F371372

General Info

Members Datasets Scaffolds Average Seq Length
262 179 524 333

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0300906|Ga0496110_0300906_269_1444
Length 375
Sequence MTPPSFHVPEAALRRFRARQTLPPTTQIRRLRKPPHIIDRAVTSVARRHWAAASGYQVSQAIHVAVTLGIPDLLAHGPVPSCDVAAATDAHPDALYRLLRALASIGVLHEDEQSRFSLTDAGDGLRTDAPGSLAGWAAFVGSPAHSQAWGHLLHSVRSGENAFCAVHGVDVWAYRVDHPQEGAIFDRAMASLTGFAHASLLAAYDFSRFRTVVDVGGGRGALLAALLPAHPALEGVLFDQPQVVAGAEEVLSDAGLTARCQIVGGSFFDSVPKGGDAYLLKSILHDWQDEQAVTILRACRRAIDADGTLLVIERVLAPPNEGPEAKFSDLNMLVSAGGRERTREAFEELLRAGDFRLDDETPTSSGLSVIAARPA

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
162 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
163 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
164 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
165 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
169 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
170 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
171 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
172 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
173 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
174 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
175 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
176 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
179 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0
Isolates 4.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 3.05
Rhizoplane 16.03
Rhizosphere 73.28
Stem 0
Stem Tuber 0
Unclassified 12.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0300906 3300048913 Unclassified 1461
2 ARcpr5oldR_c000359 3300000041 Bacteria 6423
3 Ga0065715_10175922 3300005293 Bacteria 1512
4 Ga0070683_100010981 3300005329 Bacteria 7803
5 Ga0070683_100070352 3300005329 Unclassified 3263
6 Ga0070680_100104259 3300005336 Bacteria 2356
7 Ga0068868_100200893 3300005338 Bacteria 1662
8 Ga0070689_100188254 3300005340 Unclassified 1680
9 Ga0070675_100070324 3300005354 Archaea 2900
10 Ga0070659_100143896 3300005366 Unclassified 1942
11 Ga0070714_100420062 3300005435 Bacteria 1267
12 Ga0070711_100206221 3300005439 Bacteria 1520
13 Ga0070705_100277046 3300005440 Unclassified 1191
14 Ga0070700_100164735 3300005441 Bacteria 1530
15 Ga0070663_100043082 3300005455 Bacteria 3174
16 Ga0070678_100048913 3300005456 Bacteria 3048
17 Ga0070678_100271676 3300005456 Bacteria 1430
18 Ga0070678_100280666 3300005456 Bacteria 1408
19 Ga0070681_10154436 3300005458 Bacteria 2221
20 Ga0070681_10158059 3300005458 Bacteria 2191
21 Ga0070706_100002724 3300005467 Bacteria 17663
22 Ga0070706_100237736 3300005467 Bacteria 1701
23 Ga0070707_100009662 3300005468 Bacteria 8966
24 Ga0070698_100185242 3300005471 Bacteria 2020
25 Ga0070698_100294051 3300005471 Bacteria 1555
26 Ga0070698_100361018 3300005471 Unclassified 1384
27 Ga0070672_100019884 3300005543 Bacteria 4885
28 Ga0070696_100134799 3300005546 Bacteria 1800
29 Ga0070693_100008116 3300005547 Bacteria 5157
30 Ga0070665_100241596 3300005548 Bacteria 1806
31 Ga0070665_100345607 3300005548 Bacteria 1493
32 Ga0070664_100178476 3300005564 Unclassified 1887
33 Ga0070702_100008234 3300005615 Bacteria 5039
34 Ga0068852_100259589 3300005616 Bacteria 1668
35 Ga0068864_100076130 3300005618 Bacteria 2931
36 Ga0068870_10010303 3300005840 Bacteria 4289
37 Ga0068858_100068086 3300005842 Bacteria 3298
38 Ga0068858_100388095 3300005842 Unclassified 1340
39 Ga0081540_1003603 3300005983 Bacteria 12154
40 Ga0070717_10001807 3300006028 Bacteria 14949
41 Ga0070717_10196922 3300006028 Bacteria 1763
42 Ga0070712_100004912 3300006175 Bacteria 8265
43 Ga0097621_100135641 3300006237 Unclassified 2099
44 Ga0097621_100157155 3300006237 Bacteria 1952
45 Ga0097621_100287150 3300006237 Bacteria 1449
46 Ga0068871_100193261 3300006358 Bacteria 1754
47 Ga0068865_100018939 3300006881 Bacteria 4450
48 Ga0068865_100181311 3300006881 Bacteria 1622
49 Ga0105240_10125914 3300009093 Bacteria 3079
50 Ga0105245_10061635 3300009098 Bacteria 3382
51 Ga0105245_10075950 3300009098 Archaea 3060
52 Ga0105245_10192795 3300009098 Bacteria 1953
53 Ga0105245_10452524 3300009098 Unclassified 1293
54 Ga0105247_10009345 3300009101 Bacteria 5953
55 Ga0105243_10199840 3300009148 Bacteria 1752
56 Ga0105241_10279176 3300009174 Unclassified 1426
57 Ga0105242_10055508 3300009176 Bacteria 3240
58 Ga0105242_10244130 3300009176 Bacteria 1616
59 Ga0105248_10012844 3300009177 Bacteria 9238
60 Ga0105238_10448929 3300009551 Bacteria 1286
61 Ga0105239_10105688 3300010375 Bacteria 3118
62 Ga0157370_10007389 3300013104 Bacteria 11970
63 Ga0157374_10350128 3300013296 Bacteria 1468
64 Ga0163162_10042796 3300013306 Bacteria 4534
65 Ga0163162_10088607 3300013306 Bacteria 3174
66 Ga0157375_10036713 3300013308 Bacteria 4690
67 Ga0157375_10137156 3300013308 Unclassified 2572
68 Ga0157375_10303485 3300013308 Bacteria 1760
69 Ga0163163_10079993 3300014325 Bacteria 3267
70 Ga0157377_10012382 3300014745 Bacteria 4290
71 Ga0157377_10023822 3300014745 Unclassified 3248
72 Ga0157377_10147795 3300014745 Bacteria 1450
73 Ga0157379_10147646 3300014968 Bacteria 2120
74 Ga0157376_10033804 3300014969 Bacteria 4121
75 Ga0157376_10124233 3300014969 Bacteria 2292
76 Ga0207688_10012526 3300025901 Archaea 4616
77 Ga0207684_10009327 3300025910 Bacteria 8672
78 Ga0207707_10075377 3300025912 Bacteria 2943
79 Ga0207707_10387055 3300025912 Bacteria 1201
80 Ga0207695_10271073 3300025913 Bacteria 1593
81 Ga0207693_10004781 3300025915 Bacteria 11392
82 Ga0207693_10247506 3300025915 Bacteria 1399
83 Ga0207663_10208391 3300025916 Bacteria 1415
84 Ga0207660_10154506 3300025917 Bacteria 1766
85 Ga0207659_10223449 3300025926 Bacteria 1515
86 Ga0207687_10183587 3300025927 Bacteria 1622
87 Ga0207644_10082719 3300025931 Bacteria 2376
88 Ga0207686_10204813 3300025934 Bacteria 1415
89 Ga0207669_10053323 3300025937 Unclassified 2435
90 Ga0207669_10097879 3300025937 Bacteria 1930
91 Ga0207704_10012759 3300025938 Archaea 4178
92 Ga0207691_10010005 3300025940 Bacteria 9106
93 Ga0207691_10147963 3300025940 Unclassified 2066
94 Ga0207711_10039921 3300025941 Bacteria 3992
95 Ga0207711_10089470 3300025941 Bacteria 2705
96 Ga0207689_10028492 3300025942 Archaea 4673
97 Ga0207661_10050185 3300025944 Archaea 3323
98 Ga0207661_10217943 3300025944 Unclassified 1685
99 Ga0207661_10242964 3300025944 Unclassified 1598
100 Ga0207667_10056864 3300025949 Bacteria 4107
101 Ga0207677_10045627 3300026023 Bacteria 2927
102 Ga0207677_10045957 3300026023 Bacteria 2920
103 Ga0207703_10012310 3300026035 Bacteria 6668
104 Ga0207639_10190097 3300026041 Bacteria 1753
105 Ga0207678_10208577 3300026067 Bacteria 1671
106 Ga0207708_10009452 3300026075 Archaea 7219
107 Ga0207702_10393529 3300026078 Unclassified 1335
108 Ga0207648_10217187 3300026089 Bacteria 1698
109 Ga0207676_10057461 3300026095 Bacteria 3064
110 Ga0207683_10067919 3300026121 Bacteria 3145
111 Ga0207683_10071014 3300026121 Bacteria 3077
112 Ga0207683_10161347 3300026121 Bacteria 2027
113 Ga0268266_10217148 3300028379 Bacteria 1756
114 Ga0307509_10012709 3300031507 Bacteria 10037
115 Ga0307516_10016851 3300031730 Bacteria 7628
116 Ga0307510_10021727 3300033180 Bacteria 7473
117 Ga0373932_0008346 3300035112 Bacteria 2474
118 Ga0373945_0092233 3300035116 Bacteria 1174
119 Ga0373931_0004179 3300035691 Bacteria 6567
120 Ga0373931_0004724 3300035691 Bacteria 6240
121 Ga0373935_0234934 3300035692 Unclassified 1278
122 Ga0373935_0280553 3300035692 Bacteria 1173
123 Ga0373927_0063447 3300035695 Bacteria 2389
124 Ga0395900_0148504 3300037418 Bacteria 2396
125 Ga0395898_0218161 3300037466 Bacteria 1820
126 Ga0395901_0222958 3300038443 Bacteria 1970
127 Ga0395901_0306458 3300038443 Bacteria 1646
128 Ga0436362_0151205 3300039453 Bacteria 2628
129 Ga0466964_0075558 3300044706 Bacteria 1435
130 Ga0495603_0084913 3300046455 Bacteria 1854
131 Ga0495580_0009353 3300046472 Bacteria 7709
132 Ga0495582_0010327 3300046473 Bacteria 5138
133 Ga0495639_0028788 3300046475 Bacteria 2462
134 Ga0495664_0010750 3300046477 Bacteria 5145
135 Ga0495606_0107925 3300046507 Bacteria 1683
136 Ga0495628_0392321 3300046516 Bacteria 1015
137 Ga0495630_0018683 3300046517 Bacteria 5092
138 Ga0495630_0143876 3300046517 Unclassified 1813
139 Ga0495586_0067445 3300046535 Unclassified 1951
140 Ga0495622_0017739 3300046557 Bacteria 3313
141 Ga0495634_0019762 3300046642 Bacteria 4782
142 Ga0495634_0050265 3300046642 Bacteria 2801
143 Ga0495635_0039061 3300046663 Bacteria 3286
144 Ga0495624_0188225 3300046690 Bacteria 1256
145 Ga0495624_0198206 3300046690 Unclassified 1220
146 Ga0495589_0094267 3300046794 Bacteria 1453
147 Ga0495581_0134871 3300047315 Bacteria 1439
148 Ga0495604_0004921 3300047317 Bacteria 10593
149 Ga0495674_0031286 3300047319 Bacteria 4835
150 Ga0495672_0037283 3300047320 Bacteria 2976
151 Ga0495676_0034019 3300047321 Bacteria 4281
152 Ga0495676_0087232 3300047321 Unclassified 2346
153 Ga0495680_0054142 3300047322 Bacteria 3117
154 Ga0495684_0289929 3300047471 Bacteria 1178
155 Ga0495593_0076296 3300047673 Bacteria 1737
156 Ga0496100_0074722 3300048903 Bacteria 2271
157 Ga0496100_0277305 3300048903 Bacteria 1249
158 Ga0496100_0393949 3300048903 Unclassified 1054
159 Ga0496101_0202891 3300048904 Unclassified 1534
160 Ga0496102_0015163 3300048905 Bacteria 6708
161 Ga0496102_0257602 3300048905 Unclassified 1645
162 Ga0496102_0291541 3300048905 Bacteria 1538
163 Ga0496103_0025133 3300048906 Bacteria 3598
164 Ga0496103_0209325 3300048906 Bacteria 1254
165 Ga0496104_0016025 3300048907 Bacteria 6805
166 Ga0496104_0025761 3300048907 Bacteria 5424
167 Ga0496104_0066503 3300048907 Bacteria 3422
168 Ga0496104_0291408 3300048907 Bacteria 1545
169 Ga0496104_0396652 3300048907 Bacteria 1292
170 Ga0496105_0005818 3300048908 Bacteria 9406
171 Ga0496105_0059534 3300048908 Bacteria 3151
172 Ga0496106_0051187 3300048909 Bacteria 3114
173 Ga0496106_0053326 3300048909 Bacteria 3054
174 Ga0496107_0013518 3300048910 Bacteria 5707
175 Ga0496107_0050893 3300048910 Bacteria 2986
176 Ga0496107_0252119 3300048910 Bacteria 1313
177 Ga0496108_0007032 3300048911 Bacteria 9112
178 Ga0496108_0015279 3300048911 Bacteria 6265
179 Ga0496108_0360190 3300048911 Bacteria 1269
180 Ga0496109_0040402 3300048912 Bacteria 4225
181 Ga0496109_0067516 3300048912 Bacteria 3276
182 Ga0496109_0080669 3300048912 Bacteria 2998
183 Ga0496109_0088830 3300048912 Bacteria 2856
184 Ga0496109_0179482 3300048912 Bacteria 1988
185 Ga0496109_0599162 3300048912 Unclassified 1038
186 Ga0496110_0006471 3300048913 Bacteria 9283
187 Ga0496110_0051512 3300048913 Bacteria 3617
188 Ga0496111_0007335 3300048914 Bacteria 7217
189 Ga0496111_0011522 3300048914 Bacteria 5961
190 Ga0496111_0122851 3300048914 Unclassified 1918
191 Ga0496112_0009837 3300048915 Bacteria 8639
192 Ga0496112_0063296 3300048915 Bacteria 3648
193 Ga0496113_0015525 3300048916 Bacteria 5238
194 Ga0496113_0084388 3300048916 Bacteria 2438
195 Ga0496114_0004485 3300048917 Bacteria 10833
196 Ga0496115_0006101 3300048918 Bacteria 8805
197 Ga0496119_0005687 3300048922 Bacteria 11824
198 Ga0496120_0005718 3300048923 Bacteria 9805
199 Ga0496121_0002568 3300048924 Bacteria 27489
200 Ga0496124_0175419 3300048927 Bacteria 1655
201 Ga0496125_0108960 3300048928 Bacteria 2012
202 Ga0496126_0014934 3300048929 Bacteria 7830
203 Ga0501032_0043584 3300049569 Bacteria 3038
204 Ga0501032_0185136 3300049569 Bacteria 1362
205 Ga0501033_0080686 3300049570 Bacteria 2386
206 Ga0501036_0003342 3300049572 Bacteria 12817
207 Ga0501036_0005001 3300049572 Bacteria 10726
208 Ga0501037_0251422 3300049573 Unclassified 1237
209 Ga0501038_0055881 3300049574 Bacteria 3390
210 Ga0501038_0126585 3300049574 Bacteria 2102
211 Ga0501039_0057272 3300049575 Bacteria 3018
212 Ga0501039_0067929 3300049575 Bacteria 2767
213 Ga0501040_0009231 3300049576 Bacteria 6422
214 Ga0501040_0131729 3300049576 Unclassified 1758
215 Ga0501041_0033721 3300049577 Bacteria 3098
216 Ga0501041_0035665 3300049577 Bacteria 3013
217 Ga0501042_0009069 3300049578 Bacteria 6614
218 Ga0501042_0032600 3300049578 Bacteria 3690
219 Ga0501043_0090166 3300049579 Bacteria 2410
220 Ga0501043_0256758 3300049579 Unclassified 1345
221 Ga0501046_0010202 3300049580 Bacteria 8084
222 Ga0501048_0006390 3300049582 Bacteria 8960
223 Ga0501048_0033736 3300049582 Bacteria 3696
224 Ga0501068_0018690 3300049584 Bacteria 4015
225 Ga0501069_0127798 3300049585 Bacteria 1454
226 Ga0501071_0004492 3300049587 Bacteria 8853
227 Ga0501071_0023787 3300049587 Bacteria 4280
228 Ga0501072_0006439 3300049588 Bacteria 8940
229 Ga0501073_0055061 3300049589 Bacteria 2784
230 Ga0501073_0217510 3300049589 Unclassified 1320
231 Ga0501074_0004488 3300049590 Bacteria 9990
232 Ga0501074_0056750 3300049590 Bacteria 2822
233 Ga0501079_0010538 3300049741 Bacteria 7028
234 Ga0501079_0076476 3300049741 Bacteria 2589
235 Ga0501081_0019704 3300049743 Bacteria 4494
236 Ga0501083_0020649 3300049744 Bacteria 4580
237 Ga0501035_0029997 3300049822 Bacteria 4960
238 Ga0501035_0065920 3300049822 Bacteria 3214
239 Ga0501045_0005819 3300049824 Bacteria 8536
240 Ga0501045_0019226 3300049824 Bacteria 4866
241 nmdc:mga0yw44_14362_c1 3300050492 Bacteria 4204
242 Ga0500610_0121389 3300053079 Archaea 1336
243 Ga0500554_001317 3300053102 Bacteria 4805
244 Ga0500603_000099 3300053150 Bacteria 20576
245 Ga0500636_0059277 3300053177 Bacteria 2237
246 Ga0500637_0000768 3300053178 Bacteria 12889
247 Ga0500637_0033980 3300053178 Bacteria 2851
248 Ga0501084_0002055 3300054114 Bacteria 16065
249 Ga0501084_0035986 3300054114 Bacteria 4137
250 Ga0530510_0020787 3300061734 Archaea 4668
251 2513623025 2513237092 Bacteria 8341956
252 2824608620 2824600985 Bacteria 8488197
253 2824617635 2824609381 Bacteria 8672835
254 2888425289 2888419890 Bacteria 7857137
255 2935653166 2935648319 Bacteria 8801166
256 2935661749 2935656913 Bacteria 8965014
257 2936015894 2936011229 Bacteria 8801034
258 2936024669 2936019824 Bacteria 8804134
259 2936033900 2936028420 Bacteria 8965941
260 2936051637 2936046547 Bacteria 8903709
261 3005592630 3005587118 Bacteria 7794411
262 8019670287 8019668869 Bacteria 8791617
263 Ga0496110_0300906
264 ARcpr5oldR_c000359
265 Ga0065715_10175922
266 Ga0070683_100010981
267 Ga0070683_100070352
268 Ga0070680_100104259
269 Ga0068868_100200893
270 Ga0070689_100188254
271 Ga0070675_100070324
272 Ga0070659_100143896
273 Ga0070714_100420062
274 Ga0070711_100206221
275 Ga0070705_100277046
276 Ga0070700_100164735
277 Ga0070663_100043082
278 Ga0070678_100048913
279 Ga0070678_100271676
280 Ga0070678_100280666
281 Ga0070681_10154436
282 Ga0070681_10158059
283 Ga0070706_100002724
284 Ga0070706_100237736
285 Ga0070707_100009662
286 Ga0070698_100185242
287 Ga0070698_100294051
288 Ga0070698_100361018
289 Ga0070672_100019884
290 Ga0070696_100134799
291 Ga0070693_100008116
292 Ga0070665_100241596
293 Ga0070665_100345607
294 Ga0070664_100178476
295 Ga0070702_100008234
296 Ga0068852_100259589
297 Ga0068864_100076130
298 Ga0068870_10010303
299 Ga0068858_100068086
300 Ga0068858_100388095
301 Ga0081540_1003603
302 Ga0070717_10001807
303 Ga0070717_10196922
304 Ga0070712_100004912
305 Ga0097621_100135641
306 Ga0097621_100157155
307 Ga0097621_100287150
308 Ga0068871_100193261
309 Ga0068865_100018939
310 Ga0068865_100181311
311 Ga0105240_10125914
312 Ga0105245_10061635
313 Ga0105245_10075950
314 Ga0105245_10192795
315 Ga0105245_10452524
316 Ga0105247_10009345
317 Ga0105243_10199840
318 Ga0105241_10279176
319 Ga0105242_10055508
320 Ga0105242_10244130
321 Ga0105248_10012844
322 Ga0105238_10448929
323 Ga0105239_10105688
324 Ga0157370_10007389
325 Ga0157374_10350128
326 Ga0163162_10042796
327 Ga0163162_10088607
328 Ga0157375_10036713
329 Ga0157375_10137156
330 Ga0157375_10303485
331 Ga0163163_10079993
332 Ga0157377_10012382
333 Ga0157377_10023822
334 Ga0157377_10147795
335 Ga0157379_10147646
336 Ga0157376_10033804
337 Ga0157376_10124233
338 Ga0207688_10012526
339 Ga0207684_10009327
340 Ga0207707_10075377
341 Ga0207707_10387055
342 Ga0207695_10271073
343 Ga0207693_10004781
344 Ga0207693_10247506
345 Ga0207663_10208391
346 Ga0207660_10154506
347 Ga0207659_10223449
348 Ga0207687_10183587
349 Ga0207644_10082719
350 Ga0207686_10204813
351 Ga0207669_10053323
352 Ga0207669_10097879
353 Ga0207704_10012759
354 Ga0207691_10010005
355 Ga0207691_10147963
356 Ga0207711_10039921
357 Ga0207711_10089470
358 Ga0207689_10028492
359 Ga0207661_10050185
360 Ga0207661_10217943
361 Ga0207661_10242964
362 Ga0207667_10056864
363 Ga0207677_10045627
364 Ga0207677_10045957
365 Ga0207703_10012310
366 Ga0207639_10190097
367 Ga0207678_10208577
368 Ga0207708_10009452
369 Ga0207702_10393529
370 Ga0207648_10217187
371 Ga0207676_10057461
372 Ga0207683_10067919
373 Ga0207683_10071014
374 Ga0207683_10161347
375 Ga0268266_10217148
376 Ga0307509_10012709
377 Ga0307516_10016851
378 Ga0307510_10021727
379 Ga0373932_0008346
380 Ga0373945_0092233
381 Ga0373931_0004179
382 Ga0373931_0004724
383 Ga0373935_0234934
384 Ga0373935_0280553
385 Ga0373927_0063447
386 Ga0395900_0148504
387 Ga0395898_0218161
388 Ga0395901_0222958
389 Ga0395901_0306458
390 Ga0436362_0151205
391 Ga0466964_0075558
392 Ga0495603_0084913
393 Ga0495580_0009353
394 Ga0495582_0010327
395 Ga0495639_0028788
396 Ga0495664_0010750
397 Ga0495606_0107925
398 Ga0495628_0392321
399 Ga0495630_0018683
400 Ga0495630_0143876
401 Ga0495586_0067445
402 Ga0495622_0017739
403 Ga0495634_0019762
404 Ga0495634_0050265
405 Ga0495635_0039061
406 Ga0495624_0188225
407 Ga0495624_0198206
408 Ga0495589_0094267
409 Ga0495581_0134871
410 Ga0495604_0004921
411 Ga0495674_0031286
412 Ga0495672_0037283
413 Ga0495676_0034019
414 Ga0495676_0087232
415 Ga0495680_0054142
416 Ga0495684_0289929
417 Ga0495593_0076296
418 Ga0496100_0074722
419 Ga0496100_0277305
420 Ga0496100_0393949
421 Ga0496101_0202891
422 Ga0496102_0015163
423 Ga0496102_0257602
424 Ga0496102_0291541
425 Ga0496103_0025133
426 Ga0496103_0209325
427 Ga0496104_0016025
428 Ga0496104_0025761
429 Ga0496104_0066503
430 Ga0496104_0291408
431 Ga0496104_0396652
432 Ga0496105_0005818
433 Ga0496105_0059534
434 Ga0496106_0051187
435 Ga0496106_0053326
436 Ga0496107_0013518
437 Ga0496107_0050893
438 Ga0496107_0252119
439 Ga0496108_0007032
440 Ga0496108_0015279
441 Ga0496108_0360190
442 Ga0496109_0040402
443 Ga0496109_0067516
444 Ga0496109_0080669
445 Ga0496109_0088830
446 Ga0496109_0179482
447 Ga0496109_0599162
448 Ga0496110_0006471
449 Ga0496110_0051512
450 Ga0496111_0007335
451 Ga0496111_0011522
452 Ga0496111_0122851
453 Ga0496112_0009837
454 Ga0496112_0063296
455 Ga0496113_0015525
456 Ga0496113_0084388
457 Ga0496114_0004485
458 Ga0496115_0006101
459 Ga0496119_0005687
460 Ga0496120_0005718
461 Ga0496121_0002568
462 Ga0496124_0175419
463 Ga0496125_0108960
464 Ga0496126_0014934
465 Ga0501032_0043584
466 Ga0501032_0185136
467 Ga0501033_0080686
468 Ga0501036_0003342
469 Ga0501036_0005001
470 Ga0501037_0251422
471 Ga0501038_0055881
472 Ga0501038_0126585
473 Ga0501039_0057272
474 Ga0501039_0067929
475 Ga0501040_0009231
476 Ga0501040_0131729
477 Ga0501041_0033721
478 Ga0501041_0035665
479 Ga0501042_0009069
480 Ga0501042_0032600
481 Ga0501043_0090166
482 Ga0501043_0256758
483 Ga0501046_0010202
484 Ga0501048_0006390
485 Ga0501048_0033736
486 Ga0501068_0018690
487 Ga0501069_0127798
488 Ga0501071_0004492
489 Ga0501071_0023787
490 Ga0501072_0006439
491 Ga0501073_0055061
492 Ga0501073_0217510
493 Ga0501074_0004488
494 Ga0501074_0056750
495 Ga0501079_0010538
496 Ga0501079_0076476
497 Ga0501081_0019704
498 Ga0501083_0020649
499 Ga0501035_0029997
500 Ga0501035_0065920
501 Ga0501045_0005819
502 Ga0501045_0019226
503 nmdc:mga0yw44_14362_c1
504 Ga0500610_0121389
505 Ga0500554_001317
506 Ga0500603_000099
507 Ga0500636_0059277
508 Ga0500637_0000768
509 Ga0500637_0033980
510 Ga0501084_0002055
511 Ga0501084_0035986
512 Ga0530510_0020787
513 2513623025
514 2824608620
515 2824617635
516 2888425289
517 2935653166
518 2935661749
519 2936015894
520 2936024669
521 2936033900
522 2936051637
523 3005592630
524 8019670287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00891

Methyltransf_2

O-methyltransferase domain

149

356

0.96

PF08100

Dimerisation

Dimerisation domain

43

128

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a6d-assembly1.cif.gz_A crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam 0.9269 14 345
8h3t-assembly1.cif.gz_B the crystal structure of alph 0.8959 5 345
6i6n-assembly1.cif.gz_A papaver somniferum o-methyltransferase 1 0.8955 21 344
6c5b-assembly1.cif.gz_B crystal structure analysis of laphzm 0.8954 16 345
6i6n-assembly1.cif.gz_B papaver somniferum o-methyltransferase 1 0.8953 21 344
ID Description Score Start End Superfamily
af_Q8T638_12_103_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9463 22 96 1.10.10.10
6clwA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9363 164 345 3.40.50.150
af_A3KNM1_99_348_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9347 101 344 3.40.50.150
3gwzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9347 19 98 1.10.10.10
3i53A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.934 32 110 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A534ZI61-F1-model_v4 SAM-dependent methyltransferase 0.9779 233 345 GO:0008171
GO:0032259
AF-A0A0D5X1A0-F1-model_v4 deleted 0.9657 30 345
AF-A0A7W0KWF8-F1-model_v4 Hydroxyneurosporene methyltransferase 0.9561 16 345 GO:0008171
GO:0032259
AF-A0A0D5X1A0-F1-model_v4 deleted 0.9539 30 345
AF-A0A7K2MXI2-F1-model_v4 Methyltransferase 0.9536 28 111 GO:0008168
GO:0009058
GO:0032259

Map