F371451

General Info

Members Datasets Scaffolds Average Seq Length
262 162 524 318

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_385441_c1|nmdc:mga09592_385441_c1_14_967
Length 310
Sequence VISLTDIRAARERIAGIASVTPLIDVSRQAGRPLLLKCENMQPCGAFKIRGAYNMVAQLTADQLQRGVITYSSGNHGQAMALAARALGAPAVVVMPTTAPRVKIDGTRSFGAEVILEGTTSSDRRARAETEAAARGLTMVPPFDHEWIIAGQGTVGLEILEQCPDAAAIVVPIGVAAAVKQMRPDVRVIGVEPVGAAAMRASLDAGHPVTLPKTATVADGLMPVRPGDFTYDLVSRLADDVVTVEDDEIIEAVRWTFTRAKVVAEPSGAASVAAVLSGKADARQRVDGPVIAILSGGNVAPELIGQWLNR

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
128 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
129 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 2.67
Rhizosphere 91.22
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_385441_c1 3300050508 Bacteria 1212
2 MBSR1b_contig_7380000 2162886012 Bacteria 1141
3 Ga0065712_10083971 3300005290 Bacteria 2798
4 Ga0065715_10095414 3300005293 Bacteria 4089
5 Ga0070676_10249602 3300005328 Unclassified 1184
6 Ga0070683_100004649 3300005329 Bacteria 11345
7 Ga0070683_100008702 3300005329 Bacteria 8630
8 Ga0070690_100008723 3300005330 Bacteria 5849
9 Ga0070690_100055269 3300005330 Bacteria 2543
10 Ga0070670_100003257 3300005331 Bacteria 13413
11 Ga0070670_100008786 3300005331 Bacteria 8622
12 Ga0070670_100043132 3300005331 Bacteria 3878
13 Ga0070670_100057466 3300005331 Unclassified 3340
14 Ga0068869_100001284 3300005334 Bacteria 14854
15 Ga0068869_100075523 3300005334 Bacteria 2504
16 Ga0068869_100079032 3300005334 Unclassified 2451
17 Ga0070666_10379936 3300005335 Bacteria 1014
18 Ga0070682_100264780 3300005337 Bacteria 1246
19 Ga0068868_100041634 3300005338 Bacteria 3579
20 Ga0070689_100229045 3300005340 Bacteria 1527
21 Ga0070687_100086431 3300005343 Bacteria 1724
22 Ga0070669_100054757 3300005353 Bacteria 2922
23 Ga0070675_100003397 3300005354 Bacteria 12059
24 Ga0070675_100004188 3300005354 Bacteria 10958
25 Ga0070675_100026607 3300005354 Bacteria 4643
26 Ga0070671_100148527 3300005355 Bacteria 1979
27 Ga0070674_100007783 3300005356 Bacteria 6334
28 Ga0070674_100040341 3300005356 Bacteria 3158
29 Ga0070674_100417317 3300005356 Bacteria 1100
30 Ga0070673_100001008 3300005364 Bacteria 15996
31 Ga0070673_100003896 3300005364 Bacteria 9379
32 Ga0070673_100028267 3300005364 Bacteria 4168
33 Ga0070673_100084493 3300005364 Bacteria 2582
34 Ga0070673_100225273 3300005364 Bacteria 1625
35 Ga0070659_100162659 3300005366 Unclassified 1826
36 Ga0070667_100093482 3300005367 Bacteria 2590
37 Ga0070667_100135498 3300005367 Unclassified 2153
38 Ga0070667_100197689 3300005367 Bacteria 1783
39 Ga0070713_100060485 3300005436 Bacteria 3166
40 Ga0070701_10054178 3300005438 Bacteria 2091
41 Ga0070701_10061561 3300005438 Bacteria 1980
42 Ga0070705_100037573 3300005440 Bacteria 2733
43 Ga0070700_100003626 3300005441 Bacteria 7989
44 Ga0070700_100072218 3300005441 Bacteria 2205
45 Ga0070700_100341727 3300005441 Bacteria 1107
46 Ga0070694_100089091 3300005444 Bacteria 2162
47 Ga0070694_100212414 3300005444 Bacteria 1448
48 Ga0070678_100172729 3300005456 Bacteria 1762
49 Ga0070678_100216777 3300005456 Bacteria 1589
50 Ga0070662_100208495 3300005457 Bacteria 1554
51 Ga0068867_100000727 3300005459 Bacteria 22046
52 Ga0068867_100013756 3300005459 Bacteria 5731
53 Ga0068867_100376074 3300005459 Bacteria 1192
54 Ga0070698_100282239 3300005471 Bacteria 1592
55 Ga0070699_100283910 3300005518 Bacteria 1483
56 Ga0070684_100000742 3300005535 Bacteria 22631
57 Ga0070684_100049997 3300005535 Bacteria 3630
58 Ga0070672_100010398 3300005543 Bacteria 6455
59 Ga0070672_100012266 3300005543 Bacteria 6008
60 Ga0070672_100046422 3300005543 Bacteria 3365
61 Ga0070686_100021170 3300005544 Bacteria 3861
62 Ga0070686_100308151 3300005544 Bacteria 1177
63 Ga0070696_100131546 3300005546 Bacteria 1821
64 Ga0070665_100628246 3300005548 Bacteria 1087
65 Ga0070664_100011107 3300005564 Bacteria 7301
66 Ga0068857_100052682 3300005577 Bacteria 3610
67 Ga0068864_100105899 3300005618 Bacteria 2500
68 Ga0068864_100168501 3300005618 Unclassified 1995
69 Ga0068864_100214247 3300005618 Bacteria 1775
70 Ga0068861_100015572 3300005719 Bacteria 5362
71 Ga0068851_10076220 3300005834 Bacteria 1744
72 Ga0068858_100027792 3300005842 Bacteria 5256
73 Ga0068860_100023545 3300005843 Bacteria 5952
74 Ga0081455_10144728 3300005937 Unclassified 1841
75 Ga0070717_10063875 3300006028 Unclassified 3057
76 Ga0075368_10010554 3300006042 Bacteria 3342
77 Ga0075368_10035758 3300006042 Bacteria 1939
78 Ga0075364_10005395 3300006051 Bacteria 7424
79 Ga0075362_10000445 3300006177 Bacteria 11997
80 Ga0075367_10000523 3300006178 Bacteria 14463
81 Ga0075367_10035222 3300006178 Bacteria 2896
82 Ga0075366_10005382 3300006195 Bacteria 6937
83 Ga0075370_10003726 3300006353 Bacteria 7295
84 Ga0068871_100088630 3300006358 Bacteria 2575
85 Ga0075430_100003978 3300006846 Bacteria 12463
86 Ga0075431_100045451 3300006847 Bacteria 4527
87 Ga0075433_10034153 3300006852 Bacteria 4366
88 Ga0075434_100409542 3300006871 Bacteria 1377
89 Ga0075429_100346239 3300006880 Bacteria 1301
90 Ga0068865_100002427 3300006881 Bacteria 11014
91 Ga0068865_100142439 3300006881 Bacteria 1809
92 Ga0075435_100000143 3300007076 Bacteria 40414
93 Ga0111539_10671391 3300009094 Bacteria 1207
94 Ga0114129_10004403 3300009147 Bacteria 19866
95 Ga0114129_10029886 3300009147 Bacteria 7716
96 Ga0105243_10015028 3300009148 Bacteria 5859
97 Ga0105243_10022812 3300009148 Bacteria 4758
98 Ga0105241_10355765 3300009174 Bacteria 1273
99 Ga0105242_10001547 3300009176 Bacteria 18110
100 Ga0105248_10017073 3300009177 Bacteria 7994
101 Ga0105238_10161657 3300009551 Bacteria 2215
102 Ga0157378_10266014 3300013297 Bacteria 1647
103 Ga0157375_10016849 3300013308 Bacteria 6578
104 Ga0157375_10094013 3300013308 Bacteria 3065
105 Ga0163163_10000417 3300014325 Bacteria 39600
106 Ga0163163_10055002 3300014325 Bacteria 3933
107 Ga0163163_10132297 3300014325 Bacteria 2535
108 Ga0157380_10007225 3300014326 Bacteria 7875
109 Ga0157380_10042548 3300014326 Bacteria 3550
110 Ga0157380_10189792 3300014326 Bacteria 1813
111 Ga0157377_10011912 3300014745 Bacteria 4356
112 Ga0157376_10212312 3300014969 Bacteria 1787
113 Ga0207697_10003995 3300025315 Bacteria 7148
114 Ga0207656_10051626 3300025321 Unclassified 1778
115 Ga0207688_10017536 3300025901 Bacteria 3891
116 Ga0207688_10055719 3300025901 Unclassified 2219
117 Ga0207680_10149365 3300025903 Bacteria 1557
118 Ga0207654_10025188 3300025911 Bacteria 3206
119 Ga0207662_10003633 3300025918 Bacteria 7981
120 Ga0207662_10030261 3300025918 Bacteria 3141
121 Ga0207681_10040679 3300025923 Bacteria 3095
122 Ga0207694_10068521 3300025924 Bacteria 2771
123 Ga0207650_10003136 3300025925 Bacteria 11389
124 Ga0207650_10007644 3300025925 Bacteria 7364
125 Ga0207650_10061283 3300025925 Bacteria 2809
126 Ga0207650_10074359 3300025925 Bacteria 2561
127 Ga0207650_10222549 3300025925 Bacteria 1519
128 Ga0207650_10230763 3300025925 Bacteria 1493
129 Ga0207659_10002932 3300025926 Bacteria 10163
130 Ga0207659_10004038 3300025926 Bacteria 8856
131 Ga0207659_10022255 3300025926 Bacteria 4219
132 Ga0207659_10141120 3300025926 Unclassified 1870
133 Ga0207659_10191360 3300025926 Bacteria 1629
134 Ga0207700_10045189 3300025928 Bacteria 3248
135 Ga0207644_10028665 3300025931 Bacteria 3857
136 Ga0207644_10038073 3300025931 Bacteria 3386
137 Ga0207706_10198510 3300025933 Bacteria 1760
138 Ga0207686_10001571 3300025934 Bacteria 12875
139 Ga0207709_10011720 3300025935 Bacteria 4834
140 Ga0207670_10079785 3300025936 Bacteria 2286
141 Ga0207669_10012293 3300025937 Bacteria 4204
142 Ga0207704_10132309 3300025938 Bacteria 1730
143 Ga0207711_10493527 3300025941 Bacteria 1141
144 Ga0207689_10002040 3300025942 Bacteria 19065
145 Ga0207689_10114462 3300025942 Bacteria 2217
146 Ga0207661_10002181 3300025944 Bacteria 13503
147 Ga0207661_10002276 3300025944 Bacteria 13232
148 Ga0207679_10004533 3300025945 Bacteria 8653
149 Ga0207679_10457350 3300025945 Bacteria 1133
150 Ga0207651_10005337 3300025960 Bacteria 6588
151 Ga0207651_10008951 3300025960 Bacteria 5438
152 Ga0207651_10047184 3300025960 Bacteria 2902
153 Ga0207651_10141802 3300025960 Bacteria 1857
154 Ga0207640_10016262 3300025981 Bacteria 4325
155 Ga0207640_10103058 3300025981 Unclassified 2005
156 Ga0207658_10072063 3300025986 Bacteria 2618
157 Ga0207658_10172528 3300025986 Bacteria 1783
158 Ga0207703_10025183 3300026035 Bacteria 4680
159 Ga0207703_10114662 3300026035 Bacteria 2305
160 Ga0207703_10497869 3300026035 Bacteria 1143
161 Ga0207678_10071137 3300026067 Bacteria 2982
162 Ga0207678_10081742 3300026067 Bacteria 2765
163 Ga0207678_10118339 3300026067 Bacteria 2261
164 Ga0207678_10226413 3300026067 Bacteria 1601
165 Ga0207648_10000656 3300026089 Bacteria 38712
166 Ga0207648_10001967 3300026089 Bacteria 22450
167 Ga0207676_10115345 3300026095 Bacteria 2255
168 Ga0207676_10183725 3300026095 Bacteria 1833
169 Ga0207674_10007406 3300026116 Bacteria 12787
170 Ga0207675_100011559 3300026118 Bacteria 8254
171 Ga0207675_100078466 3300026118 Bacteria 3094
172 Ga0207675_100098480 3300026118 Bacteria 2754
173 Ga0207683_10057913 3300026121 Bacteria 3401
174 Ga0207683_10076506 3300026121 Bacteria 2963
175 Ga0209813_10021140 3300027866 Bacteria 1827
176 Ga0268265_10409488 3300028380 Bacteria 1256
177 Ga0268264_10040369 3300028381 Bacteria 3856
178 Ga0307408_100021817 3300031548 Bacteria 4340
179 Ga0307405_10061578 3300031731 Bacteria 2373
180 Ga0307405_10263551 3300031731 Bacteria 1288
181 Ga0307413_10004561 3300031824 Bacteria 6047
182 Ga0307413_10016573 3300031824 Bacteria 3811
183 Ga0307410_10004146 3300031852 Bacteria 7431
184 Ga0307410_10043656 3300031852 Bacteria 2972
185 Ga0307410_10060428 3300031852 Bacteria 2590
186 Ga0307406_10240899 3300031901 Bacteria 1356
187 Ga0307407_10011913 3300031903 Bacteria 4160
188 Ga0307407_10069847 3300031903 Bacteria 2086
189 Ga0307412_10083210 3300031911 Bacteria 2218
190 Ga0307409_100040782 3300031995 Bacteria 3460
191 Ga0307409_100096949 3300031995 Bacteria 2434
192 Ga0307409_100141001 3300031995 Bacteria 2077
193 Ga0307409_100418369 3300031995 Bacteria 1285
194 Ga0307416_100010682 3300032002 Bacteria 6081
195 Ga0307416_100014629 3300032002 Bacteria 5387
196 Ga0307416_100137309 3300032002 Bacteria 2215
197 Ga0307414_10301361 3300032004 Bacteria 1356
198 Ga0307411_10013660 3300032005 Bacteria 4490
199 Ga0307411_10274058 3300032005 Bacteria 1339
200 Ga0307415_100108717 3300032126 Bacteria 2052
201 Ga0307415_100111838 3300032126 Bacteria 2028
202 Ga0373946_0076462 3300035171 Bacteria 1457
203 Ga0373935_0297008 3300035692 Bacteria 1141
204 Ga0373935_0302318 3300035692 Bacteria 1131
205 Ga0373933_0049442 3300035724 Bacteria 2507
206 Ga0373947_0056309 3300035725 Bacteria 2376
207 Ga0373937_0000467 3300036401 Bacteria 37384
208 Ga0373925_0001019 3300037068 Bacteria 25348
209 Ga0451853_3195364 3300041512 Bacteria 1004
210 Ga0450920_006852 3300042122 Bacteria 2054
211 Ga0450896_002784 3300042133 Bacteria 2281
212 Ga0450906_017279 3300042145 Bacteria 1302
213 Ga0439446_0014611 3300042156 Bacteria 2169
214 Ga0439446_0016019 3300042156 Bacteria 2085
215 Ga0450908_008706 3300042184 Bacteria 1897
216 Ga0439435_0003999 3300042436 Bacteria 3134
217 Ga0439435_0031232 3300042436 Bacteria 1447
218 Ga0451576_0014514 3300045051 Bacteria 8763
219 Ga0451576_0409746 3300045051 Bacteria 1422
220 Ga0495588_0070886 3300046674 Bacteria 1812
221 Ga0495647_0061041 3300046681 Bacteria 1488
222 Ga0495658_0017374 3300046683 Bacteria 3715
223 Ga0495658_0090411 3300046683 Bacteria 1812
224 Ga0496105_0237683 3300048908 Bacteria 1479
225 Ga0496106_0021008 3300048909 Bacteria 4846
226 Ga0496110_0002426 3300048913 Bacteria 13963
227 Ga0496110_0195078 3300048913 Bacteria 1839
228 Ga0496112_0013866 3300048915 Bacteria 7456
229 Ga0496112_0078717 3300048915 Bacteria 3260
230 Ga0496112_0098317 3300048915 Bacteria 2896
231 Ga0501034_0005318 3300049571 Bacteria 14110
232 Ga0501067_0065774 3300049583 Bacteria 2007
233 Ga0501069_0006047 3300049585 Bacteria 6320
234 Ga0501072_0309361 3300049588 Bacteria 1256
235 Ga0501073_0002679 3300049589 Bacteria 13335
236 Ga0501077_0168508 3300049593 Bacteria 1391
237 Ga0501081_0094017 3300049743 Bacteria 2112
238 nmdc:mga00v17_10538_c1 3300050491 Bacteria 5050
239 nmdc:mga00v17_7170_c1 3300050491 Bacteria 5939
240 nmdc:mga0k408_9915_c1 3300050493 Bacteria 5142
241 nmdc:mga06z11_16469_c1 3300050494 Bacteria 3331
242 nmdc:mga06z11_94177_c1 3300050494 Bacteria 1632
243 nmdc:mga07m45_8039_c1 3300050496 Bacteria 5408
244 nmdc:mga05p37_15560_c1 3300050507 Bacteria 9143
245 nmdc:mga05p37_76109_c1 3300050507 Bacteria 4132
246 nmdc:mga09592_40065_c1 3300050508 Bacteria 3936
247 nmdc:mga0qj67_36608_c1 3300050509 Bacteria 3841
248 nmdc:mga06r32_466424_c1 3300050510 Unclassified 1241
249 nmdc:mga08y16_113738_c1 3300050511 Bacteria 2817
250 nmdc:mga08y16_13406_c1 3300050511 Bacteria 8624
251 nmdc:mga08y16_650856_c1 3300050511 Bacteria 1058
252 nmdc:mga0n895_103378_c1 3300050512 Bacteria 2860
253 nmdc:mga0n895_308044_c1 3300050512 Bacteria 1605
254 nmdc:mga0n895_380500_c1 3300050512 Bacteria 1428
255 nmdc:mga0rr50_63173_c1 3300050513 Bacteria 2796
256 Ga0495601_0080486 3300053077 Bacteria 2090
257 Ga0501084_0127255 3300054114 Bacteria 2144
258 Ga0590071_000006 3300059421 Bacteria 60899
259 Ga0590071_002780 3300059421 Unclassified 4382
260 Ga0590075_000425 3300059424 Bacteria 11435
261 Ga0501082_0044587 3300060353 Bacteria 3825
262 Ga0501082_0132317 3300060353 Bacteria 2164
263 nmdc:mga09592_385441_c1
264 MBSR1b_contig_7380000
265 Ga0065712_10083971
266 Ga0065715_10095414
267 Ga0070676_10249602
268 Ga0070683_100004649
269 Ga0070683_100008702
270 Ga0070690_100008723
271 Ga0070690_100055269
272 Ga0070670_100003257
273 Ga0070670_100008786
274 Ga0070670_100043132
275 Ga0070670_100057466
276 Ga0068869_100001284
277 Ga0068869_100075523
278 Ga0068869_100079032
279 Ga0070666_10379936
280 Ga0070682_100264780
281 Ga0068868_100041634
282 Ga0070689_100229045
283 Ga0070687_100086431
284 Ga0070669_100054757
285 Ga0070675_100003397
286 Ga0070675_100004188
287 Ga0070675_100026607
288 Ga0070671_100148527
289 Ga0070674_100007783
290 Ga0070674_100040341
291 Ga0070674_100417317
292 Ga0070673_100001008
293 Ga0070673_100003896
294 Ga0070673_100028267
295 Ga0070673_100084493
296 Ga0070673_100225273
297 Ga0070659_100162659
298 Ga0070667_100093482
299 Ga0070667_100135498
300 Ga0070667_100197689
301 Ga0070713_100060485
302 Ga0070701_10054178
303 Ga0070701_10061561
304 Ga0070705_100037573
305 Ga0070700_100003626
306 Ga0070700_100072218
307 Ga0070700_100341727
308 Ga0070694_100089091
309 Ga0070694_100212414
310 Ga0070678_100172729
311 Ga0070678_100216777
312 Ga0070662_100208495
313 Ga0068867_100000727
314 Ga0068867_100013756
315 Ga0068867_100376074
316 Ga0070698_100282239
317 Ga0070699_100283910
318 Ga0070684_100000742
319 Ga0070684_100049997
320 Ga0070672_100010398
321 Ga0070672_100012266
322 Ga0070672_100046422
323 Ga0070686_100021170
324 Ga0070686_100308151
325 Ga0070696_100131546
326 Ga0070665_100628246
327 Ga0070664_100011107
328 Ga0068857_100052682
329 Ga0068864_100105899
330 Ga0068864_100168501
331 Ga0068864_100214247
332 Ga0068861_100015572
333 Ga0068851_10076220
334 Ga0068858_100027792
335 Ga0068860_100023545
336 Ga0081455_10144728
337 Ga0070717_10063875
338 Ga0075368_10010554
339 Ga0075368_10035758
340 Ga0075364_10005395
341 Ga0075362_10000445
342 Ga0075367_10000523
343 Ga0075367_10035222
344 Ga0075366_10005382
345 Ga0075370_10003726
346 Ga0068871_100088630
347 Ga0075430_100003978
348 Ga0075431_100045451
349 Ga0075433_10034153
350 Ga0075434_100409542
351 Ga0075429_100346239
352 Ga0068865_100002427
353 Ga0068865_100142439
354 Ga0075435_100000143
355 Ga0111539_10671391
356 Ga0114129_10004403
357 Ga0114129_10029886
358 Ga0105243_10015028
359 Ga0105243_10022812
360 Ga0105241_10355765
361 Ga0105242_10001547
362 Ga0105248_10017073
363 Ga0105238_10161657
364 Ga0157378_10266014
365 Ga0157375_10016849
366 Ga0157375_10094013
367 Ga0163163_10000417
368 Ga0163163_10055002
369 Ga0163163_10132297
370 Ga0157380_10007225
371 Ga0157380_10042548
372 Ga0157380_10189792
373 Ga0157377_10011912
374 Ga0157376_10212312
375 Ga0207697_10003995
376 Ga0207656_10051626
377 Ga0207688_10017536
378 Ga0207688_10055719
379 Ga0207680_10149365
380 Ga0207654_10025188
381 Ga0207662_10003633
382 Ga0207662_10030261
383 Ga0207681_10040679
384 Ga0207694_10068521
385 Ga0207650_10003136
386 Ga0207650_10007644
387 Ga0207650_10061283
388 Ga0207650_10074359
389 Ga0207650_10222549
390 Ga0207650_10230763
391 Ga0207659_10002932
392 Ga0207659_10004038
393 Ga0207659_10022255
394 Ga0207659_10141120
395 Ga0207659_10191360
396 Ga0207700_10045189
397 Ga0207644_10028665
398 Ga0207644_10038073
399 Ga0207706_10198510
400 Ga0207686_10001571
401 Ga0207709_10011720
402 Ga0207670_10079785
403 Ga0207669_10012293
404 Ga0207704_10132309
405 Ga0207711_10493527
406 Ga0207689_10002040
407 Ga0207689_10114462
408 Ga0207661_10002181
409 Ga0207661_10002276
410 Ga0207679_10004533
411 Ga0207679_10457350
412 Ga0207651_10005337
413 Ga0207651_10008951
414 Ga0207651_10047184
415 Ga0207651_10141802
416 Ga0207640_10016262
417 Ga0207640_10103058
418 Ga0207658_10072063
419 Ga0207658_10172528
420 Ga0207703_10025183
421 Ga0207703_10114662
422 Ga0207703_10497869
423 Ga0207678_10071137
424 Ga0207678_10081742
425 Ga0207678_10118339
426 Ga0207678_10226413
427 Ga0207648_10000656
428 Ga0207648_10001967
429 Ga0207676_10115345
430 Ga0207676_10183725
431 Ga0207674_10007406
432 Ga0207675_100011559
433 Ga0207675_100078466
434 Ga0207675_100098480
435 Ga0207683_10057913
436 Ga0207683_10076506
437 Ga0209813_10021140
438 Ga0268265_10409488
439 Ga0268264_10040369
440 Ga0307408_100021817
441 Ga0307405_10061578
442 Ga0307405_10263551
443 Ga0307413_10004561
444 Ga0307413_10016573
445 Ga0307410_10004146
446 Ga0307410_10043656
447 Ga0307410_10060428
448 Ga0307406_10240899
449 Ga0307407_10011913
450 Ga0307407_10069847
451 Ga0307412_10083210
452 Ga0307409_100040782
453 Ga0307409_100096949
454 Ga0307409_100141001
455 Ga0307409_100418369
456 Ga0307416_100010682
457 Ga0307416_100014629
458 Ga0307416_100137309
459 Ga0307414_10301361
460 Ga0307411_10013660
461 Ga0307411_10274058
462 Ga0307415_100108717
463 Ga0307415_100111838
464 Ga0373946_0076462
465 Ga0373935_0297008
466 Ga0373935_0302318
467 Ga0373933_0049442
468 Ga0373947_0056309
469 Ga0373937_0000467
470 Ga0373925_0001019
471 Ga0451853_3195364
472 Ga0450920_006852
473 Ga0450896_002784
474 Ga0450906_017279
475 Ga0439446_0014611
476 Ga0439446_0016019
477 Ga0450908_008706
478 Ga0439435_0003999
479 Ga0439435_0031232
480 Ga0451576_0014514
481 Ga0451576_0409746
482 Ga0495588_0070886
483 Ga0495647_0061041
484 Ga0495658_0017374
485 Ga0495658_0090411
486 Ga0496105_0237683
487 Ga0496106_0021008
488 Ga0496110_0002426
489 Ga0496110_0195078
490 Ga0496112_0013866
491 Ga0496112_0078717
492 Ga0496112_0098317
493 Ga0501034_0005318
494 Ga0501067_0065774
495 Ga0501069_0006047
496 Ga0501072_0309361
497 Ga0501073_0002679
498 Ga0501077_0168508
499 Ga0501081_0094017
500 nmdc:mga00v17_10538_c1
501 nmdc:mga00v17_7170_c1
502 nmdc:mga0k408_9915_c1
503 nmdc:mga06z11_16469_c1
504 nmdc:mga06z11_94177_c1
505 nmdc:mga07m45_8039_c1
506 nmdc:mga05p37_15560_c1
507 nmdc:mga05p37_76109_c1
508 nmdc:mga09592_40065_c1
509 nmdc:mga0qj67_36608_c1
510 nmdc:mga06r32_466424_c1
511 nmdc:mga08y16_113738_c1
512 nmdc:mga08y16_13406_c1
513 nmdc:mga08y16_650856_c1
514 nmdc:mga0n895_103378_c1
515 nmdc:mga0n895_308044_c1
516 nmdc:mga0n895_380500_c1
517 nmdc:mga0rr50_63173_c1
518 Ga0495601_0080486
519 Ga0501084_0127255
520 Ga0590071_000006
521 Ga0590071_002780
522 Ga0590075_000425
523 Ga0501082_0044587
524 Ga0501082_0132317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

14

296

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9493 1 296
3iau-assembly1.cif.gz_A the structure of the processed form of threonine deaminase isoform 2 from solanum lycopersicum 0.946 7 296
2zpu-assembly1.cif.gz_A crystal structure of modified serine racemase from s.pombe. 0.9444 6 294
3l6b-assembly1.cif.gz_A x-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor 0.9288 5 294
1ve5-assembly1.cif.gz_A crystal structure of t.th. hb8 threonine deaminase 0.9284 6 288
ID Description Score Start End Superfamily
af_P36007_52_148_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9613 51 144 3.40.50.1100
af_Q9VHF0_106_202_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9583 51 143 3.40.50.1100
2gn1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9566 52 146 3.40.50.1100
2gn1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9376 52 146 3.40.50.1100
af_P9WG95_65_164_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9341 51 146 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A381RIS1-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9714 1 181 GO:0003941
GO:0006565
GO:0009097
GO:0030170
AF-A0A7K4FXQ7-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9712 3 175 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-B0EK73-F1-model_v4 Threonine dehydratase catabolic, putative (EC 4.3.1.19) 0.9705 7 200 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A2V9RQI8-F1-model_v4 Threonine ammonia-lyase 0.9705 34 227 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A7V5N249-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9701 4 187 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097

Map