F371584

General Info

Members Datasets Scaffolds Average Seq Length
263 182 526 133

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10580222|Ga0065712_105802221
Length 139
Sequence MAETLKLEIVTPEAIVYSEDVLMVTMPCVTGQIGVYPLHVPLITQVVPGEIIVHHKDGHDQSLAVGEGLVDIAANRVSIVTDMAIPADKIDEAKAEEAHQRALARLEEKLSDEEVASVNASLVRSLAQLHVKRRHRAGG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
122 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
123 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 4.94
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10580222 3300005290 Bacteria 601
2 Ga0058859_11583841 3300004798 Bacteria 803
3 Ga0065714_10161315 3300005288 Bacteria 1050
4 Ga0065712_10001552 3300005290 Bacteria 7548
5 Ga0065715_10144262 3300005293 Bacteria 1809
6 Ga0070676_10232312 3300005328 Bacteria 1223
7 Ga0070683_100001805 3300005329 Bacteria 16680
8 Ga0070670_100013821 3300005331 Bacteria 6921
9 Ga0070670_100107108 3300005331 Bacteria 2409
10 Ga0070670_102265792 3300005331 Unclassified 500
11 Ga0070677_10302556 3300005333 Bacteria 813
12 Ga0070666_10142759 3300005335 Bacteria 1668
13 Ga0070666_10281099 3300005335 Bacteria 1183
14 Ga0070660_101403896 3300005339 Bacteria 593
15 Ga0070689_100233169 3300005340 Bacteria 1514
16 Ga0070661_100014971 3300005344 Bacteria 5472
17 Ga0070668_100121036 3300005347 Bacteria 2092
18 Ga0070669_100009217 3300005353 Bacteria 7034
19 Ga0070669_100433430 3300005353 Bacteria 1081
20 Ga0070675_100106753 3300005354 Bacteria 2364
21 Ga0070675_100432870 3300005354 Bacteria 1178
22 Ga0070675_100647678 3300005354 Unclassified 960
23 Ga0070671_100465618 3300005355 Bacteria 1085
24 Ga0070674_100506276 3300005356 Bacteria 1006
25 Ga0070674_100548499 3300005356 Bacteria 970
26 Ga0070674_101358421 3300005356 Bacteria 635
27 Ga0070673_100377844 3300005364 Bacteria 1263
28 Ga0070673_100410086 3300005364 Bacteria 1213
29 Ga0070688_100109679 3300005365 Bacteria 1833
30 Ga0070688_100560236 3300005365 Bacteria 870
31 Ga0070688_100844316 3300005365 Bacteria 719
32 Ga0070659_101321887 3300005366 Bacteria 640
33 Ga0070667_100095208 3300005367 Bacteria 2567
34 Ga0070667_101273593 3300005367 Bacteria 689
35 Ga0070701_10620478 3300005438 Bacteria 718
36 Ga0070705_100795820 3300005440 Bacteria 752
37 Ga0070700_100085031 3300005441 Bacteria 2051
38 Ga0070700_100677246 3300005441 Bacteria 817
39 Ga0070708_100009363 3300005445 Bacteria 7895
40 Ga0070663_100010512 3300005455 Bacteria 5769
41 Ga0070678_100256676 3300005456 Bacteria 1468
42 Ga0070662_100249550 3300005457 Bacteria 1426
43 Ga0070662_100391070 3300005457 Bacteria 1146
44 Ga0070685_10576154 3300005466 Bacteria 807
45 Ga0070706_100005565 3300005467 Bacteria 11992
46 Ga0070706_100344945 3300005467 Bacteria 1388
47 Ga0070706_101789635 3300005467 Unclassified 558
48 Ga0070707_100009299 3300005468 Bacteria 9121
49 Ga0070707_100296430 3300005468 Bacteria 1571
50 Ga0070707_102071071 3300005468 Unclassified 536
51 Ga0070698_100031033 3300005471 Bacteria 5541
52 Ga0070698_101982320 3300005471 Bacteria 535
53 Ga0070699_100071832 3300005518 Bacteria 3010
54 Ga0070699_100488720 3300005518 Unclassified 1118
55 Ga0070684_100010085 3300005535 Bacteria 7470
56 Ga0070697_100161294 3300005536 Bacteria 1894
57 Ga0070672_101870478 3300005543 Unclassified 540
58 Ga0070695_101326004 3300005545 Bacteria 595
59 Ga0070696_100229557 3300005546 Bacteria 1396
60 Ga0070665_100917726 3300005548 Bacteria 888
61 Ga0070664_100002749 3300005564 Bacteria 14199
62 Ga0070702_100096758 3300005615 Bacteria 1802
63 Ga0068859_103075018 3300005617 Unclassified 509
64 Ga0068864_101157149 3300005618 Bacteria 771
65 Ga0068858_100154066 3300005842 Bacteria 2162
66 Ga0068860_100176166 3300005843 Bacteria 2067
67 Ga0068862_100053452 3300005844 Bacteria 3458
68 Ga0075364_10007403 3300006051 Bacteria 6516
69 Ga0075367_10464296 3300006178 Bacteria 803
70 Ga0075366_10015819 3300006195 Bacteria 4331
71 Ga0097621_100333901 3300006237 Bacteria 1345
72 Ga0097621_102164296 3300006237 Bacteria 532
73 Ga0075428_100184698 3300006844 Bacteria 2256
74 Ga0075428_100314700 3300006844 Bacteria 1683
75 Ga0075428_101244411 3300006844 Bacteria 784
76 Ga0075430_100144032 3300006846 Unclassified 1984
77 Ga0075430_100195506 3300006846 Bacteria 1680
78 Ga0075431_101186075 3300006847 Bacteria 726
79 Ga0075433_10324049 3300006852 Bacteria 1363
80 Ga0075434_101578710 3300006871 Bacteria 665
81 Ga0075429_100011254 3300006880 Bacteria 7743
82 Ga0075429_100452776 3300006880 Bacteria 1125
83 Ga0075436_101179257 3300006914 Unclassified 578
84 Ga0097620_103073314 3300006931 Unclassified 509
85 Ga0075435_100211194 3300007076 Bacteria 1647
86 Ga0075435_100749977 3300007076 Bacteria 849
87 Ga0111539_10002823 3300009094 Bacteria 23094
88 Ga0111539_11468079 3300009094 Bacteria 791
89 Ga0111539_11764806 3300009094 Bacteria 718
90 Ga0114129_10024251 3300009147 Bacteria 8594
91 Ga0105242_10785267 3300009176 Bacteria 941
92 Ga0105248_10027464 3300009177 Bacteria 6337
93 Ga0105248_10049160 3300009177 Bacteria 4730
94 Ga0105248_10239996 3300009177 Bacteria 2040
95 Ga0105248_11461442 3300009177 Unclassified 774
96 Ga0105248_12580014 3300009177 Unclassified 579
97 Ga0105249_10624408 3300009553 Bacteria 1134
98 Ga0105249_10738819 3300009553 Bacteria 1046
99 Ga0105239_10259754 3300010375 Bacteria 1952
100 Ga0157374_11109022 3300013296 Unclassified 812
101 Ga0163162_10207473 3300013306 Bacteria 2089
102 Ga0163162_10475899 3300013306 Bacteria 1380
103 Ga0157375_10143986 3300013308 Bacteria 2513
104 Ga0163163_10000017 3300014325 Bacteria 208781
105 Ga0163163_10101535 3300014325 Bacteria 2899
106 Ga0157380_10414363 3300014326 Bacteria 1283
107 Ga0157380_10678369 3300014326 Bacteria 1032
108 Ga0157379_10233195 3300014968 Bacteria 1669
109 Ga0207688_10485709 3300025901 Bacteria 772
110 Ga0207680_10142943 3300025903 Bacteria 1588
111 Ga0207645_10173558 3300025907 Bacteria 1413
112 Ga0207684_10002028 3300025910 Bacteria 20866
113 Ga0207684_10203329 3300025910 Bacteria 1709
114 Ga0207649_10193238 3300025920 Unclassified 1433
115 Ga0207646_10161635 3300025922 Bacteria 2021
116 Ga0207646_10255087 3300025922 Bacteria 1585
117 Ga0207681_10156534 3300025923 Bacteria 1713
118 Ga0207650_10012640 3300025925 Bacteria 5826
119 Ga0207659_10420426 3300025926 Bacteria 1121
120 Ga0207644_10190300 3300025931 Bacteria 1613
121 Ga0207644_10408608 3300025931 Bacteria 1111
122 Ga0207690_11476135 3300025932 Bacteria 568
123 Ga0207706_10073833 3300025933 Bacteria 2999
124 Ga0207706_10305693 3300025933 Bacteria 1385
125 Ga0207706_10316633 3300025933 Bacteria 1358
126 Ga0207706_11253812 3300025933 Unclassified 614
127 Ga0207670_10169373 3300025936 Bacteria 1636
128 Ga0207691_10173260 3300025940 Bacteria 1889
129 Ga0207711_10026793 3300025941 Bacteria 4838
130 Ga0207711_10878054 3300025941 Unclassified 834
131 Ga0207661_10232947 3300025944 Bacteria 1631
132 Ga0207679_10009561 3300025945 Bacteria 6215
133 Ga0207679_10680252 3300025945 Bacteria 933
134 Ga0207712_10984879 3300025961 Unclassified 748
135 Ga0207712_11643663 3300025961 Bacteria 576
136 Ga0207668_10083824 3300025972 Bacteria 2321
137 Ga0207668_10267642 3300025972 Bacteria 1396
138 Ga0207658_10016009 3300025986 Bacteria 5152
139 Ga0207678_10019717 3300026067 Bacteria 5931
140 Ga0207708_10869474 3300026075 Bacteria 779
141 Ga0207641_12361130 3300026088 Unclassified 531
142 Ga0207683_10456854 3300026121 Bacteria 1178
143 Ga0209813_10081585 3300027866 Bacteria 1070
144 Ga0207428_10000912 3300027907 Bacteria 33045
145 Ga0207428_10001562 3300027907 Bacteria 23934
146 Ga0268265_10120655 3300028380 Bacteria 2159
147 Ga0268264_10071968 3300028381 Bacteria 2931
148 Ga0307408_100058037 3300031548 Bacteria 2812
149 Ga0307413_10096352 3300031824 Bacteria 1942
150 Ga0307406_10087897 3300031901 Bacteria 2084
151 Ga0307407_10281856 3300031903 Bacteria 1151
152 Ga0307409_100101234 3300031995 Bacteria 2390
153 Ga0307416_100525309 3300032002 Bacteria 1252
154 Ga0307411_10067568 3300032005 Bacteria 2406
155 Ga0307415_100053216 3300032126 Unclassified 2757
156 Ga0373934_0001733 3300035086 Bacteria 8010
157 Ga0373923_0344940 3300035111 Bacteria 710
158 Ga0373954_0006060 3300035118 Bacteria 5259
159 Ga0373956_0002299 3300035119 Bacteria 7858
160 Ga0373957_0027309 3300035120 Bacteria 2073
161 Ga0373933_0103895 3300035724 Bacteria 1765
162 Ga0373933_0528564 3300035724 Unclassified 773
163 Ga0373933_0994937 3300035724 Unclassified 552
164 Ga0373947_0454415 3300035725 Bacteria 868
165 Ga0373937_0001308 3300036401 Bacteria 20850
166 Ga0373937_0512296 3300036401 Bacteria 1140
167 Ga0373937_0776510 3300036401 Bacteria 906
168 Ga0373937_1843769 3300036401 Bacteria 551
169 Ga0395900_0353339 3300037418 Bacteria 1443
170 Ga0395898_1168472 3300037466 Unclassified 701
171 Ga0395901_0233538 3300038443 Bacteria 1920
172 Ga0439453_0011519 3300041408 Bacteria 1476
173 Ga0451849_1339283 3300041505 Bacteria 829
174 Ga0450920_005395 3300042122 Bacteria 2271
175 Ga0450896_014767 3300042133 Bacteria 1115
176 Ga0450906_037880 3300042145 Bacteria 851
177 Ga0439435_0008332 3300042436 Bacteria 2402
178 Ga0439460_0152516 3300042461 Bacteria 771
179 Ga0439460_0179733 3300042461 Bacteria 715
180 Ga0439440_0063480 3300042993 Bacteria 947
181 Ga0453683_0052211 3300044673 Bacteria 2559
182 Ga0451576_0006895 3300045051 Bacteria 13754
183 Ga0451576_0866637 3300045051 Unclassified 948
184 Ga0495641_0488495 3300046461 Bacteria 561
185 Ga0495653_0123029 3300046463 Bacteria 1846
186 Ga0495653_0475696 3300046463 Bacteria 782
187 Ga0495587_0026311 3300046536 Bacteria 3549
188 Ga0495659_0142365 3300046664 Bacteria 958
189 Ga0495581_0523778 3300047315 Unclassified 689
190 Ga0495680_0085003 3300047322 Bacteria 2383
191 Ga0496102_1393135 3300048905 Bacteria 620
192 Ga0496104_0030270 3300048907 Bacteria 5029
193 Ga0496105_0055847 3300048908 Bacteria 3260
194 Ga0496107_0143336 3300048910 Bacteria 1766
195 Ga0496108_0078675 3300048911 Bacteria 2791
196 Ga0496109_0100582 3300048912 Bacteria 2682
197 Ga0496110_0008629 3300048913 Bacteria 8208
198 Ga0496110_0538729 3300048913 Bacteria 1061
199 Ga0496111_0267143 3300048914 Bacteria 1269
200 Ga0496112_0299238 3300048915 Unclassified 1554
201 Ga0496112_1033584 3300048915 Bacteria 741
202 Ga0496113_0314558 3300048916 Bacteria 1255
203 Ga0496114_0229083 3300048917 Bacteria 1632
204 Ga0501298_020180 3300049521 Bacteria 1240
205 Ga0501031_1053677 3300049568 Unclassified 519
206 Ga0501033_0151278 3300049570 Bacteria 1674
207 Ga0501036_0005067 3300049572 Bacteria 10664
208 Ga0501036_0232223 3300049572 Bacteria 1548
209 Ga0501038_0034159 3300049574 Bacteria 4474
210 Ga0501039_0009003 3300049575 Bacteria 7604
211 Ga0501039_0204344 3300049575 Bacteria 1553
212 Ga0501040_0001979 3300049576 Bacteria 13209
213 Ga0501040_0218632 3300049576 Bacteria 1355
214 Ga0501040_0462340 3300049576 Bacteria 914
215 Ga0501041_0000363 3300049577 Bacteria 22560
216 Ga0501042_0045366 3300049578 Bacteria 3133
217 Ga0501042_0073976 3300049578 Bacteria 2438
218 Ga0501043_0125904 3300049579 Bacteria 2009
219 Ga0501046_0000745 3300049580 Bacteria 31417
220 Ga0501048_0017770 3300049582 Bacteria 5233
221 Ga0501048_0052128 3300049582 Bacteria 2911
222 Ga0501071_0003362 3300049587 Bacteria 10001
223 Ga0501071_0014615 3300049587 Bacteria 5372
224 Ga0501072_0006160 3300049588 Bacteria 9142
225 Ga0501072_0018958 3300049588 Bacteria 5311
226 Ga0501074_0079967 3300049590 Bacteria 2346
227 Ga0501074_0124585 3300049590 Bacteria 1843
228 Ga0501074_1210958 3300049590 Unclassified 530
229 Ga0501075_0000671 3300049591 Bacteria 21101
230 Ga0501075_0222609 3300049591 Bacteria 1439
231 Ga0501075_0406394 3300049591 Bacteria 1038
232 Ga0501076_0041634 3300049592 Bacteria 3614
233 Ga0501076_0135106 3300049592 Bacteria 2002
234 Ga0501077_0004092 3300049593 Bacteria 8802
235 Ga0501261_117433 3300049690 Unclassified 523
236 Ga0501079_0225360 3300049741 Bacteria 1464
237 Ga0501081_0028773 3300049743 Bacteria 3751
238 Ga0501081_1050068 3300049743 Unclassified 616
239 Ga0501083_0133379 3300049744 Bacteria 1628
240 Ga0501045_0000779 3300049824 Bacteria 20503
241 Ga0501045_0091441 3300049824 Bacteria 2249
242 nmdc:mga00v17_14439_c1 3300050491 Bacteria 4407
243 nmdc:mga06z11_98401_c1 3300050494 Bacteria 1601
244 nmdc:mga04h51_96741_c1 3300050495 Bacteria 1070
245 nmdc:mga05p37_158694_c1 3300050507 Bacteria 2763
246 nmdc:mga05p37_242577_c1 3300050507 Bacteria 2166
247 nmdc:mga05p37_79464_c1 3300050507 Bacteria 4039
248 nmdc:mga09592_66268_c1 3300050508 Bacteria 3061
249 nmdc:mga0qj67_137101_c1 3300050509 Unclassified 1983
250 nmdc:mga0qj67_94349_c1 3300050509 Bacteria 2407
251 nmdc:mga06r32_211753_c1 3300050510 Unclassified 1926
252 nmdc:mga06r32_29021_c1 3300050510 Bacteria 5181
253 nmdc:mga08y16_1163_c1 3300050511 Bacteria 25937
254 nmdc:mga08y16_193073_c1 3300050511 Bacteria 2112
255 nmdc:mga0n895_856709_c1 3300050512 Unclassified 896
256 nmdc:mga0rr50_922645_c1 3300050513 Unclassified 744
257 nmdc:mga0a205_115945_c1 3300050515 Bacteria 2577
258 nmdc:mga0a205_780680_c1 3300050515 Bacteria 803
259 Ga0501084_0037069 3300054114 Bacteria 4074
260 Ga0501082_0005038 3300060353 Bacteria 11519
261 Ga0501082_0444135 3300060353 Bacteria 1133
262 Ga0530510_0002636 3300061734 Bacteria 12329
263 Ga0530510_1117615 3300061734 Bacteria 604
264 Ga0065712_10580222
265 Ga0058859_11583841
266 Ga0065714_10161315
267 Ga0065712_10001552
268 Ga0065715_10144262
269 Ga0070676_10232312
270 Ga0070683_100001805
271 Ga0070670_100013821
272 Ga0070670_100107108
273 Ga0070670_102265792
274 Ga0070677_10302556
275 Ga0070666_10142759
276 Ga0070666_10281099
277 Ga0070660_101403896
278 Ga0070689_100233169
279 Ga0070661_100014971
280 Ga0070668_100121036
281 Ga0070669_100009217
282 Ga0070669_100433430
283 Ga0070675_100106753
284 Ga0070675_100432870
285 Ga0070675_100647678
286 Ga0070671_100465618
287 Ga0070674_100506276
288 Ga0070674_100548499
289 Ga0070674_101358421
290 Ga0070673_100377844
291 Ga0070673_100410086
292 Ga0070688_100109679
293 Ga0070688_100560236
294 Ga0070688_100844316
295 Ga0070659_101321887
296 Ga0070667_100095208
297 Ga0070667_101273593
298 Ga0070701_10620478
299 Ga0070705_100795820
300 Ga0070700_100085031
301 Ga0070700_100677246
302 Ga0070708_100009363
303 Ga0070663_100010512
304 Ga0070678_100256676
305 Ga0070662_100249550
306 Ga0070662_100391070
307 Ga0070685_10576154
308 Ga0070706_100005565
309 Ga0070706_100344945
310 Ga0070706_101789635
311 Ga0070707_100009299
312 Ga0070707_100296430
313 Ga0070707_102071071
314 Ga0070698_100031033
315 Ga0070698_101982320
316 Ga0070699_100071832
317 Ga0070699_100488720
318 Ga0070684_100010085
319 Ga0070697_100161294
320 Ga0070672_101870478
321 Ga0070695_101326004
322 Ga0070696_100229557
323 Ga0070665_100917726
324 Ga0070664_100002749
325 Ga0070702_100096758
326 Ga0068859_103075018
327 Ga0068864_101157149
328 Ga0068858_100154066
329 Ga0068860_100176166
330 Ga0068862_100053452
331 Ga0075364_10007403
332 Ga0075367_10464296
333 Ga0075366_10015819
334 Ga0097621_100333901
335 Ga0097621_102164296
336 Ga0075428_100184698
337 Ga0075428_100314700
338 Ga0075428_101244411
339 Ga0075430_100144032
340 Ga0075430_100195506
341 Ga0075431_101186075
342 Ga0075433_10324049
343 Ga0075434_101578710
344 Ga0075429_100011254
345 Ga0075429_100452776
346 Ga0075436_101179257
347 Ga0097620_103073314
348 Ga0075435_100211194
349 Ga0075435_100749977
350 Ga0111539_10002823
351 Ga0111539_11468079
352 Ga0111539_11764806
353 Ga0114129_10024251
354 Ga0105242_10785267
355 Ga0105248_10027464
356 Ga0105248_10049160
357 Ga0105248_10239996
358 Ga0105248_11461442
359 Ga0105248_12580014
360 Ga0105249_10624408
361 Ga0105249_10738819
362 Ga0105239_10259754
363 Ga0157374_11109022
364 Ga0163162_10207473
365 Ga0163162_10475899
366 Ga0157375_10143986
367 Ga0163163_10000017
368 Ga0163163_10101535
369 Ga0157380_10414363
370 Ga0157380_10678369
371 Ga0157379_10233195
372 Ga0207688_10485709
373 Ga0207680_10142943
374 Ga0207645_10173558
375 Ga0207684_10002028
376 Ga0207684_10203329
377 Ga0207649_10193238
378 Ga0207646_10161635
379 Ga0207646_10255087
380 Ga0207681_10156534
381 Ga0207650_10012640
382 Ga0207659_10420426
383 Ga0207644_10190300
384 Ga0207644_10408608
385 Ga0207690_11476135
386 Ga0207706_10073833
387 Ga0207706_10305693
388 Ga0207706_10316633
389 Ga0207706_11253812
390 Ga0207670_10169373
391 Ga0207691_10173260
392 Ga0207711_10026793
393 Ga0207711_10878054
394 Ga0207661_10232947
395 Ga0207679_10009561
396 Ga0207679_10680252
397 Ga0207712_10984879
398 Ga0207712_11643663
399 Ga0207668_10083824
400 Ga0207668_10267642
401 Ga0207658_10016009
402 Ga0207678_10019717
403 Ga0207708_10869474
404 Ga0207641_12361130
405 Ga0207683_10456854
406 Ga0209813_10081585
407 Ga0207428_10000912
408 Ga0207428_10001562
409 Ga0268265_10120655
410 Ga0268264_10071968
411 Ga0307408_100058037
412 Ga0307413_10096352
413 Ga0307406_10087897
414 Ga0307407_10281856
415 Ga0307409_100101234
416 Ga0307416_100525309
417 Ga0307411_10067568
418 Ga0307415_100053216
419 Ga0373934_0001733
420 Ga0373923_0344940
421 Ga0373954_0006060
422 Ga0373956_0002299
423 Ga0373957_0027309
424 Ga0373933_0103895
425 Ga0373933_0528564
426 Ga0373933_0994937
427 Ga0373947_0454415
428 Ga0373937_0001308
429 Ga0373937_0512296
430 Ga0373937_0776510
431 Ga0373937_1843769
432 Ga0395900_0353339
433 Ga0395898_1168472
434 Ga0395901_0233538
435 Ga0439453_0011519
436 Ga0451849_1339283
437 Ga0450920_005395
438 Ga0450896_014767
439 Ga0450906_037880
440 Ga0439435_0008332
441 Ga0439460_0152516
442 Ga0439460_0179733
443 Ga0439440_0063480
444 Ga0453683_0052211
445 Ga0451576_0006895
446 Ga0451576_0866637
447 Ga0495641_0488495
448 Ga0495653_0123029
449 Ga0495653_0475696
450 Ga0495587_0026311
451 Ga0495659_0142365
452 Ga0495581_0523778
453 Ga0495680_0085003
454 Ga0496102_1393135
455 Ga0496104_0030270
456 Ga0496105_0055847
457 Ga0496107_0143336
458 Ga0496108_0078675
459 Ga0496109_0100582
460 Ga0496110_0008629
461 Ga0496110_0538729
462 Ga0496111_0267143
463 Ga0496112_0299238
464 Ga0496112_1033584
465 Ga0496113_0314558
466 Ga0496114_0229083
467 Ga0501298_020180
468 Ga0501031_1053677
469 Ga0501033_0151278
470 Ga0501036_0005067
471 Ga0501036_0232223
472 Ga0501038_0034159
473 Ga0501039_0009003
474 Ga0501039_0204344
475 Ga0501040_0001979
476 Ga0501040_0218632
477 Ga0501040_0462340
478 Ga0501041_0000363
479 Ga0501042_0045366
480 Ga0501042_0073976
481 Ga0501043_0125904
482 Ga0501046_0000745
483 Ga0501048_0017770
484 Ga0501048_0052128
485 Ga0501071_0003362
486 Ga0501071_0014615
487 Ga0501072_0006160
488 Ga0501072_0018958
489 Ga0501074_0079967
490 Ga0501074_0124585
491 Ga0501074_1210958
492 Ga0501075_0000671
493 Ga0501075_0222609
494 Ga0501075_0406394
495 Ga0501076_0041634
496 Ga0501076_0135106
497 Ga0501077_0004092
498 Ga0501261_117433
499 Ga0501079_0225360
500 Ga0501081_0028773
501 Ga0501081_1050068
502 Ga0501083_0133379
503 Ga0501045_0000779
504 Ga0501045_0091441
505 nmdc:mga00v17_14439_c1
506 nmdc:mga06z11_98401_c1
507 nmdc:mga04h51_96741_c1
508 nmdc:mga05p37_158694_c1
509 nmdc:mga05p37_242577_c1
510 nmdc:mga05p37_79464_c1
511 nmdc:mga09592_66268_c1
512 nmdc:mga0qj67_137101_c1
513 nmdc:mga0qj67_94349_c1
514 nmdc:mga06r32_211753_c1
515 nmdc:mga06r32_29021_c1
516 nmdc:mga08y16_1163_c1
517 nmdc:mga08y16_193073_c1
518 nmdc:mga0n895_856709_c1
519 nmdc:mga0rr50_922645_c1
520 nmdc:mga0a205_115945_c1
521 nmdc:mga0a205_780680_c1
522 Ga0501084_0037069
523 Ga0501082_0005038
524 Ga0501082_0444135
525 Ga0530510_0002636
526 Ga0530510_1117615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

5

84

0.98

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

88

133

0.94

Map