F371205

General Info

Members Datasets Scaffolds Average Seq Length
262 217 524 169

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10004240|Ga0307510_100042408
Length 189
Sequence LTRGTEQGHDGIIKIATSSKATNCSMDHFSTYRLTAEKLHDDHLADLVALHLDAEVSRYLGGVRTAEVTKTYLAVNMAHWDRHGFGLWALRKDGSFAGRAGIRHILVDGINEIEIAYTFKREFWGQGLASEIAVALTEIGLSQLELPSLIGLVFVKHGASRRVLEKANYVLEKSTTHHGEDVVIYRIQR

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
165 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
182 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
183 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
184 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
186 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
187 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
188 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
189 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
190 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
191 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
192 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
193 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
194 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
195 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
196 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
197 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
198 2922368715
199 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
200 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
201 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
202 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
203 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
204 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
205 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
206 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
207 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
208 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
209 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
210 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
211 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
212 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
213 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
214 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
215 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
216 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
217 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 0
Isolates 11.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.43
Nodule 8.78
Rhizoplane 8.02
Rhizosphere 48.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10004240 3300033180 Bacteria 16847
2 JGI24750J21931_1042309 3300002070 Bacteria 695
3 rootH1_10115796 3300003323 Bacteria 1149
4 JGI25160J50197_1006827 3300003354 Bacteria 4569
5 JGI25160J50197_1007515 3300003354 Bacteria 4255
6 JGI25404J52841_10027251 3300003659 Bacteria 1229
7 JGI25404J52841_10042057 3300003659 Bacteria 967
8 Ga0055539_1025745 3300003752 Bacteria 684
9 Ga0055531_10001452 3300003794 Bacteria 17483
10 Ga0055543_1011205 3300004625 Bacteria 1846
11 Ga0065165_1001628 3300005262 Bacteria 22844
12 Ga0068869_100169435 3300005334 Bacteria 1705
13 Ga0068868_100803583 3300005338 Bacteria 849
14 Ga0070660_100192084 3300005339 Bacteria 1654
15 Ga0070668_100016303 3300005347 Bacteria 5556
16 Ga0070671_100121099 3300005355 Bacteria 2202
17 Ga0070667_100322011 3300005367 Bacteria 1395
18 Ga0070710_10420160 3300005437 Bacteria 900
19 Ga0070711_100080102 3300005439 Bacteria 2324
20 Ga0070663_100006562 3300005455 Bacteria 7012
21 Ga0070678_100107249 3300005456 Bacteria 2178
22 Ga0070662_100075796 3300005457 Bacteria 2492
23 Ga0070693_100459812 3300005547 Bacteria 895
24 Ga0070665_100007899 3300005548 Bacteria 10792
25 Ga0068855_100319838 3300005563 Bacteria 1715
26 Ga0068855_100957907 3300005563 Bacteria 901
27 Ga0070664_100395083 3300005564 Bacteria 1264
28 Ga0068854_100050833 3300005578 Bacteria 2968
29 Ga0068859_100487399 3300005617 Bacteria 1328
30 Ga0068864_100096941 3300005618 Bacteria 2610
31 Ga0068866_10391149 3300005718 Bacteria 894
32 Ga0081455_10003896 3300005937 Bacteria 16993
33 Ga0081455_10235452 3300005937 Bacteria 1349
34 Ga0081540_1003206 3300005983 Bacteria 13034
35 Ga0081540_1029375 3300005983 Bacteria 3064
36 Ga0081540_1112567 3300005983 Bacteria 1147
37 Ga0075365_10224639 3300006038 Bacteria 1317
38 Ga0075368_10068822 3300006042 Bacteria 1427
39 Ga0075363_100001654 3300006048 Bacteria 8626
40 Ga0075367_10002994 3300006178 Bacteria 7906
41 Ga0097621_100825431 3300006237 Bacteria 860
42 Ga0068871_100189896 3300006358 Bacteria 1769
43 Ga0097620_100487431 3300006931 Bacteria 1328
44 Ga0105245_10055465 3300009098 Bacteria 3559
45 Ga0105247_10532887 3300009101 Bacteria 861
46 Ga0105243_10131284 3300009148 Bacteria 2125
47 Ga0105241_10366971 3300009174 Bacteria 1254
48 Ga0105242_11436888 3300009176 Bacteria 718
49 Ga0105248_10201594 3300009177 Bacteria 2242
50 Ga0105237_10118541 3300009545 Bacteria 2641
51 Ga0105237_10651214 3300009545 Bacteria 1060
52 Ga0105238_11608132 3300009551 Bacteria 680
53 Ga0105239_10075384 3300010375 Bacteria 3709
54 Ga0105239_10276232 3300010375 Bacteria 1890
55 Ga0105246_10481321 3300011119 Bacteria 1050
56 Ga0157374_10294077 3300013296 Bacteria 1606
57 Ga0163162_10047219 3300013306 Bacteria 4315
58 Ga0157375_10011652 3300013308 Bacteria 7768
59 Ga0163163_10015277 3300014325 Bacteria 7094
60 Ga0157379_10270684 3300014968 Bacteria 1545
61 Ga0207425_1020156 3300025245 Bacteria 1429
62 Ga0209677_110141 3300025253 Bacteria 1601
63 Ga0209233_1003949 3300025261 Bacteria 5142
64 Ga0209564_1020850 3300025295 Bacteria 2384
65 Ga0209758_1000141 3300025297 Bacteria 172481
66 Ga0209758_1001151 3300025297 Bacteria 33844
67 Ga0209256_1002728 3300025299 Bacteria 13658
68 Ga0209256_1052262 3300025299 Bacteria 983
69 Ga0207426_1000768 3300025302 Bacteria 35650
70 Ga0207426_1002765 3300025302 Bacteria 10582
71 Ga0207426_1013974 3300025302 Bacteria 2957
72 Ga0209257_1002582 3300025304 Bacteria 17615
73 Ga0207692_10348496 3300025898 Bacteria 912
74 Ga0207710_10260412 3300025900 Bacteria 869
75 Ga0207688_10078332 3300025901 Bacteria 1884
76 Ga0207699_10010996 3300025906 Bacteria 4559
77 Ga0207654_10269608 3300025911 Bacteria 1148
78 Ga0207671_10573227 3300025914 Bacteria 900
79 Ga0207693_10076306 3300025915 Bacteria 2625
80 Ga0207657_10082486 3300025919 Bacteria 2699
81 Ga0207694_10187204 3300025924 Bacteria 1680
82 Ga0207687_10179331 3300025927 Bacteria 1640
83 Ga0207706_10117128 3300025933 Bacteria 2343
84 Ga0207711_10209872 3300025941 Bacteria 1779
85 Ga0207689_10160615 3300025942 Bacteria 1852
86 Ga0207668_10011408 3300025972 Bacteria 5398
87 Ga0207677_10293838 3300026023 Bacteria 1339
88 Ga0207703_10474775 3300026035 Bacteria 1171
89 Ga0207678_10010964 3300026067 Bacteria 7965
90 Ga0207641_11164948 3300026088 Bacteria 770
91 Ga0207676_10083117 3300026095 Bacteria 2607
92 Ga0209813_10018750 3300027866 Bacteria 1915
93 Ga0268266_10088321 3300028379 Bacteria 2713
94 Ga0268264_10826944 3300028381 Bacteria 926
95 Ga0307510_10201746 3300033180 Bacteria 1523
96 Ga0373932_0068028 3300035112 Bacteria 1098
97 Ga0436361_1097725 3300039447 Bacteria 3045
98 Ga0439465_0058604 3300041413 Bacteria 1273
99 Ga0466961_0275082 3300044693 Bacteria 1031
100 Ga0466964_0378994 3300044706 Bacteria 734
101 Ga0466959_0585641 3300045049 Bacteria 751
102 Ga0466967_0069885 3300045976 Bacteria 3140
103 Ga0466967_0106857 3300045976 Bacteria 2566
104 Ga0495603_0146806 3300046455 Bacteria 1371
105 Ga0495590_0069151 3300046457 Bacteria 1238
106 Ga0495651_0018071 3300046462 Bacteria 5458
107 Ga0495651_0068083 3300046462 Bacteria 2714
108 Ga0495605_0445035 3300046474 Bacteria 534
109 Ga0495662_0071465 3300046476 Bacteria 1682
110 Ga0495664_0086474 3300046477 Bacteria 1883
111 Ga0495594_0287558 3300046499 Bacteria 937
112 Ga0495607_0375088 3300046501 Bacteria 652
113 Ga0495606_0004655 3300046507 Bacteria 13567
114 Ga0495606_0021993 3300046507 Bacteria 4662
115 Ga0495608_0124079 3300046511 Bacteria 1655
116 Ga0495610_0048519 3300046512 Bacteria 2084
117 Ga0495628_0120863 3300046516 Bacteria 2010
118 Ga0495648_0011662 3300046524 Bacteria 6603
119 Ga0495652_0008780 3300046529 Bacteria 9200
120 Ga0495652_0465075 3300046529 Bacteria 883
121 Ga0495640_0195949 3300046533 Bacteria 1282
122 Ga0495586_0511715 3300046535 Bacteria 693
123 Ga0495609_0011906 3300046538 Bacteria 4135
124 Ga0495622_0167089 3300046557 Bacteria 990
125 Ga0495622_0183778 3300046557 Bacteria 937
126 Ga0495667_0045770 3300046559 Bacteria 2895
127 Ga0495668_0019112 3300046616 Bacteria 3954
128 Ga0495634_0057397 3300046642 Bacteria 2599
129 Ga0495611_0017845 3300046648 Bacteria 3040
130 Ga0495611_0191283 3300046648 Bacteria 955
131 Ga0495635_0001585 3300046663 Bacteria 15293
132 Ga0495661_0105960 3300046665 Bacteria 1574
133 Ga0495588_0000893 3300046674 Bacteria 13124
134 Ga0495657_0064587 3300046675 Bacteria 2410
135 Ga0495623_0147697 3300046679 Bacteria 1392
136 Ga0495646_0122530 3300046680 Bacteria 1470
137 Ga0495646_0148247 3300046680 Bacteria 1307
138 Ga0495624_0002712 3300046690 Bacteria 13299
139 Ga0495624_0350867 3300046690 Bacteria 887
140 Ga0495649_0478741 3300046694 Bacteria 620
141 Ga0495600_0006259 3300046809 Bacteria 7228
142 Ga0495600_0017438 3300046809 Bacteria 4568
143 Ga0495581_0061294 3300047315 Bacteria 2174
144 Ga0495604_0014494 3300047317 Bacteria 6286
145 Ga0495683_0029174 3300047323 Bacteria 2820
146 Ga0495684_0262683 3300047471 Bacteria 1252
147 Ga0495686_0228106 3300047472 Bacteria 1056
148 Ga0495602_0078256 3300048088 Bacteria 2793
149 Ga0495614_0558096 3300048089 Bacteria 548
150 Ga0496100_0102887 3300048903 Bacteria 1971
151 Ga0496101_0150570 3300048904 Bacteria 1780
152 Ga0496101_0276162 3300048904 Bacteria 1312
153 Ga0496102_0058600 3300048905 Bacteria 3519
154 Ga0496102_0665586 3300048905 Bacteria 964
155 Ga0496104_0026882 3300048907 Bacteria 5319
156 Ga0496104_0039097 3300048907 Bacteria 4441
157 Ga0496105_0000532 3300048908 Bacteria 25166
158 Ga0496105_0003549 3300048908 Bacteria 11565
159 Ga0496106_0014337 3300048909 Bacteria 5856
160 Ga0496107_0445127 3300048910 Bacteria 962
161 Ga0496108_0246212 3300048911 Bacteria 1555
162 Ga0496109_0062015 3300048912 Bacteria 3419
163 Ga0496110_0014753 3300048913 Bacteria 6492
164 Ga0496111_0224005 3300048914 Bacteria 1397
165 Ga0496112_0112094 3300048915 Bacteria 2697
166 Ga0496112_0461271 3300048915 Bacteria 1208
167 Ga0496113_0083570 3300048916 Bacteria 2450
168 Ga0496114_0018168 3300048917 Bacteria 5681
169 Ga0496114_0315022 3300048917 Bacteria 1382
170 Ga0496115_0110573 3300048918 Bacteria 2257
171 Ga0496116_0077634 3300048919 Bacteria 2074
172 Ga0496117_0024795 3300048920 Bacteria 4730
173 Ga0496118_0022273 3300048921 Bacteria 5547
174 Ga0496119_0004863 3300048922 Bacteria 13160
175 Ga0496119_0069817 3300048922 Bacteria 2063
176 Ga0496119_0209000 3300048922 Bacteria 1005
177 Ga0496120_0026627 3300048923 Bacteria 3568
178 Ga0496121_0010040 3300048924 Bacteria 10748
179 Ga0496121_0114174 3300048924 Bacteria 2053
180 Ga0496121_0176506 3300048924 Bacteria 1546
181 Ga0496124_0194672 3300048927 Bacteria 1548
182 Ga0496124_0352182 3300048927 Bacteria 1041
183 Ga0496126_0064990 3300048929 Bacteria 3266
184 Ga0496126_0092533 3300048929 Bacteria 2656
185 Ga0496126_0099432 3300048929 Bacteria 2548
186 Ga0496126_0358458 3300048929 Bacteria 1191
187 Ga0496126_0446948 3300048929 Bacteria 1041
188 nmdc:mga03n38_792_c1 3300050490 Bacteria 8398
189 nmdc:mga0yw44_21976_c1 3300050492 Bacteria 3569
190 nmdc:mga0yw44_445987_c1 3300050492 Bacteria 877
191 nmdc:mga06z11_3226_c1 3300050494 Bacteria 6301
192 nmdc:mga06z11_683346_c1 3300050494 Bacteria 625
193 nmdc:mga04h51_32887_c1 3300050495 Bacteria 1648
194 nmdc:mga07m45_9202_c1 3300050496 Bacteria 5110
195 nmdc:mga0sz30_18673_c2 3300050516 Bacteria 1190
196 Ga0500635_0060757 3300053080 Bacteria 1318
197 Ga0495619_0100535 3300053085 Bacteria 1968
198 Ga0495619_0553200 3300053085 Bacteria 789
199 Ga0500578_0378073 3300053086 Bacteria 822
200 Ga0500643_000197 3300053087 Bacteria 57531
201 Ga0500644_0424089 3300053088 Bacteria 581
202 Ga0500583_0003165 3300053092 Bacteria 5115
203 Ga0500566_0000102 3300053094 Bacteria 43512
204 Ga0500566_0123230 3300053094 Bacteria 1395
205 Ga0500556_0007685 3300053104 Bacteria 3087
206 Ga0500557_000029 3300053105 Bacteria 77152
207 Ga0500595_002891 3300053119 Bacteria 8233
208 Ga0500595_034129 3300053119 Bacteria 1685
209 Ga0500618_000112 3300053125 Bacteria 65643
210 Ga0500642_0029677 3300053130 Bacteria 2268
211 Ga0500652_107464 3300053131 Bacteria 1166
212 Ga0500658_0058244 3300053134 Bacteria 1599
213 Ga0500559_0016611 3300053136 Bacteria 3108
214 Ga0500559_0176453 3300053136 Bacteria 1005
215 Ga0500564_131377 3300053138 Bacteria 1083
216 Ga0500585_073827 3300053144 Bacteria 1232
217 Ga0500604_0098777 3300053151 Bacteria 960
218 Ga0500616_0068049 3300053153 Bacteria 1824
219 Ga0500619_219667 3300053154 Bacteria 633
220 Ga0500622_0019729 3300053156 Bacteria 3579
221 Ga0500627_0255691 3300053158 Bacteria 774
222 Ga0500638_003840 3300053162 Bacteria 5663
223 Ga0500636_0000256 3300053177 Bacteria 29378
224 Ga0500636_0364643 3300053177 Bacteria 684
225 Ga0500611_174222 3300053727 Bacteria 600
226 Ga0500625_074671 3300053729 Bacteria 1497
227 Ga0500645_048931 3300053730 Bacteria 1237
228 Ga0500645_083357 3300053730 Bacteria 911
229 Ga0500601_005168 3300053737 Bacteria 1428
230 Ga0500661_007672 3300055283 Bacteria 1991
231 2508697020 2508501042 Bacteria 8719808
232 2511395661 2511231028 Bacteria 8046582
233 2513637554 2513237094 Bacteria 8789602
234 2517100517 2517093001 Bacteria 9002274
235 2528849900 2528768022 Bacteria 10457665
236 2585146304 2582581279 Bacteria 4980720
237 2824668221 2824661429 Bacteria 9877870
238 2849081462 2849076700 Bacteria 7039503
239 2879102027 2879099564 Bacteria 10442239
240 2885413100 2885409591 Bacteria 9235467
241 2888389031 2888388044 Bacteria 7304136
242 2906632978 2906626472 Bacteria 8826946
243 2922371279
244 2932817064 2932809354 Bacteria 9135765
245 2932822445 2932818245 Bacteria 9955613
246 2935680373 2935675223 Bacteria 9928132
247 2935690118 2935684952 Bacteria 9590419
248 2935722170 2935713505 Bacteria 9608509
249 2935731479 2935722832 Bacteria 9608746
250 2935735433 2935732158 Bacteria 9706831
251 2935745296 2935741537 Bacteria 9707219
252 2935755129 2935750917 Bacteria 9590372
253 2935762354 2935760218 Bacteria 9817913
254 2935811771 2935810662 Bacteria 9401221
255 2935987984 2935984226 Bacteria 8302647
256 2936038354 2936037263 Bacteria 9446081
257 2940561591 2940556831 Bacteria 9590747
258 3005596632 3005594810 Bacteria 8716512
259 3005712706 3005710791 Bacteria 7622528
260 8006930493 8006926726 Bacteria 6749210
261 8016589223 8016583857 Bacteria 10421953
262 8056969943 8056967851 Bacteria 9038162
263 Ga0307510_10004240
264 JGI24750J21931_1042309
265 rootH1_10115796
266 JGI25160J50197_1006827
267 JGI25160J50197_1007515
268 JGI25404J52841_10027251
269 JGI25404J52841_10042057
270 Ga0055539_1025745
271 Ga0055531_10001452
272 Ga0055543_1011205
273 Ga0065165_1001628
274 Ga0068869_100169435
275 Ga0068868_100803583
276 Ga0070660_100192084
277 Ga0070668_100016303
278 Ga0070671_100121099
279 Ga0070667_100322011
280 Ga0070710_10420160
281 Ga0070711_100080102
282 Ga0070663_100006562
283 Ga0070678_100107249
284 Ga0070662_100075796
285 Ga0070693_100459812
286 Ga0070665_100007899
287 Ga0068855_100319838
288 Ga0068855_100957907
289 Ga0070664_100395083
290 Ga0068854_100050833
291 Ga0068859_100487399
292 Ga0068864_100096941
293 Ga0068866_10391149
294 Ga0081455_10003896
295 Ga0081455_10235452
296 Ga0081540_1003206
297 Ga0081540_1029375
298 Ga0081540_1112567
299 Ga0075365_10224639
300 Ga0075368_10068822
301 Ga0075363_100001654
302 Ga0075367_10002994
303 Ga0097621_100825431
304 Ga0068871_100189896
305 Ga0097620_100487431
306 Ga0105245_10055465
307 Ga0105247_10532887
308 Ga0105243_10131284
309 Ga0105241_10366971
310 Ga0105242_11436888
311 Ga0105248_10201594
312 Ga0105237_10118541
313 Ga0105237_10651214
314 Ga0105238_11608132
315 Ga0105239_10075384
316 Ga0105239_10276232
317 Ga0105246_10481321
318 Ga0157374_10294077
319 Ga0163162_10047219
320 Ga0157375_10011652
321 Ga0163163_10015277
322 Ga0157379_10270684
323 Ga0207425_1020156
324 Ga0209677_110141
325 Ga0209233_1003949
326 Ga0209564_1020850
327 Ga0209758_1000141
328 Ga0209758_1001151
329 Ga0209256_1002728
330 Ga0209256_1052262
331 Ga0207426_1000768
332 Ga0207426_1002765
333 Ga0207426_1013974
334 Ga0209257_1002582
335 Ga0207692_10348496
336 Ga0207710_10260412
337 Ga0207688_10078332
338 Ga0207699_10010996
339 Ga0207654_10269608
340 Ga0207671_10573227
341 Ga0207693_10076306
342 Ga0207657_10082486
343 Ga0207694_10187204
344 Ga0207687_10179331
345 Ga0207706_10117128
346 Ga0207711_10209872
347 Ga0207689_10160615
348 Ga0207668_10011408
349 Ga0207677_10293838
350 Ga0207703_10474775
351 Ga0207678_10010964
352 Ga0207641_11164948
353 Ga0207676_10083117
354 Ga0209813_10018750
355 Ga0268266_10088321
356 Ga0268264_10826944
357 Ga0307510_10201746
358 Ga0373932_0068028
359 Ga0436361_1097725
360 Ga0439465_0058604
361 Ga0466961_0275082
362 Ga0466964_0378994
363 Ga0466959_0585641
364 Ga0466967_0069885
365 Ga0466967_0106857
366 Ga0495603_0146806
367 Ga0495590_0069151
368 Ga0495651_0018071
369 Ga0495651_0068083
370 Ga0495605_0445035
371 Ga0495662_0071465
372 Ga0495664_0086474
373 Ga0495594_0287558
374 Ga0495607_0375088
375 Ga0495606_0004655
376 Ga0495606_0021993
377 Ga0495608_0124079
378 Ga0495610_0048519
379 Ga0495628_0120863
380 Ga0495648_0011662
381 Ga0495652_0008780
382 Ga0495652_0465075
383 Ga0495640_0195949
384 Ga0495586_0511715
385 Ga0495609_0011906
386 Ga0495622_0167089
387 Ga0495622_0183778
388 Ga0495667_0045770
389 Ga0495668_0019112
390 Ga0495634_0057397
391 Ga0495611_0017845
392 Ga0495611_0191283
393 Ga0495635_0001585
394 Ga0495661_0105960
395 Ga0495588_0000893
396 Ga0495657_0064587
397 Ga0495623_0147697
398 Ga0495646_0122530
399 Ga0495646_0148247
400 Ga0495624_0002712
401 Ga0495624_0350867
402 Ga0495649_0478741
403 Ga0495600_0006259
404 Ga0495600_0017438
405 Ga0495581_0061294
406 Ga0495604_0014494
407 Ga0495683_0029174
408 Ga0495684_0262683
409 Ga0495686_0228106
410 Ga0495602_0078256
411 Ga0495614_0558096
412 Ga0496100_0102887
413 Ga0496101_0150570
414 Ga0496101_0276162
415 Ga0496102_0058600
416 Ga0496102_0665586
417 Ga0496104_0026882
418 Ga0496104_0039097
419 Ga0496105_0000532
420 Ga0496105_0003549
421 Ga0496106_0014337
422 Ga0496107_0445127
423 Ga0496108_0246212
424 Ga0496109_0062015
425 Ga0496110_0014753
426 Ga0496111_0224005
427 Ga0496112_0112094
428 Ga0496112_0461271
429 Ga0496113_0083570
430 Ga0496114_0018168
431 Ga0496114_0315022
432 Ga0496115_0110573
433 Ga0496116_0077634
434 Ga0496117_0024795
435 Ga0496118_0022273
436 Ga0496119_0004863
437 Ga0496119_0069817
438 Ga0496119_0209000
439 Ga0496120_0026627
440 Ga0496121_0010040
441 Ga0496121_0114174
442 Ga0496121_0176506
443 Ga0496124_0194672
444 Ga0496124_0352182
445 Ga0496126_0064990
446 Ga0496126_0092533
447 Ga0496126_0099432
448 Ga0496126_0358458
449 Ga0496126_0446948
450 nmdc:mga03n38_792_c1
451 nmdc:mga0yw44_21976_c1
452 nmdc:mga0yw44_445987_c1
453 nmdc:mga06z11_3226_c1
454 nmdc:mga06z11_683346_c1
455 nmdc:mga04h51_32887_c1
456 nmdc:mga07m45_9202_c1
457 nmdc:mga0sz30_18673_c2
458 Ga0500635_0060757
459 Ga0495619_0100535
460 Ga0495619_0553200
461 Ga0500578_0378073
462 Ga0500643_000197
463 Ga0500644_0424089
464 Ga0500583_0003165
465 Ga0500566_0000102
466 Ga0500566_0123230
467 Ga0500556_0007685
468 Ga0500557_000029
469 Ga0500595_002891
470 Ga0500595_034129
471 Ga0500618_000112
472 Ga0500642_0029677
473 Ga0500652_107464
474 Ga0500658_0058244
475 Ga0500559_0016611
476 Ga0500559_0176453
477 Ga0500564_131377
478 Ga0500585_073827
479 Ga0500604_0098777
480 Ga0500616_0068049
481 Ga0500619_219667
482 Ga0500622_0019729
483 Ga0500627_0255691
484 Ga0500638_003840
485 Ga0500636_0000256
486 Ga0500636_0364643
487 Ga0500611_174222
488 Ga0500625_074671
489 Ga0500645_048931
490 Ga0500645_083357
491 Ga0500601_005168
492 Ga0500661_007672
493 2508697020
494 2511395661
495 2513637554
496 2517100517
497 2528849900
498 2585146304
499 2824668221
500 2849081462
501 2879102027
502 2885413100
503 2888389031
504 2906632978
505 2922371279
506 2932817064
507 2932822445
508 2935680373
509 2935690118
510 2935722170
511 2935731479
512 2935735433
513 2935745296
514 2935755129
515 2935762354
516 2935811771
517 2935987984
518 2936038354
519 2940561591
520 3005596632
521 3005712706
522 8006930493
523 8016589223
524 8056969943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

33

170

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.9372 124 164
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.9263 124 165
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.925 124 165
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.9222 124 165
7kpp-assembly1.cif.gz_A structure of the e102a mutant of a gnat superfamily pa3944 acetyltransferase 0.9044 3 164
ID Description Score Start End Superfamily
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9429 3 164 3.40.630.30
af_Q2FUT4_1_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.925 5 148 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9222 124 165 3.30.572.10
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9211 3 164 3.40.630.30
af_Q2G0B8_3_165_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9183 4 154 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7C3GH82-F1-model_v4 N-acetyltransferase 0.9799 92 165 GO:0016747
AF-A0A841Q222-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9788 88 164 GO:0016747
AF-A0A2V9CQ62-F1-model_v4 N-acetyltransferase domain-containing protein 0.9743 90 163 GO:0016747
AF-A0A0F5Y996-F1-model_v4 GCN5 family acetyltransferase 0.9738 3 165 GO:0016747
AF-A0A838U5Q7-F1-model_v4 GNAT family N-acetyltransferase 0.9692 88 164 GO:0016747

Map