F371587

General Info

Members Datasets Scaffolds Average Seq Length
263 157 526 231

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10267892|Ga0065707_102678921
Length 253
Sequence MPTSRPMRSPRRAADAIVLPRPAPSPALLSVYEAIVTCGRCPRLRAHCQRIATVKKAAFRDQSYWGRPVPGFGDPHARVLLVGLAPAAHGANRTGRVFTGDGPGGSGDFLMRALHVNGLASQPTSRGPDDGLELTGAYIAAAARCAPPDNKPTPQELDRCRPFLGAEWNALPDIRVVVCLGRIAFGICWRVLGDRGFDVRPRPAFAHGGHYPVVGGPHVLSAFHPSRQNTNTGRLTAPMLEAVFARARALAWP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
155 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
156 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
157 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.38
Rhizosphere 98.86
Stem 0
Stem Tuber 0.38
Unclassified 22.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10267892 3300005295 Bacteria 1079
2 Ga0070658_10216678 3300005327 Unclassified 1618
3 Ga0070683_100000689 3300005329 Bacteria 24471
4 Ga0070683_100058627 3300005329 Unclassified 3576
5 Ga0070683_100155627 3300005329 Bacteria 2167
6 Ga0070683_100361413 3300005329 Unclassified 1383
7 Ga0070670_100082950 3300005331 Bacteria 2754
8 Ga0068869_100131704 3300005334 Bacteria 1923
9 Ga0070666_10094299 3300005335 Unclassified 2059
10 Ga0070680_100002000 3300005336 Bacteria 15004
11 Ga0070682_100281776 3300005337 Unclassified 1212
12 Ga0068868_100025216 3300005338 Bacteria 4519
13 Ga0070660_100031925 3300005339 Unclassified 3960
14 Ga0070691_10004490 3300005341 Bacteria 6334
15 Ga0070692_10008423 3300005345 Bacteria 4601
16 Ga0070692_10193270 3300005345 Bacteria 1187
17 Ga0070675_100106983 3300005354 Bacteria 2361
18 Ga0070671_100099013 3300005355 Unclassified 2445
19 Ga0070673_100224952 3300005364 Bacteria 1626
20 Ga0070659_100164665 3300005366 Bacteria 1814
21 Ga0070709_10274222 3300005434 Unclassified 1223
22 Ga0070714_100417756 3300005435 Bacteria 1270
23 Ga0070694_100000140 3300005444 Bacteria 36469
24 Ga0070694_100000712 3300005444 Bacteria 18524
25 Ga0070708_100031183 3300005445 Bacteria 4612
26 Ga0070708_100451986 3300005445 Bacteria 1212
27 Ga0070678_100065810 3300005456 Bacteria 2692
28 Ga0070662_100004179 3300005457 Bacteria 9099
29 Ga0070662_100047511 3300005457 Bacteria 3088
30 Ga0070681_10014677 3300005458 Bacteria 7791
31 Ga0070681_10159274 3300005458 Unclassified 2181
32 Ga0070707_100196736 3300005468 Bacteria 1965
33 Ga0070698_100022846 3300005471 Bacteria 6539
34 Ga0070699_100012083 3300005518 Bacteria 7450
35 Ga0070699_100271816 3300005518 Bacteria 1517
36 Ga0070679_100005249 3300005530 Bacteria 11990
37 Ga0070684_100002249 3300005535 Bacteria 14196
38 Ga0070684_100048062 3300005535 Unclassified 3701
39 Ga0070684_100344404 3300005535 Bacteria 1370
40 Ga0068853_100074908 3300005539 Unclassified 2954
41 Ga0068853_100216957 3300005539 Unclassified 1746
42 Ga0070696_100049714 3300005546 Bacteria 2913
43 Ga0070665_100366707 3300005548 Bacteria 1447
44 Ga0070665_100513758 3300005548 Bacteria 1209
45 Ga0070704_100000502 3300005549 Bacteria 18588
46 Ga0070704_100237167 3300005549 Bacteria 1491
47 Ga0068855_100014022 3300005563 Bacteria 9660
48 Ga0068855_100016420 3300005563 Bacteria 8901
49 Ga0070664_100072836 3300005564 Unclassified 2947
50 Ga0070664_100547985 3300005564 Unclassified 1069
51 Ga0068857_100004237 3300005577 Bacteria 12092
52 Ga0068857_100024247 3300005577 Bacteria 5339
53 Ga0068854_100132937 3300005578 Unclassified 1901
54 Ga0068856_100012000 3300005614 Bacteria 8393
55 Ga0068856_100074701 3300005614 Unclassified 3357
56 Ga0070702_100342849 3300005615 Bacteria 1049
57 Ga0068852_100007086 3300005616 Bacteria 8167
58 Ga0068864_100011849 3300005618 Bacteria 7200
59 Ga0068864_100223236 3300005618 Unclassified 1739
60 Ga0068863_100177505 3300005841 Unclassified 2044
61 Ga0068858_100012613 3300005842 Bacteria 7968
62 Ga0068858_100063616 3300005842 Bacteria 3414
63 Ga0068858_100518294 3300005842 Bacteria 1153
64 Ga0068860_100065000 3300005843 Bacteria 3465
65 Ga0068860_100384458 3300005843 Bacteria 1386
66 Ga0068862_100928651 3300005844 Bacteria 857
67 Ga0075428_100000112 3300006844 Bacteria 69141
68 Ga0075431_100030967 3300006847 Bacteria 5510
69 Ga0075431_100263659 3300006847 Bacteria 1748
70 Ga0075433_10000775 3300006852 Bacteria 21995
71 Ga0075434_100003418 3300006871 Bacteria 14205
72 Ga0075434_101018519 3300006871 Bacteria 842
73 Ga0075429_100086555 3300006880 Bacteria 2731
74 Ga0068865_100083658 3300006881 Bacteria 2297
75 Ga0075435_100094735 3300007076 Bacteria 2468
76 Ga0105240_10002863 3300009093 Bacteria 27276
77 Ga0105240_10078821 3300009093 Bacteria 4055
78 Ga0105240_10240495 3300009093 Bacteria 2099
79 Ga0111539_10052191 3300009094 Bacteria 4867
80 Ga0105245_10151717 3300009098 Bacteria 2192
81 Ga0105245_10347815 3300009098 Bacteria 1468
82 Ga0105245_10546598 3300009098 Bacteria 1180
83 Ga0105245_10564046 3300009098 Unclassified 1162
84 Ga0114129_10004222 3300009147 Bacteria 20299
85 Ga0114129_10014642 3300009147 Bacteria 11175
86 Ga0114129_10022411 3300009147 Bacteria 8967
87 Ga0114129_10333618 3300009147 Bacteria 2013
88 Ga0105241_10083658 3300009174 Bacteria 2504
89 Ga0105241_10315599 3300009174 Bacteria 1346
90 Ga0105242_10304504 3300009176 Bacteria 1456
91 Ga0105242_10706544 3300009176 Unclassified 987
92 Ga0105242_11341361 3300009176 Bacteria 740
93 Ga0105248_10007432 3300009177 Bacteria 12021
94 Ga0105248_10015180 3300009177 Bacteria 8487
95 Ga0105248_10080145 3300009177 Bacteria 3669
96 Ga0105248_10086254 3300009177 Bacteria 3533
97 Ga0105237_10003660 3300009545 Bacteria 18126
98 Ga0105237_10085949 3300009545 Unclassified 3135
99 Ga0105237_10508556 3300009545 Bacteria 1211
100 Ga0105238_10021628 3300009551 Bacteria 6552
101 Ga0105238_10022581 3300009551 Bacteria 6412
102 Ga0105238_10035592 3300009551 Bacteria 5061
103 Ga0105249_10043085 3300009553 Bacteria 4106
104 Ga0105239_10001360 3300010375 Bacteria 32860
105 Ga0105239_10020756 3300010375 Bacteria 7248
106 Ga0105239_10021349 3300010375 Bacteria 7140
107 Ga0105239_10404476 3300010375 Unclassified 1545
108 Ga0105246_10010920 3300011119 Bacteria 5631
109 Ga0105246_10535732 3300011119 Unclassified 1001
110 Ga0157371_10191437 3300013102 Unclassified 1465
111 Ga0157370_10002156 3300013104 Bacteria 24036
112 Ga0157369_10002061 3300013105 Bacteria 24256
113 Ga0157369_10113959 3300013105 Unclassified 2872
114 Ga0157374_10160253 3300013296 Unclassified 2191
115 Ga0157378_10091991 3300013297 Bacteria 2759
116 Ga0163162_10115544 3300013306 Unclassified 2784
117 Ga0163162_10594994 3300013306 Unclassified 1233
118 Ga0157372_10001346 3300013307 Bacteria 26583
119 Ga0157372_10006473 3300013307 Bacteria 12467
120 Ga0157372_11001748 3300013307 Unclassified 968
121 Ga0157375_10010147 3300013308 Bacteria 8286
122 Ga0157375_10346313 3300013308 Bacteria 1651
123 Ga0163163_10113272 3300014325 Unclassified 2742
124 Ga0163163_10180500 3300014325 Bacteria 2158
125 Ga0163163_10703462 3300014325 Bacteria 1074
126 Ga0157377_10034515 3300014745 Bacteria 2768
127 Ga0157376_10012233 3300014969 Bacteria 6363
128 Ga0207692_10443049 3300025898 Bacteria 816
129 Ga0207680_10078566 3300025903 Bacteria 2067
130 Ga0207654_10044693 3300025911 Bacteria 2517
131 Ga0207654_10298777 3300025911 Bacteria 1094
132 Ga0207707_10002949 3300025912 Bacteria 15152
133 Ga0207707_10416851 3300025912 Bacteria 1152
134 Ga0207695_10001934 3300025913 Bacteria 32168
135 Ga0207695_10279571 3300025913 Bacteria 1563
136 Ga0207695_10819339 3300025913 Unclassified 811
137 Ga0207671_10013549 3300025914 Bacteria 6492
138 Ga0207671_10067042 3300025914 Unclassified 2672
139 Ga0207671_10500277 3300025914 Bacteria 969
140 Ga0207663_10502645 3300025916 Bacteria 942
141 Ga0207660_10002657 3300025917 Bacteria 11725
142 Ga0207657_10043388 3300025919 Unclassified 3962
143 Ga0207649_10044406 3300025920 Bacteria 2720
144 Ga0207652_10006495 3300025921 Bacteria 9425
145 Ga0207646_10156040 3300025922 Bacteria 2059
146 Ga0207646_10260620 3300025922 Bacteria 1567
147 Ga0207694_10006561 3300025924 Bacteria 8844
148 Ga0207694_10009074 3300025924 Bacteria 7505
149 Ga0207694_10048730 3300025924 Bacteria 3278
150 Ga0207650_10336661 3300025925 Bacteria 1239
151 Ga0207687_10015323 3300025927 Bacteria 5023
152 Ga0207687_10018860 3300025927 Bacteria 4562
153 Ga0207687_10227084 3300025927 Unclassified 1473
154 Ga0207644_10107037 3300025931 Bacteria 2109
155 Ga0207644_10271752 3300025931 Unclassified 1358
156 Ga0207690_10021426 3300025932 Unclassified 4008
157 Ga0207690_10121963 3300025932 Bacteria 1895
158 Ga0207706_10012424 3300025933 Bacteria 7759
159 Ga0207706_10038467 3300025933 Bacteria 4243
160 Ga0207686_10218661 3300025934 Bacteria 1374
161 Ga0207686_10219648 3300025934 Unclassified 1371
162 Ga0207704_10115845 3300025938 Bacteria 1822
163 Ga0207711_10001206 3300025941 Bacteria 24477
164 Ga0207711_10029511 3300025941 Unclassified 4627
165 Ga0207711_10200158 3300025941 Bacteria 1822
166 Ga0207689_10144667 3300025942 Bacteria 1959
167 Ga0207689_10417983 3300025942 Bacteria 1119
168 Ga0207689_10527490 3300025942 Bacteria 991
169 Ga0207661_10013134 3300025944 Bacteria 6044
170 Ga0207661_10049788 3300025944 Unclassified 3336
171 Ga0207661_10334210 3300025944 Unclassified 1364
172 Ga0207679_10104059 3300025945 Unclassified 2227
173 Ga0207679_10168587 3300025945 Bacteria 1800
174 Ga0207667_10001595 3300025949 Bacteria 28504
175 Ga0207667_10069432 3300025949 Bacteria 3667
176 Ga0207667_10120125 3300025949 Bacteria 2708
177 Ga0207651_10115990 3300025960 Bacteria 2021
178 Ga0207658_10258893 3300025986 Bacteria 1482
179 Ga0207658_10355145 3300025986 Bacteria 1277
180 Ga0207658_10367406 3300025986 Bacteria 1257
181 Ga0207703_10029751 3300026035 Bacteria 4311
182 Ga0207703_10076497 3300026035 Bacteria 2776
183 Ga0207639_10027619 3300026041 Unclassified 4136
184 Ga0207639_10074231 3300026041 Unclassified 2670
185 Ga0207639_10091742 3300026041 Unclassified 2433
186 Ga0207702_10014168 3300026078 Bacteria 6622
187 Ga0207641_10958040 3300026088 Unclassified 851
188 Ga0207648_10234162 3300026089 Bacteria 1634
189 Ga0207676_10080816 3300026095 Bacteria 2639
190 Ga0207676_10625112 3300026095 Unclassified 1037
191 Ga0207674_10000252 3300026116 Bacteria 66798
192 Ga0207674_10019964 3300026116 Bacteria 7251
193 Ga0207674_10132088 3300026116 Unclassified 2460
194 Ga0207683_10001197 3300026121 Bacteria 23484
195 Ga0207683_10197643 3300026121 Unclassified 1827
196 Ga0207698_10010171 3300026142 Bacteria 6029
197 Ga0207428_10222144 3300027907 Bacteria 1416
198 Ga0268266_10261850 3300028379 Bacteria 1603
199 Ga0268264_10023600 3300028381 Bacteria 5015
200 Ga0268264_10197534 3300028381 Bacteria 1838
201 Ga0265313_10005591 3300031595 Bacteria 9196
202 Ga0265314_10004080 3300031711 Bacteria 13774
203 Ga0265314_10327729 3300031711 Bacteria 850
204 Ga0307413_10000034 3300031824 Bacteria 34768
205 Ga0373948_0007595 3300034817 Bacteria 1828
206 Ga0373934_0000752 3300035086 Bacteria 11605
207 Ga0373934_0035471 3300035086 Unclassified 1962
208 Ga0373953_0035234 3300035117 Bacteria 1966
209 Ga0373954_0001243 3300035118 Bacteria 10262
210 Ga0373954_0003447 3300035118 Bacteria 6705
211 Ga0373955_0064919 3300035172 Bacteria 2025
212 Ga0373955_0136438 3300035172 Bacteria 1435
213 Ga0373924_0019699 3300035410 Unclassified 2616
214 Ga0373935_0287264 3300035692 Bacteria 1159
215 Ga0373927_0132328 3300035695 Bacteria 1630
216 Ga0373933_0028017 3300035724 Unclassified 3247
217 Ga0373933_0071856 3300035724 Bacteria 2107
218 Ga0373933_0121300 3300035724 Unclassified 1637
219 Ga0373937_0003807 3300036401 Bacteria 12746
220 Ga0373937_0005380 3300036401 Bacteria 10949
221 Ga0373937_0012014 3300036401 Bacteria 7600
222 Ga0373937_0052870 3300036401 Unclassified 3726
223 Ga0373937_0169007 3300036401 Unclassified 2051
224 Ga0373925_0093602 3300037068 Unclassified 2300
225 Ga0453684_0296083 3300044712 Bacteria 1841
226 Ga0451576_0563855 3300045051 Bacteria 1196
227 Ga0495592_0105699 3300046454 Unclassified 1999
228 Ga0495651_0179253 3300046462 Bacteria 1501
229 Ga0495653_0439233 3300046463 Bacteria 823
230 Ga0495580_0001952 3300046472 Bacteria 18101
231 Ga0495580_0149774 3300046472 Bacteria 1616
232 Ga0495580_0365442 3300046472 Bacteria 976
233 Ga0495630_0033331 3300046517 Bacteria 3841
234 Ga0495642_0167330 3300046528 Bacteria 955
235 Ga0495652_0059520 3300046529 Bacteria 3232
236 Ga0495652_0377974 3300046529 Bacteria 1008
237 Ga0495652_0701722 3300046529 Bacteria 681
238 Ga0495587_0003311 3300046536 Bacteria 10756
239 Ga0495587_0093409 3300046536 Bacteria 1737
240 Ga0495667_0379711 3300046559 Unclassified 891
241 Ga0495635_0148249 3300046663 Bacteria 1597
242 Ga0495635_0417436 3300046663 Bacteria 890
243 Ga0495604_0152270 3300047317 Bacteria 1642
244 Ga0495674_0073465 3300047319 Bacteria 2948
245 Ga0495674_0399682 3300047319 Bacteria 1109
246 Ga0495685_003265 3300047447 Bacteria 5165
247 Ga0495684_0174291 3300047471 Bacteria 1597
248 Ga0495602_0039686 3300048088 Unclassified 4331
249 Ga0496112_0293738 3300048915 Unclassified 1571
250 Ga0501042_0314119 3300049578 Bacteria 1132
251 nmdc:mga05p37_240503_c1 3300050507 Bacteria 2177
252 nmdc:mga05p37_57541_c1 3300050507 Bacteria 4789
253 nmdc:mga09592_80716_c1 3300050508 Bacteria 2770
254 nmdc:mga06r32_94892_c1 3300050510 Bacteria 2919
255 nmdc:mga0n895_1334925_c1 3300050512 Bacteria 687
256 nmdc:mga0n895_1499_c1 3300050512 Bacteria 17513
257 nmdc:mga0rr50_79914_c1 3300050513 Bacteria 2520
258 nmdc:mga0a205_714_c1 3300050515 Bacteria 26702
259 Ga0495601_0289473 3300053077 Unclassified 1068
260 2585311379 2582581313 Bacteria 10042643
261 2744955993 2744054611 Bacteria 5611514
262 2899370144 2899370129 Bacteria 6781179
263 2984526453 2984523437 Bacteria 4508481
264 Ga0065707_10267892
265 Ga0070658_10216678
266 Ga0070683_100000689
267 Ga0070683_100058627
268 Ga0070683_100155627
269 Ga0070683_100361413
270 Ga0070670_100082950
271 Ga0068869_100131704
272 Ga0070666_10094299
273 Ga0070680_100002000
274 Ga0070682_100281776
275 Ga0068868_100025216
276 Ga0070660_100031925
277 Ga0070691_10004490
278 Ga0070692_10008423
279 Ga0070692_10193270
280 Ga0070675_100106983
281 Ga0070671_100099013
282 Ga0070673_100224952
283 Ga0070659_100164665
284 Ga0070709_10274222
285 Ga0070714_100417756
286 Ga0070694_100000140
287 Ga0070694_100000712
288 Ga0070708_100031183
289 Ga0070708_100451986
290 Ga0070678_100065810
291 Ga0070662_100004179
292 Ga0070662_100047511
293 Ga0070681_10014677
294 Ga0070681_10159274
295 Ga0070707_100196736
296 Ga0070698_100022846
297 Ga0070699_100012083
298 Ga0070699_100271816
299 Ga0070679_100005249
300 Ga0070684_100002249
301 Ga0070684_100048062
302 Ga0070684_100344404
303 Ga0068853_100074908
304 Ga0068853_100216957
305 Ga0070696_100049714
306 Ga0070665_100366707
307 Ga0070665_100513758
308 Ga0070704_100000502
309 Ga0070704_100237167
310 Ga0068855_100014022
311 Ga0068855_100016420
312 Ga0070664_100072836
313 Ga0070664_100547985
314 Ga0068857_100004237
315 Ga0068857_100024247
316 Ga0068854_100132937
317 Ga0068856_100012000
318 Ga0068856_100074701
319 Ga0070702_100342849
320 Ga0068852_100007086
321 Ga0068864_100011849
322 Ga0068864_100223236
323 Ga0068863_100177505
324 Ga0068858_100012613
325 Ga0068858_100063616
326 Ga0068858_100518294
327 Ga0068860_100065000
328 Ga0068860_100384458
329 Ga0068862_100928651
330 Ga0075428_100000112
331 Ga0075431_100030967
332 Ga0075431_100263659
333 Ga0075433_10000775
334 Ga0075434_100003418
335 Ga0075434_101018519
336 Ga0075429_100086555
337 Ga0068865_100083658
338 Ga0075435_100094735
339 Ga0105240_10002863
340 Ga0105240_10078821
341 Ga0105240_10240495
342 Ga0111539_10052191
343 Ga0105245_10151717
344 Ga0105245_10347815
345 Ga0105245_10546598
346 Ga0105245_10564046
347 Ga0114129_10004222
348 Ga0114129_10014642
349 Ga0114129_10022411
350 Ga0114129_10333618
351 Ga0105241_10083658
352 Ga0105241_10315599
353 Ga0105242_10304504
354 Ga0105242_10706544
355 Ga0105242_11341361
356 Ga0105248_10007432
357 Ga0105248_10015180
358 Ga0105248_10080145
359 Ga0105248_10086254
360 Ga0105237_10003660
361 Ga0105237_10085949
362 Ga0105237_10508556
363 Ga0105238_10021628
364 Ga0105238_10022581
365 Ga0105238_10035592
366 Ga0105249_10043085
367 Ga0105239_10001360
368 Ga0105239_10020756
369 Ga0105239_10021349
370 Ga0105239_10404476
371 Ga0105246_10010920
372 Ga0105246_10535732
373 Ga0157371_10191437
374 Ga0157370_10002156
375 Ga0157369_10002061
376 Ga0157369_10113959
377 Ga0157374_10160253
378 Ga0157378_10091991
379 Ga0163162_10115544
380 Ga0163162_10594994
381 Ga0157372_10001346
382 Ga0157372_10006473
383 Ga0157372_11001748
384 Ga0157375_10010147
385 Ga0157375_10346313
386 Ga0163163_10113272
387 Ga0163163_10180500
388 Ga0163163_10703462
389 Ga0157377_10034515
390 Ga0157376_10012233
391 Ga0207692_10443049
392 Ga0207680_10078566
393 Ga0207654_10044693
394 Ga0207654_10298777
395 Ga0207707_10002949
396 Ga0207707_10416851
397 Ga0207695_10001934
398 Ga0207695_10279571
399 Ga0207695_10819339
400 Ga0207671_10013549
401 Ga0207671_10067042
402 Ga0207671_10500277
403 Ga0207663_10502645
404 Ga0207660_10002657
405 Ga0207657_10043388
406 Ga0207649_10044406
407 Ga0207652_10006495
408 Ga0207646_10156040
409 Ga0207646_10260620
410 Ga0207694_10006561
411 Ga0207694_10009074
412 Ga0207694_10048730
413 Ga0207650_10336661
414 Ga0207687_10015323
415 Ga0207687_10018860
416 Ga0207687_10227084
417 Ga0207644_10107037
418 Ga0207644_10271752
419 Ga0207690_10021426
420 Ga0207690_10121963
421 Ga0207706_10012424
422 Ga0207706_10038467
423 Ga0207686_10218661
424 Ga0207686_10219648
425 Ga0207704_10115845
426 Ga0207711_10001206
427 Ga0207711_10029511
428 Ga0207711_10200158
429 Ga0207689_10144667
430 Ga0207689_10417983
431 Ga0207689_10527490
432 Ga0207661_10013134
433 Ga0207661_10049788
434 Ga0207661_10334210
435 Ga0207679_10104059
436 Ga0207679_10168587
437 Ga0207667_10001595
438 Ga0207667_10069432
439 Ga0207667_10120125
440 Ga0207651_10115990
441 Ga0207658_10258893
442 Ga0207658_10355145
443 Ga0207658_10367406
444 Ga0207703_10029751
445 Ga0207703_10076497
446 Ga0207639_10027619
447 Ga0207639_10074231
448 Ga0207639_10091742
449 Ga0207702_10014168
450 Ga0207641_10958040
451 Ga0207648_10234162
452 Ga0207676_10080816
453 Ga0207676_10625112
454 Ga0207674_10000252
455 Ga0207674_10019964
456 Ga0207674_10132088
457 Ga0207683_10001197
458 Ga0207683_10197643
459 Ga0207698_10010171
460 Ga0207428_10222144
461 Ga0268266_10261850
462 Ga0268264_10023600
463 Ga0268264_10197534
464 Ga0265313_10005591
465 Ga0265314_10004080
466 Ga0265314_10327729
467 Ga0307413_10000034
468 Ga0373948_0007595
469 Ga0373934_0000752
470 Ga0373934_0035471
471 Ga0373953_0035234
472 Ga0373954_0001243
473 Ga0373954_0003447
474 Ga0373955_0064919
475 Ga0373955_0136438
476 Ga0373924_0019699
477 Ga0373935_0287264
478 Ga0373927_0132328
479 Ga0373933_0028017
480 Ga0373933_0071856
481 Ga0373933_0121300
482 Ga0373937_0003807
483 Ga0373937_0005380
484 Ga0373937_0012014
485 Ga0373937_0052870
486 Ga0373937_0169007
487 Ga0373925_0093602
488 Ga0453684_0296083
489 Ga0451576_0563855
490 Ga0495592_0105699
491 Ga0495651_0179253
492 Ga0495653_0439233
493 Ga0495580_0001952
494 Ga0495580_0149774
495 Ga0495580_0365442
496 Ga0495630_0033331
497 Ga0495642_0167330
498 Ga0495652_0059520
499 Ga0495652_0377974
500 Ga0495652_0701722
501 Ga0495587_0003311
502 Ga0495587_0093409
503 Ga0495667_0379711
504 Ga0495635_0148249
505 Ga0495635_0417436
506 Ga0495604_0152270
507 Ga0495674_0073465
508 Ga0495674_0399682
509 Ga0495685_003265
510 Ga0495684_0174291
511 Ga0495602_0039686
512 Ga0496112_0293738
513 Ga0501042_0314119
514 nmdc:mga05p37_240503_c1
515 nmdc:mga05p37_57541_c1
516 nmdc:mga09592_80716_c1
517 nmdc:mga06r32_94892_c1
518 nmdc:mga0n895_1334925_c1
519 nmdc:mga0n895_1499_c1
520 nmdc:mga0rr50_79914_c1
521 nmdc:mga0a205_714_c1
522 Ga0495601_0289473
523 2585311379
524 2744955993
525 2899370144
526 2984526453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

70

248

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8987 29 251
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8755 29 251
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7813 27 253
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7546 27 253
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7487 28 253
ID Description Score Start End Superfamily
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9061 29 251 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9015 29 251 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8906 29 251 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8781 29 251 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7144 68 249 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A838V6Y0-F1-model_v4 Uracil-DNA glycosylase 0.9808 113 251 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2V8GD56-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9742 175 250
AF-A0A534Y0X0-F1-model_v4 Uracil-DNA glycosylase 0.9735 111 250 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2E7MVV2-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9718 119 253 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7C5UUN3-F1-model_v4 Uracil-DNA glycosylase 0.9707 112 250 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map