F371598

General Info

Members Datasets Scaffolds Average Seq Length
263 150 526 320

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100015179|Ga0070683_1000151792
Length 344
Sequence VSYGRPSSVPDPSIVNDPHLKAHAVMALLRRRWREFLEFLFPPETDRWLAVFRIGMGLQVLGYTLFLRSDWHHLFATAGKGLVGRELGEAIASFDSPLIPKLGWLVAIGQHVGLGEETVLSIAWACLLCFLGLFCRLAAIIAWFLHLCAAESGGLLAYGADNFMTMALFYLMLSPLPDQYSLDCRLFQAKPMDQKLLGFWRRVLQIHLCFVYFFGGLAKFLGSGWWDGSNLWRSLIRPPFNLISPDILVRFKYALPILGLSICLIEIGYPVFIWMKKTRFLWLVCISAMHAAIGLMMGMYLFALVMIVLNLAAFGVGIGLPFIRRPAAGTRHPRGLFSSSNSPP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.08
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 19.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100015179 3300005329 Bacteria 6761
2 JGI25404J52841_10001465 3300003659 Bacteria 4157
3 JGI25404J52841_10028772 3300003659 Unclassified 1192
4 JGI25405J52794_10000244 3300003911 Bacteria 7196
5 Ga0065704_10007069 3300005289 Bacteria 4863
6 Ga0065704_10014937 3300005289 Unclassified 2101
7 Ga0065704_10106911 3300005289 Unclassified 2070
8 Ga0065712_10001861 3300005290 Bacteria 5369
9 Ga0065715_10002013 3300005293 Bacteria 5284
10 Ga0065715_10151579 3300005293 Unclassified 1720
11 Ga0065715_10158206 3300005293 Bacteria 1655
12 Ga0065715_10177443 3300005293 Unclassified 1501
13 Ga0065707_10136565 3300005295 Unclassified 1827
14 Ga0070676_10035881 3300005328 Bacteria 2854
15 Ga0070683_100012750 3300005329 Bacteria 7310
16 Ga0070683_100023477 3300005329 Bacteria 5517
17 Ga0070670_100008273 3300005331 Bacteria 8856
18 Ga0070666_10002919 3300005335 Bacteria 10340
19 Ga0070666_10027723 3300005335 Bacteria 3712
20 Ga0070680_100019895 3300005336 Bacteria 5323
21 Ga0070682_100024034 3300005337 Bacteria 3623
22 Ga0068868_100316518 3300005338 Bacteria 1328
23 Ga0070660_100137121 3300005339 Bacteria 1961
24 Ga0070689_100004539 3300005340 Bacteria 9401
25 Ga0070687_100130045 3300005343 Bacteria 1452
26 Ga0070668_100251066 3300005347 Bacteria 1468
27 Ga0070668_100327312 3300005347 Unclassified 1291
28 Ga0070669_100050594 3300005353 Bacteria 3035
29 Ga0070669_100409213 3300005353 Unclassified 1111
30 Ga0070675_100006565 3300005354 Bacteria 8941
31 Ga0070675_100129359 3300005354 Bacteria 2150
32 Ga0070675_100241557 3300005354 Bacteria 1578
33 Ga0070671_100002952 3300005355 Bacteria 13221
34 Ga0070673_100013044 3300005364 Bacteria 5733
35 Ga0070673_100075241 3300005364 Bacteria 2723
36 Ga0070688_100081122 3300005365 Bacteria 2100
37 Ga0070659_100004847 3300005366 Bacteria 9613
38 Ga0070659_100096683 3300005366 Bacteria 2372
39 Ga0070667_100095841 3300005367 Bacteria 2559
40 Ga0070709_10141571 3300005434 Bacteria 1653
41 Ga0070714_100027599 3300005435 Bacteria 4703
42 Ga0070714_100051353 3300005435 Bacteria 3514
43 Ga0070714_100213370 3300005435 Bacteria 1770
44 Ga0070713_100033006 3300005436 Bacteria 4142
45 Ga0070713_100092124 3300005436 Unclassified 2609
46 Ga0070713_100313387 3300005436 Unclassified 1447
47 Ga0070710_10177588 3300005437 Bacteria 1331
48 Ga0070711_100042349 3300005439 Bacteria 3077
49 Ga0070700_100021347 3300005441 Bacteria 3763
50 Ga0070708_100021270 3300005445 Bacteria 5483
51 Ga0070708_100036432 3300005445 Bacteria 4291
52 Ga0070708_100078077 3300005445 Unclassified 2993
53 Ga0070708_100136340 3300005445 Bacteria 2274
54 Ga0070663_100003459 3300005455 Bacteria 9099
55 Ga0070678_100140643 3300005456 Bacteria 1931
56 Ga0070678_100209417 3300005456 Bacteria 1614
57 Ga0070662_100166387 3300005457 Bacteria 1728
58 Ga0070706_100002438 3300005467 Bacteria 18748
59 Ga0070706_100122117 3300005467 Bacteria 2428
60 Ga0070706_100240953 3300005467 Bacteria 1689
61 Ga0070706_100263823 3300005467 Bacteria 1607
62 Ga0070706_100390350 3300005467 Unclassified 1296
63 Ga0070707_100014579 3300005468 Bacteria 7371
64 Ga0070707_100046365 3300005468 Bacteria 4160
65 Ga0070707_100072664 3300005468 Bacteria 3315
66 Ga0070707_100083393 3300005468 Bacteria 3088
67 Ga0070707_100175143 3300005468 Bacteria 2091
68 Ga0070707_100266475 3300005468 Bacteria 1666
69 Ga0070698_100032787 3300005471 Bacteria 5379
70 Ga0070698_100046325 3300005471 Bacteria 4446
71 Ga0070699_100115689 3300005518 Unclassified 2357
72 Ga0070679_100013088 3300005530 Bacteria 7945
73 Ga0070684_100014126 3300005535 Bacteria 6457
74 Ga0070684_100025599 3300005535 Bacteria 4962
75 Ga0070684_100036701 3300005535 Unclassified 4200
76 Ga0070697_100014607 3300005536 Bacteria 6166
77 Ga0070697_100028683 3300005536 Bacteria 4458
78 Ga0070697_100156702 3300005536 Bacteria 1922
79 Ga0070672_100019143 3300005543 Bacteria 4964
80 Ga0070696_100081112 3300005546 Unclassified 2298
81 Ga0070665_100016263 3300005548 Bacteria 7463
82 Ga0070665_100045374 3300005548 Unclassified 4414
83 Ga0070665_100096963 3300005548 Unclassified 2953
84 Ga0070664_100025380 3300005564 Bacteria 4912
85 Ga0070664_100064220 3300005564 Bacteria 3131
86 Ga0070664_100207802 3300005564 Bacteria 1749
87 Ga0068859_100256063 3300005617 Bacteria 1841
88 Ga0068863_100009109 3300005841 Bacteria 9693
89 Ga0068860_100060620 3300005843 Bacteria 3596
90 Ga0081455_10001699 3300005937 Bacteria 26651
91 Ga0081455_10002301 3300005937 Bacteria 22758
92 Ga0081455_10003670 3300005937 Bacteria 17564
93 Ga0081455_10003939 3300005937 Bacteria 16880
94 Ga0081455_10017971 3300005937 Bacteria 6754
95 Ga0081455_10145263 3300005937 Unclassified 1836
96 Ga0081540_1000020 3300005983 Bacteria 163043
97 Ga0081540_1000340 3300005983 Bacteria 47909
98 Ga0081540_1020657 3300005983 Unclassified 3951
99 Ga0081539_10008706 3300005985 Bacteria 8723
100 Ga0070717_10023412 3300006028 Bacteria 4893
101 Ga0070717_10097972 3300006028 Bacteria 2485
102 Ga0070717_10161275 3300006028 Bacteria 1945
103 Ga0070715_10140255 3300006163 Bacteria 1173
104 Ga0070716_100080346 3300006173 Unclassified 1944
105 Ga0070712_100028906 3300006175 Bacteria 3712
106 Ga0070712_100093924 3300006175 Bacteria 2203
107 Ga0070712_100230528 3300006175 Unclassified 1470
108 Ga0097621_100056694 3300006237 Bacteria 3201
109 Ga0068871_100015148 3300006358 Bacteria 5765
110 Ga0075434_100063405 3300006871 Unclassified 3678
111 Ga0068865_100217462 3300006881 Bacteria 1492
112 Ga0068865_100326614 3300006881 Bacteria 1236
113 Ga0068865_100341719 3300006881 Unclassified 1210
114 Ga0097620_100256039 3300006931 Bacteria 1841
115 Ga0099794_10080888 3300007265 Bacteria 1602
116 Ga0111539_10455837 3300009094 Bacteria 1489
117 Ga0105247_10153965 3300009101 Unclassified 1517
118 Ga0114129_10418827 3300009147 Bacteria 1762
119 Ga0105237_10084736 3300009545 Bacteria 3159
120 Ga0105249_10007765 3300009553 Bacteria 9350
121 Ga0105249_10401876 3300009553 Unclassified 1400
122 Ga0099796_10003758 3300010159 Bacteria 3574
123 Ga0105239_10105999 3300010375 Bacteria 3113
124 Ga0105239_10354188 3300010375 Bacteria 1657
125 Ga0157370_10377127 3300013104 Bacteria 1307
126 Ga0157374_10004856 3300013296 Bacteria 11284
127 Ga0157374_10015538 3300013296 Bacteria 6677
128 Ga0157374_10045356 3300013296 Bacteria 4069
129 Ga0157374_10112069 3300013296 Bacteria 2625
130 Ga0157374_10182985 3300013296 Unclassified 2048
131 Ga0157378_10007023 3300013297 Bacteria 9827
132 Ga0157378_10022371 3300013297 Bacteria 5566
133 Ga0157378_10242095 3300013297 Unclassified 1723
134 Ga0163162_10024026 3300013306 Bacteria 6015
135 Ga0163162_10188538 3300013306 Bacteria 2189
136 Ga0157372_10004405 3300013307 Bacteria 15017
137 Ga0157375_10005883 3300013308 Bacteria 10682
138 Ga0157375_10008482 3300013308 Bacteria 9001
139 Ga0157375_10017729 3300013308 Bacteria 6436
140 Ga0157375_10026639 3300013308 Bacteria 5392
141 Ga0157375_10089261 3300013308 Bacteria 3138
142 Ga0163163_10007847 3300014325 Bacteria 9439
143 Ga0163163_10185425 3300014325 Bacteria 2128
144 Ga0182008_10190256 3300014497 Bacteria 1041
145 Ga0157377_10015729 3300014745 Bacteria 3878
146 Ga0157379_10004383 3300014968 Bacteria 12080
147 Ga0157376_10040806 3300014969 Bacteria 3795
148 Ga0157376_10052627 3300014969 Bacteria 3386
149 Ga0157376_10094462 3300014969 Bacteria 2598
150 Ga0163161_10042706 3300017792 Bacteria 3262
151 Ga0163161_10066385 3300017792 Bacteria 2634
152 Ga0207666_1004702 3300025271 Bacteria 1721
153 Ga0207697_10000605 3300025315 Bacteria 20437
154 Ga0207697_10003519 3300025315 Bacteria 7721
155 Ga0207697_10006936 3300025315 Bacteria 5079
156 Ga0207697_10007932 3300025315 Unclassified 4692
157 Ga0207697_10035115 3300025315 Unclassified 2052
158 Ga0207697_10065424 3300025315 Bacteria 1517
159 Ga0207692_10079358 3300025898 Bacteria 1751
160 Ga0207680_10005139 3300025903 Bacteria 6244
161 Ga0207685_10025593 3300025905 Bacteria 2039
162 Ga0207699_10106784 3300025906 Bacteria 1787
163 Ga0207645_10025115 3300025907 Bacteria 3858
164 Ga0207645_10159301 3300025907 Unclassified 1476
165 Ga0207684_10002497 3300025910 Bacteria 18498
166 Ga0207654_10297307 3300025911 Bacteria 1097
167 Ga0207695_10146823 3300025913 Unclassified 2302
168 Ga0207693_10019139 3300025915 Bacteria 5449
169 Ga0207693_10027511 3300025915 Bacteria 4495
170 Ga0207693_10060119 3300025915 Bacteria 2976
171 Ga0207693_10093201 3300025915 Bacteria 2361
172 Ga0207693_10129243 3300025915 Bacteria 1986
173 Ga0207660_10022977 3300025917 Bacteria 4207
174 Ga0207662_10007452 3300025918 Bacteria 5958
175 Ga0207662_10172537 3300025918 Bacteria 1387
176 Ga0207649_10076519 3300025920 Bacteria 2154
177 Ga0207646_10012756 3300025922 Bacteria 8061
178 Ga0207646_10047538 3300025922 Unclassified 3849
179 Ga0207646_10116447 3300025922 Unclassified 2400
180 Ga0207646_10153795 3300025922 Bacteria 2074
181 Ga0207646_10163102 3300025922 Bacteria 2012
182 Ga0207646_10169209 3300025922 Unclassified 1973
183 Ga0207681_10033603 3300025923 Bacteria 3364
184 Ga0207650_10049038 3300025925 Bacteria 3116
185 Ga0207659_10013501 3300025926 Bacteria 5234
186 Ga0207659_10178333 3300025926 Bacteria 1681
187 Ga0207659_10335143 3300025926 Unclassified 1252
188 Ga0207700_10002394 3300025928 Bacteria 10785
189 Ga0207700_10147206 3300025928 Unclassified 1942
190 Ga0207664_10045714 3300025929 Unclassified 3434
191 Ga0207664_10155637 3300025929 Unclassified 1945
192 Ga0207644_10008571 3300025931 Bacteria 6690
193 Ga0207644_10066796 3300025931 Bacteria 2619
194 Ga0207644_10069884 3300025931 Bacteria 2565
195 Ga0207690_10132460 3300025932 Bacteria 1826
196 Ga0207706_10005432 3300025933 Bacteria 11875
197 Ga0207686_10189235 3300025934 Bacteria 1466
198 Ga0207670_10007423 3300025936 Bacteria 6116
199 Ga0207670_10073236 3300025936 Bacteria 2375
200 Ga0207704_10184272 3300025938 Bacteria 1512
201 Ga0207665_10095411 3300025939 Bacteria 2067
202 Ga0207691_10041314 3300025940 Bacteria 4258
203 Ga0207661_10066744 3300025944 Unclassified 2923
204 Ga0207679_10099642 3300025945 Unclassified 2269
205 Ga0207679_10163779 3300025945 Bacteria 1823
206 Ga0207651_10031904 3300025960 Bacteria 3375
207 Ga0207651_10043625 3300025960 Bacteria 2995
208 Ga0207712_10004050 3300025961 Bacteria 9254
209 Ga0207668_10125258 3300025972 Bacteria 1952
210 Ga0207668_10600938 3300025972 Unclassified 958
211 Ga0207658_10059718 3300025986 Unclassified 2842
212 Ga0207658_10087858 3300025986 Unclassified 2401
213 Ga0207658_10198354 3300025986 Bacteria 1674
214 Ga0207677_10083539 3300026023 Bacteria 2299
215 Ga0207678_10001967 3300026067 Bacteria 18724
216 Ga0207676_10032818 3300026095 Bacteria 3917
217 Ga0207683_10013350 3300026121 Bacteria 7005
218 Ga0207683_10017110 3300026121 Bacteria 6171
219 Ga0207683_10033886 3300026121 Bacteria 4437
220 Ga0210002_1014939 3300027617 Unclassified 1221
221 Ga0209974_10003971 3300027876 Bacteria 5292
222 Ga0268266_10050021 3300028379 Unclassified 3585
223 Ga0268266_10067314 3300028379 Bacteria 3100
224 Ga0268266_10441093 3300028379 Bacteria 1236
225 Ga0268265_10361931 3300028380 Bacteria 1328
226 Ga0268264_10016767 3300028381 Bacteria 5994
227 Ga0373935_0145231 3300035692 Unclassified 1605
228 Ga0373935_0164233 3300035692 Unclassified 1515
229 Ga0373937_0132065 3300036401 Bacteria 2332
230 Ga0373925_0034989 3300037068 Unclassified 3704
231 Ga0395899_0074346 3300037312 Bacteria 2483
232 Ga0395900_0032821 3300037418 Bacteria 5340
233 Ga0395900_0071125 3300037418 Bacteria 3576
234 Ga0395898_0005651 3300037466 Bacteria 13480
235 Ga0395905_0006645 3300037471 Bacteria 11598
236 Ga0395901_0000532 3300038443 Bacteria 43915
237 Ga0439455_0001804 3300042012 Bacteria 3729
238 Ga0439458_0023504 3300042157 Bacteria 1438
239 Ga0466967_0352832 3300045976 Bacteria 1424
240 Ga0495630_0098062 3300046517 Unclassified 2217
241 Ga0495674_0047094 3300047319 Bacteria 3825
242 Ga0495680_0061042 3300047322 Bacteria 2902
243 Ga0496100_0042097 3300048903 Bacteria 2916
244 Ga0496102_0025816 3300048905 Bacteria 5233
245 Ga0496102_0064686 3300048905 Bacteria 3350
246 Ga0496106_0006323 3300048909 Bacteria 8773
247 Ga0496107_0002054 3300048910 Bacteria 12870
248 Ga0496109_0005261 3300048912 Bacteria 10808
249 Ga0496109_0137132 3300048912 Bacteria 2287
250 Ga0496109_0279422 3300048912 Bacteria 1574
251 Ga0496112_0031979 3300048915 Bacteria 5108
252 Ga0496112_0203183 3300048915 Bacteria 1940
253 Ga0496112_0261989 3300048915 Unclassified 1678
254 Ga0496112_0520777 3300048915 Bacteria 1124
255 Ga0496113_0024387 3300048916 Bacteria 4299
256 Ga0496114_0175211 3300048917 Bacteria 1871
257 Ga0496115_0008883 3300048918 Bacteria 7448
258 Ga0496115_0045794 3300048918 Bacteria 3493
259 nmdc:mga05p37_642296_c1 3300050507 Bacteria 1190
260 nmdc:mga05p37_9278_c1 3300050507 Bacteria 11634
261 nmdc:mga08y16_717282_c1 3300050511 Bacteria 998
262 nmdc:mga0n895_324198_c1 3300050512 Bacteria 1561
263 nmdc:mga0a205_294720_c1 3300050515 Bacteria 1496
264 Ga0070683_100015179
265 JGI25404J52841_10001465
266 JGI25404J52841_10028772
267 JGI25405J52794_10000244
268 Ga0065704_10007069
269 Ga0065704_10014937
270 Ga0065704_10106911
271 Ga0065712_10001861
272 Ga0065715_10002013
273 Ga0065715_10151579
274 Ga0065715_10158206
275 Ga0065715_10177443
276 Ga0065707_10136565
277 Ga0070676_10035881
278 Ga0070683_100012750
279 Ga0070683_100023477
280 Ga0070670_100008273
281 Ga0070666_10002919
282 Ga0070666_10027723
283 Ga0070680_100019895
284 Ga0070682_100024034
285 Ga0068868_100316518
286 Ga0070660_100137121
287 Ga0070689_100004539
288 Ga0070687_100130045
289 Ga0070668_100251066
290 Ga0070668_100327312
291 Ga0070669_100050594
292 Ga0070669_100409213
293 Ga0070675_100006565
294 Ga0070675_100129359
295 Ga0070675_100241557
296 Ga0070671_100002952
297 Ga0070673_100013044
298 Ga0070673_100075241
299 Ga0070688_100081122
300 Ga0070659_100004847
301 Ga0070659_100096683
302 Ga0070667_100095841
303 Ga0070709_10141571
304 Ga0070714_100027599
305 Ga0070714_100051353
306 Ga0070714_100213370
307 Ga0070713_100033006
308 Ga0070713_100092124
309 Ga0070713_100313387
310 Ga0070710_10177588
311 Ga0070711_100042349
312 Ga0070700_100021347
313 Ga0070708_100021270
314 Ga0070708_100036432
315 Ga0070708_100078077
316 Ga0070708_100136340
317 Ga0070663_100003459
318 Ga0070678_100140643
319 Ga0070678_100209417
320 Ga0070662_100166387
321 Ga0070706_100002438
322 Ga0070706_100122117
323 Ga0070706_100240953
324 Ga0070706_100263823
325 Ga0070706_100390350
326 Ga0070707_100014579
327 Ga0070707_100046365
328 Ga0070707_100072664
329 Ga0070707_100083393
330 Ga0070707_100175143
331 Ga0070707_100266475
332 Ga0070698_100032787
333 Ga0070698_100046325
334 Ga0070699_100115689
335 Ga0070679_100013088
336 Ga0070684_100014126
337 Ga0070684_100025599
338 Ga0070684_100036701
339 Ga0070697_100014607
340 Ga0070697_100028683
341 Ga0070697_100156702
342 Ga0070672_100019143
343 Ga0070696_100081112
344 Ga0070665_100016263
345 Ga0070665_100045374
346 Ga0070665_100096963
347 Ga0070664_100025380
348 Ga0070664_100064220
349 Ga0070664_100207802
350 Ga0068859_100256063
351 Ga0068863_100009109
352 Ga0068860_100060620
353 Ga0081455_10001699
354 Ga0081455_10002301
355 Ga0081455_10003670
356 Ga0081455_10003939
357 Ga0081455_10017971
358 Ga0081455_10145263
359 Ga0081540_1000020
360 Ga0081540_1000340
361 Ga0081540_1020657
362 Ga0081539_10008706
363 Ga0070717_10023412
364 Ga0070717_10097972
365 Ga0070717_10161275
366 Ga0070715_10140255
367 Ga0070716_100080346
368 Ga0070712_100028906
369 Ga0070712_100093924
370 Ga0070712_100230528
371 Ga0097621_100056694
372 Ga0068871_100015148
373 Ga0075434_100063405
374 Ga0068865_100217462
375 Ga0068865_100326614
376 Ga0068865_100341719
377 Ga0097620_100256039
378 Ga0099794_10080888
379 Ga0111539_10455837
380 Ga0105247_10153965
381 Ga0114129_10418827
382 Ga0105237_10084736
383 Ga0105249_10007765
384 Ga0105249_10401876
385 Ga0099796_10003758
386 Ga0105239_10105999
387 Ga0105239_10354188
388 Ga0157370_10377127
389 Ga0157374_10004856
390 Ga0157374_10015538
391 Ga0157374_10045356
392 Ga0157374_10112069
393 Ga0157374_10182985
394 Ga0157378_10007023
395 Ga0157378_10022371
396 Ga0157378_10242095
397 Ga0163162_10024026
398 Ga0163162_10188538
399 Ga0157372_10004405
400 Ga0157375_10005883
401 Ga0157375_10008482
402 Ga0157375_10017729
403 Ga0157375_10026639
404 Ga0157375_10089261
405 Ga0163163_10007847
406 Ga0163163_10185425
407 Ga0182008_10190256
408 Ga0157377_10015729
409 Ga0157379_10004383
410 Ga0157376_10040806
411 Ga0157376_10052627
412 Ga0157376_10094462
413 Ga0163161_10042706
414 Ga0163161_10066385
415 Ga0207666_1004702
416 Ga0207697_10000605
417 Ga0207697_10003519
418 Ga0207697_10006936
419 Ga0207697_10007932
420 Ga0207697_10035115
421 Ga0207697_10065424
422 Ga0207692_10079358
423 Ga0207680_10005139
424 Ga0207685_10025593
425 Ga0207699_10106784
426 Ga0207645_10025115
427 Ga0207645_10159301
428 Ga0207684_10002497
429 Ga0207654_10297307
430 Ga0207695_10146823
431 Ga0207693_10019139
432 Ga0207693_10027511
433 Ga0207693_10060119
434 Ga0207693_10093201
435 Ga0207693_10129243
436 Ga0207660_10022977
437 Ga0207662_10007452
438 Ga0207662_10172537
439 Ga0207649_10076519
440 Ga0207646_10012756
441 Ga0207646_10047538
442 Ga0207646_10116447
443 Ga0207646_10153795
444 Ga0207646_10163102
445 Ga0207646_10169209
446 Ga0207681_10033603
447 Ga0207650_10049038
448 Ga0207659_10013501
449 Ga0207659_10178333
450 Ga0207659_10335143
451 Ga0207700_10002394
452 Ga0207700_10147206
453 Ga0207664_10045714
454 Ga0207664_10155637
455 Ga0207644_10008571
456 Ga0207644_10066796
457 Ga0207644_10069884
458 Ga0207690_10132460
459 Ga0207706_10005432
460 Ga0207686_10189235
461 Ga0207670_10007423
462 Ga0207670_10073236
463 Ga0207704_10184272
464 Ga0207665_10095411
465 Ga0207691_10041314
466 Ga0207661_10066744
467 Ga0207679_10099642
468 Ga0207679_10163779
469 Ga0207651_10031904
470 Ga0207651_10043625
471 Ga0207712_10004050
472 Ga0207668_10125258
473 Ga0207668_10600938
474 Ga0207658_10059718
475 Ga0207658_10087858
476 Ga0207658_10198354
477 Ga0207677_10083539
478 Ga0207678_10001967
479 Ga0207676_10032818
480 Ga0207683_10013350
481 Ga0207683_10017110
482 Ga0207683_10033886
483 Ga0210002_1014939
484 Ga0209974_10003971
485 Ga0268266_10050021
486 Ga0268266_10067314
487 Ga0268266_10441093
488 Ga0268265_10361931
489 Ga0268264_10016767
490 Ga0373935_0145231
491 Ga0373935_0164233
492 Ga0373937_0132065
493 Ga0373925_0034989
494 Ga0395899_0074346
495 Ga0395900_0032821
496 Ga0395900_0071125
497 Ga0395898_0005651
498 Ga0395905_0006645
499 Ga0395901_0000532
500 Ga0439455_0001804
501 Ga0439458_0023504
502 Ga0466967_0352832
503 Ga0495630_0098062
504 Ga0495674_0047094
505 Ga0495680_0061042
506 Ga0496100_0042097
507 Ga0496102_0025816
508 Ga0496102_0064686
509 Ga0496106_0006323
510 Ga0496107_0002054
511 Ga0496109_0005261
512 Ga0496109_0137132
513 Ga0496109_0279422
514 Ga0496112_0031979
515 Ga0496112_0203183
516 Ga0496112_0261989
517 Ga0496112_0520777
518 Ga0496113_0024387
519 Ga0496114_0175211
520 Ga0496115_0008883
521 Ga0496115_0045794
522 nmdc:mga05p37_642296_c1
523 nmdc:mga05p37_9278_c1
524 nmdc:mga08y16_717282_c1
525 nmdc:mga0n895_324198_c1
526 nmdc:mga0a205_294720_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dbw-assembly1.cif.gz_a "e. coli atp synthase imaged in 10mm mgatp state3 ""down"" fo classified" 0.236 147 305
6wiv-assembly1.cif.gz_B structure of human gaba(b) receptor in an inactive state 0.2256 36 307
7w55-assembly1.cif.gz_R cryo-em structure of the neuromedin u-bound neuromedin u receptor 2-gq protein complex 0.2218 36 313
8imo-assembly1.cif.gz_c rt1'i-rt1'ii, rt2i-rt2ii, rt3'i-rt3'ii cylinder in cyanobacterial phycobilisome from anthocerotibacter panamensis (cluster g) 0.2216 174 304
7x9b-assembly1.cif.gz_R cryo-em structure of neuropeptide y y2 receptor in complex with npy and gi 0.217 36 306
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6 36 165 1.10.10.1740
af_Q53FP2_11_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5956 39 161 1.20.120.550
af_Q53FP2_11_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.583 39 161 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5464 36 165 1.10.10.1740
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5463 15 191 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2V6ICU0-F1-model_v4 HTTM-like domain-containing protein 0.9749 14 307 GO:0012505
GO:0016020
AF-A0A2V6KXN0-F1-model_v4 HTTM domain-containing protein 0.9724 16 271 GO:0016020
AF-A0A7W1MWR4-F1-model_v4 HTTM domain-containing protein 0.9653 17 310 GO:0012505
GO:0016020
AF-A0A2V6NRB0-F1-model_v4 HTTM-like domain-containing protein 0.9634 14 307 GO:0012505
GO:0016020
AF-A0A2V6P1M2-F1-model_v4 HTTM-like domain-containing protein 0.9628 25 308 GO:0012505
GO:0016020

Map