
110 Ga0207657_10000603 3300025919 Bacteria 38198
111 Ga0207657_10014954 3300025919 Bacteria 7541
112 Ga0207652_10043437 3300025921 Unclassified 3827
113 Ga0207652_10108779 3300025921 Bacteria 2457
114 Ga0207652_10242404 3300025921 Bacteria 1625
115 Ga0207681_10412831 3300025923 Unclassified 1092
116 Ga0207694_10318518 3300025924 Bacteria 1283
117 Ga0207650_10087581 3300025925 Unclassified 2373
118 Ga0207687_10257629 3300025927 Unclassified 1389
119 Ga0207687_10468583 3300025927 Bacteria 1047
120 Ga0207644_10000001 3300025931 Bacteria 1243214
121 Ga0207690_10000552 3300025932 Bacteria 24439
122 Ga0207690_10750300 3300025932 Bacteria 805
123 Ga0207661_10234044 3300025944 Bacteria 1628
124 Ga0207667_10008910 3300025949 Bacteria 11872
125 Ga0207667_10018312 3300025949 Bacteria 7859
126 Ga0207667_10038428 3300025949 Bacteria 5112
127 Ga0207667_10294858 3300025949 Bacteria 1657
128 Ga0207640_10024128 3300025981 Bacteria 3665
129 Ga0207658_10000003 3300025986 Bacteria 1151934
130 Ga0207639_10151993 3300026041 Bacteria 1940
131 Ga0207702_10000001 3300026078 Bacteria 895738
132 Ga0207702_10257443 3300026078 Bacteria 1642
133 Ga0207674_10000021 3300026116 Bacteria 161986
134 Ga0207674_10167579 3300026116 Bacteria 2150
135 Ga0209813_10000440 3300027866 Bacteria 10134
136 Ga0268264_10003214 3300028381 Bacteria 14152
137 Ga0265338_10021127 3300028800 Bacteria 6804
138 Ga0265338_10343424 3300028800 Bacteria 1075
139 Ga0316179_1048564 3300030734 Bacteria 13048
140 Ga0316178_1082866 3300030735 Unclassified 991
141 Ga0316183_1006863 3300030742 Unclassified 3353
142 Ga0316183_1054186 3300030742 Bacteria 1142
143 Ga0316183_1123146 3300030742 Bacteria 2047
144 Ga0316183_1150685 3300030742 Bacteria 7880
145 Ga0316181_1162944 3300030744 Bacteria 39585
146 Ga0265316_10217206 3300031344 Bacteria 1412
147 Ga0307406_10000001 3300031901 Bacteria 638191
148 Ga0307406_10000281 3300031901 Bacteria 29975
149 Ga0307409_102060135 3300031995 Unclassified 600
150 Ga0307414_11589146 3300032004 Unclassified 609
151 Ga0373950_0163586 3300034818 Unclassified 515
152 Ga0373925_1084004 3300037068 Bacteria 659
153 Ga0395899_0069622 3300037312 Bacteria 2576
154 Ga0395899_0075942 3300037312 Bacteria 2453
155 Ga0395899_0312277 3300037312 Unclassified 1061
156 Ga0395899_0316873 3300037312 Bacteria 1052
157 Ga0395899_0866062 3300037312 Unclassified 553
158 Ga0395900_0004170 3300037418 Bacteria 15374
159 Ga0395900_0011562 3300037418 Bacteria 9033
160 Ga0395900_0025398 3300037418 Bacteria 6065
161 Ga0395900_0164660 3300037418 Bacteria 2260
162 Ga0395900_0515004 3300037418 Bacteria 1145
163 Ga0395900_0920955 3300037418 Unclassified 797
164 Ga0395900_1083068 3300037418 Unclassified 719
165 Ga0395898_0001455 3300037466 Bacteria 33509
166 Ga0395898_0010044 3300037466 Bacteria 9910
167 Ga0395898_0346486 3300037466 Unclassified 1417
168 Ga0395898_1799586 3300037466 Bacteria 534
169 Ga0395905_0010499 3300037471 Bacteria 9006
170 Ga0395905_0157064 3300037471 Bacteria 2139
171 Ga0395905_0248655 3300037471 Bacteria 1661
172 Ga0395905_1417798 3300037471 Bacteria 599
173 Ga0395901_0003594 3300038443 Bacteria 15639
174 Ga0395901_0011968 3300038443 Bacteria 8799
175 Ga0395901_0024680 3300038443 Bacteria 6173
176 Ga0395901_0078330 3300038443 Bacteria 3451
177 Ga0395901_0126111 3300038443 Unclassified 2690
178 Ga0439436_0073878 3300041404 Bacteria 950
179 Ga0439438_009675 3300041405 Bacteria 3105
180 Ga0439461_0003353 3300041410 Bacteria 2630
181 Ga0439431_0008632 3300041997 Bacteria 2294
182 Ga0450919_014788 3300042121 Bacteria 882
183 Ga0439446_0000002 3300042156 Bacteria 177065
184 Ga0439446_0005853 3300042156 Bacteria 3178
185 Ga0439434_0003977 3300042435 Bacteria 4314
186 Ga0439434_0031591 3300042435 Unclassified 1610
187 Ga0439434_0098584 3300042435 Bacteria 940
188 Ga0450918_002453 3300042531 Bacteria 3509
189 Ga0450918_020689 3300042531 Bacteria 1150
190 Ga0466972_0016700 3300044658 Bacteria 3670
191 Ga0466965_0003671 3300044683 Bacteria 6772
192 Ga0466970_0249706 3300044765 Unclassified 994
193 Ga0495638_0000285 3300046460 Bacteria 67536
194 Ga0495597_0008511 3300046542 Bacteria 5138
195 Ga0495588_0398675 3300046674 Bacteria 722
196 Ga0495670_0034907 3300046691 Bacteria 2506
197 Ga0495671_0036783 3300046692 Bacteria 2479
198 Ga0495660_0000005 3300046810 Bacteria 574567
199 Ga0495672_0000323 3300047320 Bacteria 63547
200 Ga0495686_0030315 3300047472 Bacteria 3513
201 Ga0495615_0179826 3300048090 Bacteria 644
202 Ga0496100_0044822 3300048903 Unclassified 2835
203 Ga0496114_1398144 3300048917 Bacteria 587
204 Ga0496124_0022468 3300048927 Bacteria 5780
205 Ga0496125_0153812 3300048928 Bacteria 1575
206 Ga0501031_0000661 3300049568 Bacteria 20447
207 Ga0501032_0003842 3300049569 Bacteria 11410
208 Ga0501034_0005701 3300049571 Bacteria 13537
209 Ga0501034_0053968 3300049571 Bacteria 4046
210 Ga0501034_1139013 3300049571 Unclassified 660
211 Ga0501036_0000950 3300049572 Bacteria 21798
212 Ga0501037_0000215 3300049573 Bacteria 50987
213 Ga0501038_0000201 3300049574 Bacteria 51285
214 Ga0501039_0030812 3300049575 Bacteria 4136
215 Ga0501042_0033160 3300049578 Bacteria 3660
216 Ga0501043_0000501 3300049579 Bacteria 35168
217 Ga0501046_0000085 3300049580 Bacteria 100298
218 Ga0501047_0002969 3300049581 Bacteria 16081
219 Ga0501048_0000002 3300049582 Bacteria 108048
220 Ga0501069_0045327 3300049585 Bacteria 2436
221 Ga0501070_0167530 3300049586 Bacteria 1810
222 Ga0501070_0500578 3300049586 Bacteria 976
223 Ga0501073_0040040 3300049589 Bacteria 3319
224 Ga0501080_0354725 3300049742 Bacteria 1324
225 Ga0501083_0002883 3300049744 Bacteria 11891
226 Ga0501083_0115506 3300049744 Bacteria 1762
227 Ga0501035_0038375 3300049822 Bacteria 4336
228 Ga0501035_0326202 3300049822 Unclassified 1289
229 Ga0501044_0039853 3300049823 Bacteria 4898
230 Ga0501044_0548138 3300049823 Bacteria 1054
231 nmdc:mga03683_20910_c2 3300050489 Bacteria 2063
232 nmdc:mga00v17_676_c1 3300050491 Bacteria 18744
233 nmdc:mga0yw44_1175122_c1 3300050492 Unclassified 518
234 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
235 nmdc:mga0yw44_3609_c2 3300050492 Bacteria 2538
236 nmdc:mga0yw44_637_c1 3300050492 Bacteria 12759
237 nmdc:mga0yw44_86329_c1 3300050492 Bacteria 1976
238 nmdc:mga0k408_407593_c1 3300050493 Bacteria 809
239 nmdc:mga06z11_14513_c1 3300050494 Bacteria 3492
240 nmdc:mga04h51_293_c1 3300050495 Bacteria 12807
241 nmdc:mga07m45_274912_c1 3300050496 Bacteria 980
242 nmdc:mga07m45_35809_c1 3300050496 Bacteria 2762
243 nmdc:mga0sz30_2689_c1 3300050516 Bacteria 6335
244 Ga0500643_000274 3300053087 Bacteria 44987
245 Ga0500646_0000002 3300053090 Bacteria 178770
246 Ga0500583_0000194 3300053092 Bacteria 23356
247 Ga0500583_0002928 3300053092 Bacteria 5256
248 Ga0500583_0026090 3300053092 Bacteria 2505
249 Ga0500651_0006352 3300053093 Bacteria 6806
250 Ga0500641_0000001 3300053096 Bacteria 1115973
251 Ga0500555_000023 3300053103 Bacteria 150521
252 Ga0500555_119438 3300053103 Bacteria 659
253 Ga0500569_000009 3300053109 Bacteria 67536
254 Ga0500652_000001 3300053131 Bacteria 946868
255 Ga0500655_000267 3300053133 Bacteria 12197
256 Ga0500568_0045359 3300053139 Unclassified 1749
257 Ga0500568_0068830 3300053139 Bacteria 1358
258 Ga0500588_0000169 3300053146 Bacteria 8819
259 Ga0500589_034940 3300053147 Bacteria 2347
260 Ga0500620_000597 3300053155 Bacteria 6203
261 Ga0500570_000001 3300053724 Bacteria 243552
262 Ga0500611_000449 3300053727 Bacteria 4195
263 Ga0501082_0009033 3300060353 Bacteria 8596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1417798 Ga0395905_1417798_214_567 117
2 3300006028 Ga0070717_10742677 Ga0070717_107426772 123
3 3300026116 Ga0207674_10167579 Ga0207674_101675792 128
4 3300005331 Ga0070670_100922363 Ga0070670_1009223632 129
5 3300005355 Ga0070671_100000001 Ga0070671_1000000011176 129
6 3300009098 Ga0105245_10289896 Ga0105245_102898962 129
7 3300013104 Ga0157370_10777400 Ga0157370_107774002 129
8 3300025923 Ga0207681_10412831 Ga0207681_104128312 129
9 3300025927 Ga0207687_10257629 Ga0207687_102576292 129
10 3300025931 Ga0207644_10000001 Ga0207644_10000001260 129
11 3300044765 Ga0466970_0249706 Ga0466970_0249706_29_418 129
12 2162886012 MBSR1b_contig_6338588 MBSR1b_0676.00000980 130
13 3300001904 JGI24736J21556_1016979 JGI24736J21556_10169791 130
14 3300001989 JGI24739J22299_10028872 JGI24739J22299_100288722 130
15 3300005327 Ga0070658_10000366 Ga0070658_1000036633 130
16 3300005327 Ga0070658_10000737 Ga0070658_100007379 130
17 3300005327 Ga0070658_10013613 Ga0070658_100136136 130
18 3300005327 Ga0070658_10146287 Ga0070658_101462871 130
19 3300005327 Ga0070658_10758441 Ga0070658_107584412 130
20 3300005327 Ga0070658_10820846 Ga0070658_108208461 130
21 3300005329 Ga0070683_100093226 Ga0070683_1000932263 130
22 3300005331 Ga0070670_100043573 Ga0070670_1000435733 130
23 3300005331 Ga0070670_100110786 Ga0070670_1001107864 130
24 3300005336 Ga0070680_100031051 Ga0070680_1000310512 130
25 3300005336 Ga0070680_100273858 Ga0070680_1002738581 130
26 3300005337 Ga0070682_100302178 Ga0070682_1003021782 130
27 3300005339 Ga0070660_100000180 Ga0070660_10000018031 130
28 3300005339 Ga0070660_100000721 Ga0070660_1000007215 130
29 3300005339 Ga0070660_100007696 Ga0070660_1000076968 130
30 3300005339 Ga0070660_100207934 Ga0070660_1002079343 130
31 3300005341 Ga0070691_10001845 Ga0070691_100018453 130
32 3300005366 Ga0070659_100000131 Ga0070659_10000013146 130
33 3300005366 Ga0070659_100137283 Ga0070659_1001372833 130
34 3300005367 Ga0070667_100000001 Ga0070667_100000001134 130
35 3300005435 Ga0070714_101338857 Ga0070714_1013388572 130
36 3300005458 Ga0070681_10009681 Ga0070681_100096814 130
37 3300005458 Ga0070681_10122061 Ga0070681_101220614 130
38 3300005458 Ga0070681_10176121 Ga0070681_101761212 130
39 3300005518 Ga0070699_100859629 Ga0070699_1008596291 130
40 3300005530 Ga0070679_100002974 Ga0070679_1000029745 130
41 3300005530 Ga0070679_100044713 Ga0070679_1000447133 130
42 3300005535 Ga0070684_100053121 Ga0070684_1000531212 130
43 3300005563 Ga0068855_100000324 Ga0068855_10000032456 130
44 3300005563 Ga0068855_100006818 Ga0068855_10000681818 130
45 3300005577 Ga0068857_100000001 Ga0068857_100000001120 130
46 3300005577 Ga0068857_100070060 Ga0068857_1000700605 130
47 3300005577 Ga0068857_100104209 Ga0068857_1001042092 130
48 3300005577 Ga0068857_100804119 Ga0068857_1008041191 130
49 3300005578 Ga0068854_100032492 Ga0068854_1000324924 130
50 3300005614 Ga0068856_100000002 Ga0068856_100000002257 130
51 3300005614 Ga0068856_100156229 Ga0068856_1001562293 130
52 3300005843 Ga0068860_100006258 Ga0068860_10000625810 130
53 3300005937 Ga0081455_10000020 Ga0081455_1000002093 130
54 3300005985 Ga0081539_10061792 Ga0081539_100617922 130
55 3300006038 Ga0075365_10001941 Ga0075365_100019418 130
56 3300006038 Ga0075365_10006489 Ga0075365_100064894 130
57 3300006038 Ga0075365_10009623 Ga0075365_100096235 130
58 3300006038 Ga0075365_10238660 Ga0075365_102386603 130
59 3300006038 Ga0075365_11266821 Ga0075365_112668211 130
60 3300006042 Ga0075368_10000136 Ga0075368_1000013622 130
61 3300006051 Ga0075364_10004001 Ga0075364_100040011 130
62 3300006051 Ga0075364_10082972 Ga0075364_100829725 130
63 3300006177 Ga0075362_10135744 Ga0075362_101357444 130
64 3300006177 Ga0075362_10678494 Ga0075362_106784942 130
65 3300006178 Ga0075367_10000135 Ga0075367_1000013514 130
66 3300006186 Ga0075369_10000062 Ga0075369_1000006226 130
67 3300006195 Ga0075366_10433724 Ga0075366_104337242 130
68 3300006195 Ga0075366_10497024 Ga0075366_104970241 130
69 3300006353 Ga0075370_10003033 Ga0075370_100030332 130
70 3300009093 Ga0105240_10000030 Ga0105240_10000030250 130
71 3300009093 Ga0105240_10425978 Ga0105240_104259783 130
72 3300009098 Ga0105245_10788177 Ga0105245_107881772 130
73 3300009101 Ga0105247_10482321 Ga0105247_104823212 130
74 3300009174 Ga0105241_10150545 Ga0105241_101505452 130
75 3300009174 Ga0105241_10931391 Ga0105241_109313911 130
76 3300009177 Ga0105248_10724450 Ga0105248_107244502 130
77 3300009545 Ga0105237_10000001 Ga0105237_10000001125 130
78 3300009551 Ga0105238_10026134 Ga0105238_100261343 130
79 3300009551 Ga0105238_10072781 Ga0105238_100727814 130
80 3300009551 Ga0105238_10119990 Ga0105238_101199904 130
81 3300009551 Ga0105238_10528486 Ga0105238_105284863 130
82 3300009979 Ga0105032_100010 Ga0105032_10001048 130
83 3300010375 Ga0105239_11342391 Ga0105239_113423911 130
84 3300013100 Ga0157373_10247451 Ga0157373_102474513 130
85 3300013100 Ga0157373_11151020 Ga0157373_111510202 130
86 3300013102 Ga0157371_10009914 Ga0157371_100099147 130
87 3300013102 Ga0157371_10065123 Ga0157371_100651233 130
88 3300013102 Ga0157371_11015267 Ga0157371_110152672 130
89 3300013104 Ga0157370_10001312 Ga0157370_1000131216 130
90 3300013104 Ga0157370_10487144 Ga0157370_104871442 130
91 3300013105 Ga0157369_10000003 Ga0157369_10000003109 130
92 3300013105 Ga0157369_12622332 Ga0157369_126223321 130
93 3300013296 Ga0157374_10249860 Ga0157374_102498604 130
94 3300013307 Ga0157372_10000007 Ga0157372_10000007125 130
95 3300013307 Ga0157372_10000027 Ga0157372_10000027178 130
96 3300013307 Ga0157372_10023867 Ga0157372_100238673 130
97 3300013307 Ga0157372_10177542 Ga0157372_101775422 130
98 3300013307 Ga0157372_10288085 Ga0157372_102880852 130
99 3300025900 Ga0207710_10370911 Ga0207710_103709112 130
100 3300025904 Ga0207647_10004673 Ga0207647_1000467313 130
101 3300025909 Ga0207705_10000019 Ga0207705_10000019210 130
102 3300025909 Ga0207705_10003855 Ga0207705_100038556 130
103 3300025909 Ga0207705_10020953 Ga0207705_100209534 130
104 3300025909 Ga0207705_10269410 Ga0207705_102694102 130
105 3300025911 Ga0207654_10162379 Ga0207654_101623793 130
106 3300025911 Ga0207654_10325677 Ga0207654_103256772 130
107 3300025912 Ga0207707_10031112 Ga0207707_100311123 130
108 3300025912 Ga0207707_10633729 Ga0207707_106337292 130
109 3300025913 Ga0207695_10000009 Ga0207695_10000009126 130
110 3300025914 Ga0207671_10000003 Ga0207671_10000003126 130
111 3300025914 Ga0207671_10670204 Ga0207671_106702042 130
112 3300025917 Ga0207660_10000180 Ga0207660_100001804 130
113 3300025917 Ga0207660_10021578 Ga0207660_100215782 130
114 3300025919 Ga0207657_10000265 Ga0207657_1000026524 130
115 3300025919 Ga0207657_10000502 Ga0207657_100005025 130
116 3300025919 Ga0207657_10000603 Ga0207657_1000060320 130
117 3300025919 Ga0207657_10014954 Ga0207657_100149548 130
118 3300025921 Ga0207652_10043437 Ga0207652_100434372 130
119 3300025921 Ga0207652_10108779 Ga0207652_101087793 130
120 3300025921 Ga0207652_10242404 Ga0207652_102424042 130
121 3300025924 Ga0207694_10318518 Ga0207694_103185181 130
122 3300025925 Ga0207650_10087581 Ga0207650_100875812 130
123 3300025927 Ga0207687_10468583 Ga0207687_104685832 130
124 3300025932 Ga0207690_10000552 Ga0207690_100005529 130
125 3300025932 Ga0207690_10750300 Ga0207690_107503001 130
126 3300025944 Ga0207661_10234044 Ga0207661_102340442 130
127 3300025949 Ga0207667_10008910 Ga0207667_100089108 130
128 3300025949 Ga0207667_10018312 Ga0207667_100183126 130
129 3300025949 Ga0207667_10038428 Ga0207667_100384282 130
130 3300025949 Ga0207667_10294858 Ga0207667_102948583 130
131 3300025981 Ga0207640_10024128 Ga0207640_100241286 130
132 3300025986 Ga0207658_10000003 Ga0207658_1000000328 130
133 3300026041 Ga0207639_10151993 Ga0207639_101519933 130
134 3300026078 Ga0207702_10000001 Ga0207702_10000001175 130
135 3300026078 Ga0207702_10257443 Ga0207702_102574433 130
136 3300026116 Ga0207674_10000021 Ga0207674_10000021117 130
137 3300027866 Ga0209813_10000440 Ga0209813_1000044020 130
138 3300028381 Ga0268264_10003214 Ga0268264_100032142 130
139 3300028800 Ga0265338_10021127 Ga0265338_100211275 130
140 3300028800 Ga0265338_10343424 Ga0265338_103434242 130
141 3300030734 Ga0316179_1048564 Ga0316179_104856412 130
142 3300030735 Ga0316178_1082866 Ga0316178_10828662 130
143 3300030742 Ga0316183_1006863 Ga0316183_10068635 130
144 3300030742 Ga0316183_1054186 Ga0316183_10541863 130
145 3300030742 Ga0316183_1123146 Ga0316183_11231463 130
146 3300030742 Ga0316183_1150685 Ga0316183_11506857 130
147 3300030744 Ga0316181_1162944 Ga0316181_11629447 130
148 3300031344 Ga0265316_10217206 Ga0265316_102172062 130
149 3300031901 Ga0307406_10000001 Ga0307406_10000001572 130
150 3300031901 Ga0307406_10000281 Ga0307406_100002818 130
151 3300031995 Ga0307409_102060135 Ga0307409_1020601351 130
152 3300032004 Ga0307414_11589146 Ga0307414_115891462 130
153 3300034818 Ga0373950_0163586 Ga0373950_0163586_102_494 130
154 3300037068 Ga0373925_1084004 Ga0373925_1084004_71_463 130
155 3300037312 Ga0395899_0069622 Ga0395899_0069622_1256_1648 130
156 3300037312 Ga0395899_0075942 Ga0395899_0075942_1003_1395 130
157 3300037312 Ga0395899_0312277 Ga0395899_0312277_599_1003 130
158 3300037312 Ga0395899_0316873 Ga0395899_0316873_311_703 130
159 3300037312 Ga0395899_0866062 Ga0395899_0866062_25_429 130
160 3300037418 Ga0395900_0004170 Ga0395900_0004170_12133_12525 130
161 3300037418 Ga0395900_0011562 Ga0395900_0011562_5230_5631 130
162 3300037418 Ga0395900_0025398 Ga0395900_0025398_3822_4226 130
163 3300037418 Ga0395900_0164660 Ga0395900_0164660_48_440 130
164 3300037418 Ga0395900_0515004 Ga0395900_0515004_270_665 130
165 3300037418 Ga0395900_0920955 Ga0395900_0920955_282_686 130
166 3300037418 Ga0395900_1083068 Ga0395900_1083068_198_590 130
167 3300037466 Ga0395898_0001455 Ga0395898_0001455_21493_21885 130
168 3300037466 Ga0395898_0010044 Ga0395898_0010044_9103_9495 130
169 3300037466 Ga0395898_0346486 Ga0395898_0346486_68_472 130
170 3300037466 Ga0395898_1799586 Ga0395898_1799586_104_496 130
171 3300037471 Ga0395905_0010499 Ga0395905_0010499_1572_1964 130
172 3300037471 Ga0395905_0157064 Ga0395905_0157064_498_899 130
173 3300037471 Ga0395905_0248655 Ga0395905_0248655_897_1289 130
174 3300038443 Ga0395901_0003594 Ga0395901_0003594_14237_14641 130
175 3300038443 Ga0395901_0011968 Ga0395901_0011968_4948_5340 130
176 3300038443 Ga0395901_0024680 Ga0395901_0024680_1302_1694 130
177 3300038443 Ga0395901_0078330 Ga0395901_0078330_678_1082 130
178 3300038443 Ga0395901_0126111 Ga0395901_0126111_597_998 130
179 3300041404 Ga0439436_0073878 Ga0439436_0073878_495_887 130
180 3300041405 Ga0439438_009675 Ga0439438_009675_679_1071 130
181 3300041410 Ga0439461_0003353 Ga0439461_0003353_1607_1999 130
182 3300041997 Ga0439431_0008632 Ga0439431_0008632_1186_1578 130
183 3300042121 Ga0450919_014788 Ga0450919_014788_359_751 130
184 3300042156 Ga0439446_0000002 Ga0439446_0000002_124718_125110 130
185 3300042156 Ga0439446_0005853 Ga0439446_0005853_2156_2548 130
186 3300042435 Ga0439434_0003977 Ga0439434_0003977_1933_2325 130
187 3300042435 Ga0439434_0031591 Ga0439434_0031591_1150_1542 130
188 3300042435 Ga0439434_0098584 Ga0439434_0098584_83_475 130
189 3300042531 Ga0450918_002453 Ga0450918_002453_862_1254 130
190 3300042531 Ga0450918_020689 Ga0450918_020689_95_487 130
191 3300044658 Ga0466972_0016700 Ga0466972_0016700_187_582 130
192 3300044683 Ga0466965_0003671 Ga0466965_0003671_1706_2101 130
193 3300046460 Ga0495638_0000285 Ga0495638_0000285_28493_28885 130
194 3300046542 Ga0495597_0008511 Ga0495597_0008511_33_425 130
195 3300046674 Ga0495588_0398675 Ga0495588_0398675_133_525 130
196 3300046691 Ga0495670_0034907 Ga0495670_0034907_1105_1503 130
197 3300046692 Ga0495671_0036783 Ga0495671_0036783_1416_1808 130
198 3300046810 Ga0495660_0000005 Ga0495660_0000005_544766_545161 130
199 3300047320 Ga0495672_0000323 Ga0495672_0000323_48951_49346 130
200 3300047472 Ga0495686_0030315 Ga0495686_0030315_719_1111 130
201 3300048090 Ga0495615_0179826 Ga0495615_0179826_31_426 130
202 3300048903 Ga0496100_0044822 Ga0496100_0044822_1539_1934 130
203 3300048917 Ga0496114_1398144 Ga0496114_1398144_66_458 130
204 3300048927 Ga0496124_0022468 Ga0496124_0022468_145_540 130
205 3300048928 Ga0496125_0153812 Ga0496125_0153812_553_954 130
206 3300049568 Ga0501031_0000661 Ga0501031_0000661_95_487 130
207 3300049569 Ga0501032_0003842 Ga0501032_0003842_4303_4695 130
208 3300049571 Ga0501034_0005701 Ga0501034_0005701_8618_9013 130
209 3300049571 Ga0501034_0053968 Ga0501034_0053968_2052_2444 130
210 3300049571 Ga0501034_1139013 Ga0501034_1139013_213_608 130
211 3300049572 Ga0501036_0000950 Ga0501036_0000950_17044_17436 130
212 3300049573 Ga0501037_0000215 Ga0501037_0000215_21583_21975 130
213 3300049574 Ga0501038_0000201 Ga0501038_0000201_29185_29577 130
214 3300049575 Ga0501039_0030812 Ga0501039_0030812_2800_3192 130
215 3300049578 Ga0501042_0033160 Ga0501042_0033160_1271_1663 130
216 3300049579 Ga0501043_0000501 Ga0501043_0000501_13028_13420 130
217 3300049580 Ga0501046_0000085 Ga0501046_0000085_21457_21849 130
218 3300049581 Ga0501047_0002969 Ga0501047_0002969_12477_12869 130
219 3300049582 Ga0501048_0000002 Ga0501048_0000002_29373_29765 130
220 3300049585 Ga0501069_0045327 Ga0501069_0045327_75_467 130
221 3300049586 Ga0501070_0167530 Ga0501070_0167530_1363_1755 130
222 3300049586 Ga0501070_0500578 Ga0501070_0500578_22_414 130
223 3300049589 Ga0501073_0040040 Ga0501073_0040040_1232_1624 130
224 3300049742 Ga0501080_0354725 Ga0501080_0354725_398_790 130
225 3300049744 Ga0501083_0002883 Ga0501083_0002883_9782_10174 130
226 3300049744 Ga0501083_0115506 Ga0501083_0115506_64_456 130
227 3300049822 Ga0501035_0038375 Ga0501035_0038375_1878_2270 130
228 3300049822 Ga0501035_0326202 Ga0501035_0326202_618_1022 130
229 3300049823 Ga0501044_0039853 Ga0501044_0039853_162_554 130
230 3300049823 Ga0501044_0548138 Ga0501044_0548138_85_489 130
231 3300050489 nmdc:mga03683_20910_c2 nmdc:mga03683_20910_c2_1032_1424 130
232 3300050491 nmdc:mga00v17_676_c1 nmdc:mga00v17_676_c1_12549_12941 130
233 3300050492 nmdc:mga0yw44_1175122_c1 nmdc:mga0yw44_1175122_c1_84_476 130
234 3300050492 nmdc:mga0yw44_11_c1 nmdc:mga0yw44_11_c1_36029_36421 130
235 3300050492 nmdc:mga0yw44_3609_c2 nmdc:mga0yw44_3609_c2_245_643 130
236 3300050492 nmdc:mga0yw44_637_c1 nmdc:mga0yw44_637_c1_9528_9920 130
237 3300050492 nmdc:mga0yw44_86329_c1 nmdc:mga0yw44_86329_c1_1114_1506 130
238 3300050493 nmdc:mga0k408_407593_c1 nmdc:mga0k408_407593_c1_296_688 130
239 3300050494 nmdc:mga06z11_14513_c1 nmdc:mga06z11_14513_c1_2152_2544 130
240 3300050495 nmdc:mga04h51_293_c1 nmdc:mga04h51_293_c1_11467_11859 130
241 3300050496 nmdc:mga07m45_274912_c1 nmdc:mga07m45_274912_c1_128_520 130
242 3300050496 nmdc:mga07m45_35809_c1 nmdc:mga07m45_35809_c1_311_703 130
243 3300050516 nmdc:mga0sz30_2689_c1 nmdc:mga0sz30_2689_c1_5682_6074 130
244 3300053087 Ga0500643_000274 Ga0500643_000274_40471_40869 130
245 3300053090 Ga0500646_0000002 Ga0500646_0000002_22026_22418 130
246 3300053092 Ga0500583_0000194 Ga0500583_0000194_3704_4096 130
247 3300053092 Ga0500583_0002928 Ga0500583_0002928_89_487 130
248 3300053092 Ga0500583_0026090 Ga0500583_0026090_959_1351 130
249 3300053093 Ga0500651_0006352 Ga0500651_0006352_6274_6678 130
250 3300053096 Ga0500641_0000001 Ga0500641_0000001_778119_778511 130
251 3300053103 Ga0500555_000023 Ga0500555_000023_124026_124418 130
252 3300053103 Ga0500555_119438 Ga0500555_119438_14_406 130
253 3300053109 Ga0500569_000009 Ga0500569_000009_28493_28885 130
254 3300053131 Ga0500652_000001 Ga0500652_000001_702919_703311 130
255 3300053133 Ga0500655_000267 Ga0500655_000267_462_857 130
256 3300053139 Ga0500568_0045359 Ga0500568_0045359_682_1074 130
257 3300053139 Ga0500568_0068830 Ga0500568_0068830_320_712 130
258 3300053146 Ga0500588_0000169 Ga0500588_0000169_1631_2023 130
259 3300053147 Ga0500589_034940 Ga0500589_034940_775_1173 130
260 3300053155 Ga0500620_000597 Ga0500620_000597_4426_4818 130
261 3300053724 Ga0500570_000001 Ga0500570_000001_104630_105028 130
262 3300053727 Ga0500611_000449 Ga0500611_000449_474_872 130
263 3300060353 Ga0501082_0009033 Ga0501082_0009033_7072_7464 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

23

115

0.94

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

15

121

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.9193 5 128
7mqw-assembly1.cif.gz_B histidine triad protein 0.9071 5 128
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8876 3 128
4zgl-assembly2.cif.gz_D hit like protein 0.8838 3 100
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8786 3 128
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9487 17 102 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9413 3 128 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9285 17 103 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9265 2 108 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8999 3 128 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7K3IZR3-F1-model_v4 HIT domain-containing protein 0.9803 2 99 GO:0003824
GO:0009117
AF-A0A524NA58-F1-model_v4 HIT family protein 0.9798 2 107 GO:0003824
GO:0009117
AF-A0A3C7Z8K0-F1-model_v4 HIT family protein 0.9789 1 130 GO:0003824
GO:0009117
AF-A0A660MA87-F1-model_v4 HIT domain-containing protein 0.9779 1 104 GO:0003824
GO:0009117
AF-A0A3D3HB08-F1-model_v4 HIT family protein 0.9766 1 130 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
93.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map